The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAKSSTSYLVFLLLVLVVAISEIASVNGKVCEKPSKTWFGNCKDTEKCDKRCMEWEGAKH
GACHQRESKYMCFCYFDCDPKKNPGPPPGAPGTPGTPPAPPGGGEGDAPPGGGAPPPAGG
EGGGGGGEGGGGAPPPAGGEGGGGGGDGGGGAPPAA
Sequence Info Allergen Name Length Opt Bits Score E Value
A0A0X9C7K4 Par h 1.0101 156 1179 160.5 2e-41
CBK52317 Amb a 4.0101 164 738 104.8 1.2e-24
ANC85015 Art si 1.0101 132 492 73.7 2.2e-15
ANC85016 Art si 1.0102 132 486 72.9 3.8e-15
ANC85006 Art an 1.0102 132 485 72.8 4.1e-15
ANC85010 Art ca 1.0101 132 484 72.7 4.5e-15
ANC85013 Art la 1.0101 132 472 71.1 1.3e-14
ANC85008 Art ar 1.0101 132 472 71.1 1.3e-14
ANC85009 Art ar 1.0102 132 471 71.0 1.4e-14
ANC85014 Art la 1.0102 132 471 71.0 1.4e-14
AF493943 Art v 1.0101 132 470 70.9 1.5e-14
ANC85011 Art gm 1.0101 132 466 70.4 2.2e-14
AHF71026 Art t 1.0101 108 434 66.3 3.1e-13
AHF71023 Art c 1.0101 108 434 66.3 3.1e-13
AHF71024 Art f 1.0101 108 434 66.3 3.1e-13
AHF71021 Art ab 1.0101 108 433 66.1 3.4e-13
AHF71025 Art l 1.0101 108 421 64.6 9.6e-13
QUJ17885 Api g 7.0101 93 290 48.0 8.2e-08
Q7M1F3 Aes h 1.0101 50 271 45.4 2.8e-07
XP_014059932 Sal s 6.0101 1449 196 37.4 0.0021
XP_014048044 Sal s 6.0102 1449 190 36.6 0.0035
XP_014033985 Sal s 6.0202 1356 185 35.9 0.0052
XP_013998297 Sal s 6.0201 1356 185 35.9 0.0052
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Par h 1.0101 Sequence ID: A0A0X9C7K4

 Score = 160.5 bits 1179,  Expect = 2e-41
 Identities = 156/156 100%, Positives = 156/156 100%, Gaps = 0/156 0%
Query  1    MAKSSTSYLVFLLLVLVVAISEIASVNGKVCEKPSKTWFGNCKDTEKCDKRCMEWEGAKH 60
            MAKSSTSYLVFLLLVLVVAISEIASVNGKVCEKPSKTWFGNCKDTEKCDKRCMEWEGAKH
Sbjct  1    MAKSSTSYLVFLLLVLVVAISEIASVNGKVCEKPSKTWFGNCKDTEKCDKRCMEWEGAKH 60
Query  61   GACHQRESKYMCFCYFDCDPKKNPGPPPGAPGTPGTPPAPPGGGEGDAPPGGGAPPPAGG 120
            GACHQRESKYMCFCYFDCDPKKNPGPPPGAPGTPGTPPAPPGGGEGDAPPGGGAPPPAGG
Sbjct  61   GACHQRESKYMCFCYFDCDPKKNPGPPPGAPGTPGTPPAPPGGGEGDAPPGGGAPPPAGG 120
Query  121  EGGGGGGEGGGGAPPPAGGEGGGGGGDGGGGAPPAA 156
            EGGGGGGEGGGGAPPPAGGEGGGGGGDGGGGAPPAA
Sbjct  121  EGGGGGGEGGGGAPPPAGGEGGGGGGDGGGGAPPAA 156

Sequence Alignment: 2. Allergen Name: Amb a 4.0101 Sequence ID: CBK52317

 Score = 104.8 bits 738,  Expect = 1e-24
 Identities = 102/138 73%, Positives = 110/138 79%, Gaps = 8/138 5%
Query  13   LLVLVVAISEIASVNGKVCEKPSKTWFGNCK--DTEKCDKRCMEWEGAKHGACHQRESKY 70
            LLV+V+AISEIASV GK+CEKPS TW G CK   T+KCDKRC+EWEGAKHGACH+R+SK 
Sbjct  5    LLVFVLAISEIASVKGKLCEKPSVTWSGKCKVKQTDKCDKRCIEWEGAKHGACHKRDSKA 64
Query  71   MCFCYFDCDPKKNPGPPPGAPGTPGTPPAPPGGGEGDAPPGG----GAPPPAGGEGGG-G 125
             CFCYFDCDP KNPGPPPGAP      P+PP GG    P GG    G PPP GGEGGG G
Sbjct  65   TCFCYFDCDPTKNPGPPPGAPKGKAPAPSPPSGGGAPPPSGGEGGDGPPPPEGGEGGGDG 124
Query  126  GGEGGGGAPPPAGGEGGG-GGGDGGG 150
            GGEGGG      GGEGGG GGGDGGG
Sbjct  125  GGEGGGEGGGDGGGEGGGEGGGDGGG 150

Sequence Alignment: 3. Allergen Name: Art si 1.0101 Sequence ID: ANC85015

 Score = 73.7 bits 492,  Expect = 2e-15
 Identities = 70/129 54%, Positives = 86/129 66%, Gaps = 11/129 8%
Query  1    MAKSSTSYLVFLLLVLVVAISEIASVNGKVCEKPSKTWFGNCKDTEKCDKRCMEWEGAKH 60
            MAK S  +   +LL++++AI EI +   K+CEK SKTW G C D +KCDK+C+EWE A+H
Sbjct  1    MAKCSYVFCA-VLLIFILAIGEIEAAGSKLCEKTSKTWSGKC-DNKKCDKKCIEWEKAQH 58
Query  61   GACHQRES-KYMCFCYFDCDPKKNPGPPPGA-PGTPGTPPAPPGGGEGDAPPGGGAPPPA 118
            GACH+RE+ K  CFCYFDC        PPGA P  PG  P P  GG    P  GG+PPP 
Sbjct  59   GACHKREAGKESCFCYFDCSKS-----PPGATPAPPGAAPPPAAGGSPSPPADGGSPPPP 113
Query  119  GGEGGGGGGEGGGGAPPPAG 138
                GG     GG  PPP+G
Sbjct  114  AD--GGSPPADGGSPPPPSG 131

Sequence Alignment: 4. Allergen Name: Art si 1.0102 Sequence ID: ANC85016

 Score = 72.9 bits 486,  Expect = 4e-15
 Identities = 68/127 53%, Positives = 84/127 66%, Gaps = 10/127 7%
Query  1    MAKSSTSYLVFLLLVLVVAISEIASVNGKVCEKPSKTWFGNCKDTEKCDKRCMEWEGAKH 60
            MAK S  +   +LL++V+AI EI +   K+CEK SKTW G C D +KCDK+C+EWE A+H
Sbjct  1    MAKCSYVFCA-VLLIFVLAIGEIEAAGSKLCEKTSKTWSGKC-DNKKCDKKCIEWEKAQH 58
Query  61   GACHQRES-KYMCFCYFDCDPKKNPGPPPGAPGTPGTPPAPPGGGEGDAPPGGGAPPPAG 119
            GACH+RE+ K  CFCYFDC    +  PP   P  PG  P P  GG    P  GG+PPP  
Sbjct  59   GACHKREAGKESCFCYFDC----SKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPA 114
Query  120  GEGGGGGGEGGGGAPPP 136
                GG     GG+PPP
Sbjct  115  D---GGSPPADGGSPPP 128

Sequence Alignment: 5. Allergen Name: Art an 1.0102 Sequence ID: ANC85006

 Score = 72.8 bits 485,  Expect = 4e-15
 Identities = 68/127 53%, Positives = 84/127 66%, Gaps = 10/127 7%
Query  1    MAKSSTSYLVFLLLVLVVAISEIASVNGKVCEKPSKTWFGNCKDTEKCDKRCMEWEGAKH 60
            MAK S  +   +LL++V+AI EI +   K+CEK SKTW G C D +KCDK+C+EWE A+H
Sbjct  1    MAKCSYVFCA-VLLIFVLAIGEIEAAGSKLCEKTSKTWSGKC-DNKKCDKKCIEWEKAQH 58
Query  61   GACHQRES-KYMCFCYFDCDPKKNPGPPPGAPGTPGTPPAPPGGGEGDAPPGGGAPPPAG 119
            GACH+RE+ K  CFCYFDC    +  PP   P  PG  P P  GG    P  GG+PPP  
Sbjct  59   GACHKREAGKESCFCYFDC----SKSPPGATPAPPGAAPPPAAGGSPPPPADGGSPPPPA 114
Query  120  GEGGGGGGEGGGGAPPP 136
                GG     GG+PPP
Sbjct  115  D---GGSPPADGGSPPP 128

Sequence Alignment: 6. Allergen Name: Art ca 1.0101 Sequence ID: ANC85010

 Score = 72.7 bits 484,  Expect = 4e-15
 Identities = 67/127 52%, Positives = 84/127 66%, Gaps = 10/127 7%
Query  1    MAKSSTSYLVFLLLVLVVAISEIASVNGKVCEKPSKTWFGNCKDTEKCDKRCMEWEGAKH 60
            MAK S  +   +LL++++AI EI +   K+CEK SKTW G C D +KCDK+C+EWE A+H
Sbjct  1    MAKCSYVFCA-VLLIFILAIGEIEAAGSKLCEKTSKTWSGKC-DNKKCDKKCIEWEKAQH 58
Query  61   GACHQRES-KYMCFCYFDCDPKKNPGPPPGAPGTPGTPPAPPGGGEGDAPPGGGAPPPAG 119
            GACH+RE+ K  CFCYFDC    +  PP   P  PG  P P  GG    P  GG+PPP  
Sbjct  59   GACHKREAGKESCFCYFDC----SKSPPGATPAPPGAAPPPAAGGSPPPPADGGSPPPPA 114
Query  120  GEGGGGGGEGGGGAPPP 136
                GG     GG+PPP
Sbjct  115  D---GGSPPADGGSPPP 128

Sequence Alignment: 7. Allergen Name: Art la 1.0101 Sequence ID: ANC85013

 Score = 71.1 bits 472,  Expect = 1e-14
 Identities = 66/127 51%, Positives = 84/127 66%, Gaps = 10/127 7%
Query  1    MAKSSTSYLVFLLLVLVVAISEIASVNGKVCEKPSKTWFGNCKDTEKCDKRCMEWEGAKH 60
            MAK S  +   +LL++++AI EI +   K+CEK SKT+ G C D +KCDK+C+EWE A+H
Sbjct  1    MAKCSYVFCA-VLLIFILAIGEIEAAGSKLCEKTSKTYSGKC-DNKKCDKKCIEWEKAQH 58
Query  61   GACHQRES-KYMCFCYFDCDPKKNPGPPPGAPGTPGTPPAPPGGGEGDAPPGGGAPPPAG 119
            GACH+RE+ K  CFCYFDC    +  PP   P  PG  P P  GG    P  GG+PPP  
Sbjct  59   GACHKREAGKESCFCYFDC----SKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPA 114
Query  120  GEGGGGGGEGGGGAPPP 136
                GG     GG+PPP
Sbjct  115  D---GGSPPADGGSPPP 128

Sequence Alignment: 8. Allergen Name: Art ar 1.0101 Sequence ID: ANC85008

 Score = 71.1 bits 472,  Expect = 1e-14
 Identities = 66/127 51%, Positives = 84/127 66%, Gaps = 10/127 7%
Query  1    MAKSSTSYLVFLLLVLVVAISEIASVNGKVCEKPSKTWFGNCKDTEKCDKRCMEWEGAKH 60
            MAK S  +   +LL++++AI EI +   K+CEK SKT+ G C D +KCDK+C+EWE A+H
Sbjct  1    MAKCSYVFCA-VLLIFILAIGEIEAAGSKLCEKTSKTYSGKC-DNKKCDKKCIEWEKAQH 58
Query  61   GACHQRES-KYMCFCYFDCDPKKNPGPPPGAPGTPGTPPAPPGGGEGDAPPGGGAPPPAG 119
            GACH+RE+ K  CFCYFDC    +  PP   P  PG  P P  GG    P  GG+PPP  
Sbjct  59   GACHKREAGKESCFCYFDC----SKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPA 114
Query  120  GEGGGGGGEGGGGAPPP 136
                GG     GG+PPP
Sbjct  115  D---GGSPPADGGSPPP 128

Sequence Alignment: 9. Allergen Name: Art ar 1.0102 Sequence ID: ANC85009

 Score = 71.0 bits 471,  Expect = 1e-14
 Identities = 66/127 51%, Positives = 84/127 66%, Gaps = 10/127 7%
Query  1    MAKSSTSYLVFLLLVLVVAISEIASVNGKVCEKPSKTWFGNCKDTEKCDKRCMEWEGAKH 60
            MAK S  +   +LL++++AI EI +   K+CEK SKT+ G C D +KCDK+C+EWE A+H
Sbjct  1    MAKCSYVFCA-VLLIFILAIGEIEAAGSKLCEKTSKTYSGKC-DNKKCDKKCIEWEKAQH 58
Query  61   GACHQRES-KYMCFCYFDCDPKKNPGPPPGAPGTPGTPPAPPGGGEGDAPPGGGAPPPAG 119
            GACH+RE+ K  CFCYFDC    +  PP   P  PG  P P  GG    P  GG+PPP  
Sbjct  59   GACHKREAGKESCFCYFDC----SKSPPGATPAPPGASPPPAAGGSPPPPADGGSPPPPA 114
Query  120  GEGGGGGGEGGGGAPPP 136
                GG     GG+PPP
Sbjct  115  D---GGSPPADGGSPPP 128

Sequence Alignment: 10. Allergen Name: Art la 1.0102 Sequence ID: ANC85014

 Score = 71.0 bits 471,  Expect = 1e-14
 Identities = 66/127 51%, Positives = 84/127 66%, Gaps = 10/127 7%
Query  1    MAKSSTSYLVFLLLVLVVAISEIASVNGKVCEKPSKTWFGNCKDTEKCDKRCMEWEGAKH 60
            MAK S  +   +LL++++AI EI +   K+CEK SKT+ G C D +KCDK+C+EWE A+H
Sbjct  1    MAKCSYVFCA-VLLIFILAIGEIEAAGSKLCEKTSKTYSGKC-DNKKCDKKCIEWEKAQH 58
Query  61   GACHQRES-KYMCFCYFDCDPKKNPGPPPGAPGTPGTPPAPPGGGEGDAPPGGGAPPPAG 119
            GACH+RE+ K  CFCYFDC    +  PP   P  PG  P P  GG    P  GG+PPP  
Sbjct  59   GACHKREAGKESCFCYFDC----SKSPPGATPAPPGASPPPAAGGSPPPPADGGSPPPPA 114
Query  120  GEGGGGGGEGGGGAPPP 136
                GG     GG+PPP
Sbjct  115  D---GGSPPADGGSPPP 128

Sequence Alignment: 11. Allergen Name: Art v 1.0101 Sequence ID: AF493943

 Score = 70.9 bits 470,  Expect = 2e-14
 Identities = 66/129 51%, Positives = 84/129 65%, Gaps = 9/129 6%
Query  1    MAKSSTSYLVFLLLVLVVAISEIASVNGKVCEKPSKTWFGNCKDTEKCDKRCMEWEGAKH 60
            MAK S  +   +LL+++VAI E+ +   K+CEK SKT+ G C D +KCDK+C+EWE A+H
Sbjct  1    MAKCSYVFCA-VLLIFIVAIGEMEAAGSKLCEKTSKTYSGKC-DNKKCDKKCIEWEKAQH 58
Query  61   GACHQRES-KYMCFCYFDCDPKKNPGPPPGAPGTPGTPPAPPGGGEGDAPPGGGAPPPAG 119
            GACH+RE+ K  CFCYFDC    +  PP   P  PG  P P  GG    P  GG+PPP  
Sbjct  59   GACHKREAGKESCFCYFDC----SKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPA 114
Query  120  GEGGGGGGEGGGGAPPPA 137
               GG     GG  PPP+
Sbjct  115  --DGGSPPVDGGSPPPPS 130

Sequence Alignment: 12. Allergen Name: Art gm 1.0101 Sequence ID: ANC85011

 Score = 70.4 bits 466,  Expect = 2e-14
 Identities = 66/127 51%, Positives = 84/127 66%, Gaps = 10/127 7%
Query  1    MAKSSTSYLVFLLLVLVVAISEIASVNGKVCEKPSKTWFGNCKDTEKCDKRCMEWEGAKH 60
            MAK S  +   +LL++++AI EI +   K+CEK SKT+ G C D +KCDK+C+EWE A+H
Sbjct  1    MAKCSYVFCA-VLLIFLLAIGEIEAAGSKLCEKTSKTYSGKC-DNKKCDKKCIEWEKAQH 58
Query  61   GACHQRES-KYMCFCYFDCDPKKNPGPPPGAPGTPGTPPAPPGGGEGDAPPGGGAPPPAG 119
            GACH+RE+ K  CFCYFDC    +  PP   P  PG  P P  GG    P  GG+PPP  
Sbjct  59   GACHKREAGKESCFCYFDC----SKSPPGATPAPPGAAPPPATGGSPPPPADGGSPPPPA 114
Query  120  GEGGGGGGEGGGGAPPP 136
                GG     GG+PPP
Sbjct  115  D---GGSPPADGGSPPP 128

Sequence Alignment: 13. Allergen Name: Art t 1.0101 Sequence ID: AHF71026

 Score = 66.3 bits 434,  Expect = 3e-13
 Identities = 57/100 57%, Positives = 67/100 67%, Gaps = 9/100 9%
Query  29   KVCEKPSKTWFGNCKDTEKCDKRCMEWEGAKHGACHQRES-KYMCFCYFDCDPKKNPGPP 87
            K+CEK SKTW G C D +KCDK+C+EWE A+HGACH+RE+ K  CFCYFDC    +  PP
Sbjct  4    KLCEKTSKTWSGKC-DNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDC----SKSPP 58
Query  88   PGAPGTPGTPPAPPGGGEGDAPPGGGAPPPAGGEGGGGGGEGGGGAPPP 136
               P  PG  P P  GG    P  GG+PPP      GG     GG+PPP
Sbjct  59   GATPAPPGAAPPPAAGGSPPPPTDGGSPPPPA---DGGSPPADGGSPPP 104

Sequence Alignment: 14. Allergen Name: Art c 1.0101 Sequence ID: AHF71023

 Score = 66.3 bits 434,  Expect = 3e-13
 Identities = 57/100 57%, Positives = 67/100 67%, Gaps = 9/100 9%
Query  29   KVCEKPSKTWFGNCKDTEKCDKRCMEWEGAKHGACHQRES-KYMCFCYFDCDPKKNPGPP 87
            K+CEK SKTW G C D +KCDK+C+EWE A+HGACH+RE+ K  CFCYFDC    +  PP
Sbjct  4    KLCEKTSKTWSGKC-DNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDC----SKSPP 58
Query  88   PGAPGTPGTPPAPPGGGEGDAPPGGGAPPPAGGEGGGGGGEGGGGAPPP 136
               P  PG  P P  GG    P  GG+PPP      GG     GG+PPP
Sbjct  59   GATPAPPGAAPPPAAGGSPPPPADGGSPPPPA---DGGSPPADGGSPPP 104

Sequence Alignment: 15. Allergen Name: Art f 1.0101 Sequence ID: AHF71024

 Score = 66.3 bits 434,  Expect = 3e-13
 Identities = 57/100 57%, Positives = 67/100 67%, Gaps = 9/100 9%
Query  29   KVCEKPSKTWFGNCKDTEKCDKRCMEWEGAKHGACHQRES-KYMCFCYFDCDPKKNPGPP 87
            K+CEK SKTW G C D +KCDK+C+EWE A+HGACH+RE+ K  CFCYFDC    +  PP
Sbjct  4    KLCEKTSKTWSGKC-DNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDC----SKSPP 58
Query  88   PGAPGTPGTPPAPPGGGEGDAPPGGGAPPPAGGEGGGGGGEGGGGAPPP 136
               P  PG  P P  GG    P  GG+PPP      GG     GG+PPP
Sbjct  59   GATPAPPGAAPPPAAGGSPPPPTDGGSPPPPA---DGGSPPADGGSPPP 104

Sequence Alignment: 16. Allergen Name: Art ab 1.0101 Sequence ID: AHF71021

 Score = 66.1 bits 433,  Expect = 3e-13
 Identities = 57/100 57%, Positives = 66/100 66%, Gaps = 9/100 9%
Query  29   KVCEKPSKTWFGNCKDTEKCDKRCMEWEGAKHGACHQRES-KYMCFCYFDCDPKKNPGPP 87
            K+CEK SKTW G C D +KCDK+C+EWE A+HGACH+RE+ K  CFCYFDC    +  PP
Sbjct  4    KLCEKTSKTWSGKC-DNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDC----SKSPP 58
Query  88   PGAPGTPGTPPAPPGGGEGDAPPGGGAPPPAGGEGGGGGGEGGGGAPPP 136
               P  PG  P P  GG    P  GG PPP      GG     GG+PPP
Sbjct  59   GATPAPPGASPPPAAGGSPPPPADGGTPPPPA---DGGSPPADGGSPPP 104

Sequence Alignment: 17. Allergen Name: Art l 1.0101 Sequence ID: AHF71025

 Score = 64.6 bits 421,  Expect = 1e-12
 Identities = 56/100 56%, Positives = 67/100 67%, Gaps = 9/100 9%
Query  29   KVCEKPSKTWFGNCKDTEKCDKRCMEWEGAKHGACHQRES-KYMCFCYFDCDPKKNPGPP 87
            K+CEK SKT+ G C D +KCDK+C+EWE A+HGACH+RE+ K  CFCYFDC    +  PP
Sbjct  4    KLCEKTSKTYSGKC-DNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDC----SKSPP 58
Query  88   PGAPGTPGTPPAPPGGGEGDAPPGGGAPPPAGGEGGGGGGEGGGGAPPP 136
               P  PG  P P  GG    P  GG+PPP      GG     GG+PPP
Sbjct  59   GATPAPPGAAPPPAAGGSPPPPTDGGSPPPPA---DGGSPPADGGSPPP 104

Sequence Alignment: 18. Allergen Name: Api g 7.0101 Sequence ID: QUJ17885

 Score = 48.0 bits 290,  Expect = 8e-08
 Identities = 39/74 52%, Positives = 56/74 75%, Gaps = 9/74 12%
Query  5    STSYLVFLLLVLVVAISEIA--SVNGKV------CEKPSKTWFGNCKDTEKCDKRCMEWE 56
            S  +L+FL+    V +++ A  +  G+V      CEKPS+TW G C +T+ CD +C++WE
Sbjct  11   SAIFLLFLVASYSVGVAQGARAATEGEVVYPEALCEKPSQTWTGKCGNTKNCDNQCIQWE 70
Query  57   GAKHGACHQRESKYMCFCYFD-C 78
             A+HGACH+R  K+MCFCYFD C
Sbjct  71   TARHGACHKRGGKWMCFCYFDRC 93

Sequence Alignment: 19. Allergen Name: Aes h 1.0101 Sequence ID: Q7M1F3

 Score = 45.4 bits 271,  Expect = 3e-07
 Identities = 30/49 61%, Positives = 40/49 81%, Gaps = 1/49 2%
Query  30   VC-EKPSKTWFGNCKDTEKCDKRCMEWEGAKHGACHQRESKYMCFCYFDC 78
            +C E+PS+TW GNC +T  CDK+C +WE A HGACH+RE+ + CFCYF+C
Sbjct  1    LCNERPSQTWSGNCGNTAHCDKQCQDWEKASHGACHKRENHWKCFCYFNC 50

Sequence Alignment: 20. Allergen Name: Sal s 6.0101 Sequence ID: XP_014059932

 Score = 37.4 bits 196,  Expect = 0.002
 Identities = 39/71 54%, Positives = 40/71 56%, Gaps = 16/71 22%
Query  84   PGPPPGAPGTPGT---PPAP-PGGGEGDAPPGGGAPPPAGGEGGGGGGEGGGGAPPPAG- 138
            PG P GA G PG      AP P G  G  PPGG   P A GE G  G +G GGA  PAG 
Sbjct  774  PGGPTGARGAPGERGESGAPGPAGFAG--PPGGDGQPGAKGEAGDNGAKGDGGAQGPAGP 831
Query  139  -------GEGGGGGGDGGGGA--PPAA 156
                   G  G  G  G  GA  PP A
Sbjct  832  TGAPGPQGPAGNTGAKGARGAAGPPGA 858

Sequence Alignment: 21. Allergen Name: Sal s 6.0102 Sequence ID: XP_014048044

 Score = 36.6 bits 190,  Expect = 0.004
 Identities = 35/65 53%, Positives = 35/65 53%, Gaps = 10/65 15%
Query  87   PPGAPGTPGT-----PPAPPGGGEGDAPPG-GGAPPPAG--GEGGGGG--GEGGGGAPPP 136
            PPGA G PG      PP P G      PPG GG     G  GE G  G  GE G   PP 
Sbjct  855  PPGATGFPGAAGRVGPPGPSGNNGPPGPPGPGGKEGQKGNRGETGPAGRPGELGAAGPPG 914
Query  137  AGGEGGGGGGDGGGG 151
            A GE G  GGDG  G
Sbjct  915  AQGEKGQPGGDGPNG 929

Sequence Alignment: 22. Allergen Name: Sal s 6.0202 Sequence ID: XP_014033985

 Score = 35.9 bits 185,  Expect = 0.005
 Identities = 36/66 54%, Positives = 37/66 56%, Gaps = 11/66 16%
Query  84   PGP--PPGAPGTPGTP-PAPPGGGEGDAPPGGGAPPPAGGEG--GGGGGEGGGGAPPPAG 138
            PGP  P G PG  G P P  PGG  G     GG   P G  G  GG G +G  GAP PAG
Sbjct  474  PGPTGPRGQPGNIGFPGPKGPGGEAGK----GGDKGPTGATGLRGGPGADGNNGAPGPAG 529
Query  139  --GEGGGGGGDGGGGAP 153
              G  G  G  G  GAP
Sbjct  530  VVGNAGEKGEQGPSGAP 546

Sequence Alignment: 23. Allergen Name: Sal s 6.0201 Sequence ID: XP_013998297

 Score = 35.9 bits 185,  Expect = 0.005
 Identities = 36/66 54%, Positives = 37/66 56%, Gaps = 11/66 16%
Query  84   PGP--PPGAPGTPGTP-PAPPGGGEGDAPPGGGAPPPAGGEG--GGGGGEGGGGAPPPAG 138
            PGP  P G PG  G P P  PGG  G     GG   P G  G  GG G +G  GAP PAG
Sbjct  474  PGPTGPRGQPGNIGFPGPKGPGGEAGK----GGDKGPTGATGLRGGPGADGNNGAPGPAG 529
Query  139  --GEGGGGGGDGGGGAP 153
              G  G  G  G  GAP
Sbjct  530  VVGNAGEKGEQGPSGAP 546

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.