The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MALLSYVTRKTLTESLRLGLKSHVRGLQTFTLPDLPYEYGALEPAISSEIMQLHHQKHHQ
TYITNYNKALEQLDQAINKGDASAVVKLQSAIKFNGGGHINHSIFWKNLTPVSEGGGEPP
HGSLGWAIDTNFGSMEALIQRMNAEGAALQGSGWVWLGLDKESKKLVVETTANQDPLVTK
GPSLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKYAGELYQKECP
Sequence Info Allergen Name Length Opt Bits Score E Value
EF470980 Pis v 4.0101 230 1554 361.0 1.9e-101
AAA16792 Hev b 10.0101 233 1313 306.0 6.5e-85
CAB53458 Hev b 10.0102 205 1251 292.0 9.9e-81
CAC13961 Hev b 10.0103 205 1250 291.7 1.2e-80
Q92450 Asp f 6 210 652 155.4 1.3e-39
AAB60779 Asp f 6 221 652 155.4 1.4e-39
CAD68071 Mala s 11 237 647 154.2 3.3e-39
P86254 Alt a 14.0101 25 122 38.5 2.4e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pis v 4.0101 Sequence ID: EF470980

 Score = 361.0 bits 1554,  Expect = 2e-101
 Identities = 230/230 100%, Positives = 230/230 100%, Gaps = 0/230 0%
Query  1    MALLSYVTRKTLTESLRLGLKSHVRGLQTFTLPDLPYEYGALEPAISSEIMQLHHQKHHQ 60
            MALLSYVTRKTLTESLRLGLKSHVRGLQTFTLPDLPYEYGALEPAISSEIMQLHHQKHHQ
Sbjct  1    MALLSYVTRKTLTESLRLGLKSHVRGLQTFTLPDLPYEYGALEPAISSEIMQLHHQKHHQ 60
Query  61   TYITNYNKALEQLDQAINKGDASAVVKLQSAIKFNGGGHINHSIFWKNLTPVSEGGGEPP 120
            TYITNYNKALEQLDQAINKGDASAVVKLQSAIKFNGGGHINHSIFWKNLTPVSEGGGEPP
Sbjct  61   TYITNYNKALEQLDQAINKGDASAVVKLQSAIKFNGGGHINHSIFWKNLTPVSEGGGEPP 120
Query  121  HGSLGWAIDTNFGSMEALIQRMNAEGAALQGSGWVWLGLDKESKKLVVETTANQDPLVTK 180
            HGSLGWAIDTNFGSMEALIQRMNAEGAALQGSGWVWLGLDKESKKLVVETTANQDPLVTK
Sbjct  121  HGSLGWAIDTNFGSMEALIQRMNAEGAALQGSGWVWLGLDKESKKLVVETTANQDPLVTK 180
Query  181  GPSLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKYAGELYQKECP 230
            GPSLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKYAGELYQKECP
Sbjct  181  GPSLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKYAGELYQKECP 230

Sequence Alignment: 2. Allergen Name: Hev b 10.0101 Sequence ID: AAA16792

 Score = 306.0 bits 1313,  Expect = 7e-85
 Identities = 193/229 84%, Positives = 209/229 91%, Gaps = 3/229 1%
Query  1    MALLSYVTRKTLTESLR--LGLKSHVRGLQTFTLPDLPYEYGALEPAISSEIMQLHHQKH 58
            MAL S VTRK L  +++   GL  ++RGLQTF+LPDLPY+YGALEPAIS EIMQLHHQKH
Sbjct  1    MALRSLVTRKNLPSAFKAATGL-GQLRGLQTFSLPDLPYDYGALEPAISGEIMQLHHQKH 59
Query  59   HQTYITNYNKALEQLDQAINKGDASAVVKLQSAIKFNGGGHINHSIFWKNLTPVSEGGGE 118
            HQTYITNYNKALEQL+ AI KGD++AVVKLQSAIKFNGGGH+NHSIFWKNL PV EGGGE
Sbjct  60   HQTYITNYNKALEQLNDAIEKGDSAAVVKLQSAIKFNGGGHVNHSIFWKNLAPVREGGGE 119
Query  119  PPHGSLGWAIDTNFGSMEALIQRMNAEGAALQGSGWVWLGLDKESKKLVVETTANQDPLV 178
             PHGSLGWAID +FGS+E LIQ MNAEGAALQGSGWVWL LDKE KKLVVETTANQDPLV
Sbjct  120  LPHGSLGWAIDADFGSLEKLIQLMNAEGAALQGSGWVWLALDKELKKLVVETTANQDPLV 179
Query  179  TKGPSLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKYAGELYQKECP 230
            TKGP+LVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKV+NWKYA E+Y KECP
Sbjct  180  TKGPTLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVMNWKYASEVYAKECP 231

Sequence Alignment: 3. Allergen Name: Hev b 10.0102 Sequence ID: CAB53458

 Score = 292.0 bits 1251,  Expect = 1e-80
 Identities = 178/203 87%, Positives = 189/203 93%, Gaps = 0/203 0%
Query  28   QTFTLPDLPYEYGALEPAISSEIMQLHHQKHHQTYITNYNKALEQLDQAINKGDASAVVK 87
            QTF+LPDLPY+YGALEPAIS EIMQLHHQKHHQTYITNYNKALEQL+ AI KGD++AVVK
Sbjct  1    QTFSLPDLPYDYGALEPAISGEIMQLHHQKHHQTYITNYNKALEQLNDAIEKGDSAAVVK 60
Query  88   LQSAIKFNGGGHINHSIFWKNLTPVSEGGGEPPHGSLGWAIDTNFGSMEALIQRMNAEGA 147
            LQSAIKFNGGGH+NHSIFWKNL PV EGGGE PHGSLGWAID +FGS+E LIQ MNAEG 
Sbjct  61   LQSAIKFNGGGHVNHSIFWKNLAPVREGGGELPHGSLGWAIDADFGSLEKLIQLMNAEGV 120
Query  148  ALQGSGWVWLGLDKESKKLVVETTANQDPLVTKGPSLVPLLGIDVWEHAYYLQYKNVRPD 207
            ALQGSGWVWL LDKE KKLVVETTANQDPLVTKGP+LVPLLGIDVWEHAYYLQYKNVRPD
Sbjct  121  ALQGSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPD 180
Query  208  YLKNIWKVINWKYAGELYQKECP 230
            YLKNIWKV+NWKYA E+Y KECP
Sbjct  181  YLKNIWKVMNWKYASEVYAKECP 203

Sequence Alignment: 4. Allergen Name: Hev b 10.0103 Sequence ID: CAC13961

 Score = 291.7 bits 1250,  Expect = 1e-80
 Identities = 178/203 87%, Positives = 190/203 93%, Gaps = 0/203 0%
Query  28   QTFTLPDLPYEYGALEPAISSEIMQLHHQKHHQTYITNYNKALEQLDQAINKGDASAVVK 87
            QTF+LPDLPY+YGALEPAIS EIMQLHHQKHHQTYITNYNKALEQL+ AI KGD++AVVK
Sbjct  1    QTFSLPDLPYDYGALEPAISGEIMQLHHQKHHQTYITNYNKALEQLNDAIEKGDSAAVVK 60
Query  88   LQSAIKFNGGGHINHSIFWKNLTPVSEGGGEPPHGSLGWAIDTNFGSMEALIQRMNAEGA 147
            LQSAIKFNGGGH+NHSIFWKNL PV EGGGE PHGSLGWAID +FGS+E LIQ MNAEGA
Sbjct  61   LQSAIKFNGGGHVNHSIFWKNLAPVREGGGELPHGSLGWAIDADFGSLEKLIQLMNAEGA 120
Query  148  ALQGSGWVWLGLDKESKKLVVETTANQDPLVTKGPSLVPLLGIDVWEHAYYLQYKNVRPD 207
            AL+GSGWVWL LDKE KKLVVETTANQDPLVTKGP+LVPLLGIDVWEHAYYLQYKNVRPD
Sbjct  121  ALRGSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPD 180
Query  208  YLKNIWKVINWKYAGELYQKECP 230
            YLKNIWKV+NWKYA E+Y KECP
Sbjct  181  YLKNIWKVMNWKYASEVYAKECP 203

Sequence Alignment: 5. Allergen Name: Asp f 6 Sequence ID: Q92450

 Score = 155.4 bits 652,  Expect = 1e-39
 Identities = 99/194 51%, Positives = 125/194 64%, Gaps = 5/194 2%
Query  28   QTFTLPDLPYEYGALEPAISSEIMQLHHQKHHQTYITNYNKALEQLDQAINKGDASAVVK 87
            Q +TLP LPY Y AL+P IS +IM+LHH+KHHQTY+   N ALE   +A    D   +V 
Sbjct  3    QQYTLPPLPYPYDALQPYISQQIMELHHKKHHQTYVNGLNAALEAQKKAAEATDVPKLVS 62
Query  88   LQSAIKFNGGGHINHSIFWKNLTPVSEGGGEPPHGS-LGWAIDTNFGSMEALIQRMNAEG 146
            +Q AIKFNGGGHINHS+FWKNL P   GGG+  +   L  AI+  +GS + +    N   
Sbjct  63   VQQAIKFNGGGHINHSLFWKNLAPEKSGGGKIDQAPVLKAAIEQRWGSFDKFKDAFNTTL 122
Query  147  AALQGSGWVWLGLDKESKKLVVETTANQDPLVTKGPSLVPLLGIDVWEHAYYLQYKNVRP 206
              +QGSGW WL  D    KL + TT +QDP+   G +  P++G+D+WEHAYYLQY N + 
Sbjct  123  LGIQGSGWGWLVTDGPKGKLDITTTHDQDPVT--GAA--PVFGVDMWEHAYYLQYLNDKA 178
Query  207  DYLKNIWKVINWKYAGELY 225
             Y K IW VINW  A   Y
Sbjct  179  SYAKGIWNVINWAEAENRY 197

Sequence Alignment: 6. Allergen Name: Asp f 6 Sequence ID: AAB60779

 Score = 155.4 bits 652,  Expect = 1e-39
 Identities = 99/194 51%, Positives = 125/194 64%, Gaps = 5/194 2%
Query  28   QTFTLPDLPYEYGALEPAISSEIMQLHHQKHHQTYITNYNKALEQLDQAINKGDASAVVK 87
            Q +TLP LPY Y AL+P IS +IM+LHH+KHHQTY+   N ALE   +A    D   +V 
Sbjct  14   QQYTLPPLPYPYDALQPYISQQIMELHHKKHHQTYVNGLNAALEAQKKAAEATDVPKLVS 73
Query  88   LQSAIKFNGGGHINHSIFWKNLTPVSEGGGEPPHGS-LGWAIDTNFGSMEALIQRMNAEG 146
            +Q AIKFNGGGHINHS+FWKNL P   GGG+  +   L  AI+  +GS + +    N   
Sbjct  74   VQQAIKFNGGGHINHSLFWKNLAPEKSGGGKIDQAPVLKAAIEQRWGSFDKFKDAFNTTL 133
Query  147  AALQGSGWVWLGLDKESKKLVVETTANQDPLVTKGPSLVPLLGIDVWEHAYYLQYKNVRP 206
              +QGSGW WL  D    KL + TT +QDP+   G +  P++G+D+WEHAYYLQY N + 
Sbjct  134  LGIQGSGWGWLVTDGPKGKLDITTTHDQDPVT--GAA--PVFGVDMWEHAYYLQYLNDKA 189
Query  207  DYLKNIWKVINWKYAGELY 225
             Y K IW VINW  A   Y
Sbjct  190  SYAKGIWNVINWAEAENRY 208

Sequence Alignment: 7. Allergen Name: Mala s 11 Sequence ID: CAD68071

 Score = 154.2 bits 647,  Expect = 3e-39
 Identities = 101/218 46%, Positives = 137/218 62%, Gaps = 10/218 4%
Query  1    MALLSYVTRKTLTESLRLGLKSHVRGLQTFTLPDLPYEYGALEPAISSEIMQLHHQKHHQ 60
            + + S  +R+  T  +R+  ++  R     TLP LPYEY ALEP IS++IM +HH KHHQ
Sbjct  13   LPIHSLFSRR--TRLFRFS-RTAARAGTEHTLPPLPYEYNALEPFISADIMMVHHGKHHQ 69
Query  61   TYITNYNKALEQLDQAINKGDASAVVKLQSAIKFNGGGHINHSIFWKNLTPVSEGGGEPP 120
            TY+ N N + +  + A+   D    ++L +A+KFNGGGH+NH++FWK + P S+GGG+  
Sbjct  70   TYVNNLNASTKAYNDAVQAQDVLKQMELLTAVKFNGGGHVNHALFWKTMAPQSQGGGQLN 129
Query  121  HGSLGWAIDTNFGSMEALIQRMNAEGAALQGSGWVWLGLDKE-SKKLVVETTANQDPLVT 179
             G L  AID  FG  E +     A+   +QGSGW WLGL K  S  LVV    +QD L T
Sbjct  130  DGPLKQAIDKEFGDFEKFKAAFTAKALGIQGSGWCWLGLSKTGSLDLVV--AKDQDTLTT 187
Query  180  KGPSLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKYAGELYQK 227
              P    ++G D WEHA+YLQYKN +  YLK  W V+NW  A   Y +
Sbjct  188  HHP----IIGWDGWEHAWYLQYKNDKASYLKQWWNVVNWSEAESRYSE 231

Sequence Alignment: 8. Allergen Name: Alt a 14.0101 Sequence ID: P86254

 Score = 38.5 bits 122,  Expect = 2e-05
 Identities = 15/20 75%, Positives = 17/20 85%, Gaps = 0/20 0%
Query  94   FNGGGHINHSIFWKNLTPVS 113
            FN GGHINHS+FW+NL P S
Sbjct  1    FNAGGHINHSLFWQNLAPAS 20

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.