The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MALTLQRALSELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSDWSPAVATWYGPAN
GDGSEGGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVV
ITDECAGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRSIAFH
VDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPF
SIKLTTLESGQTIVANNVIPAGWTPGQTYRSIVNFAT
Sequence Info Allergen Name Length Opt Bits Score E Value
AAA50175 Gly m 2 277 1896 400.2 4.3e-113
AAF72986 Ory s 1 275 954 205.5 1.7e-54
AAF72987 Ory s 1 275 903 195.0 2.5e-51
AAF72984 Ory s 1 268 877 189.6 1e-49
AAF72989 Ory s 1 271 816 177.0 6.3e-46
AAF72991 Ory s 1 267 801 173.9 5.3e-45
AAF72990 Ory s 1 269 800 173.7 6.2e-45
AAD10496 Tri a ps93 271 792 172.0 2e-44
AAF72985 Ory s 1 286 786 170.8 5e-44
P58738 Zea m 1 269 775 168.5 2.2e-43
ACA23876 Pas n 1.0101 265 772 167.9 3.4e-43
AAB61710 Ory s 1 261 766 166.7 7.8e-43
P43213 Phl p 1 263 759 165.2 2.1e-42
AAF72983 Ory s 1 267 759 165.2 2.2e-42
CAA10140 Hol l 1 263 750 163.4 7.8e-42
CAA81613 Phl p 1.0101 263 748 163.0 1e-41
A0A4D6G2J8 Uro m 1.0201 229 741 161.6 2.3e-41
P43216 Hol l 1 265 730 159.2 1.4e-40
CAA10520 Poa p a 263 725 158.2 2.8e-40
QCX36431 Zoy m 1.0101 272 723 157.8 3.9e-40
CAA93121 Hol l 1.0102 248 722 157.6 4e-40
O04701 Cyn d 1 246 719 157.0 6e-40
AAL14079 Cyn d 1.0203 262 719 157.0 6.6e-40
A0A4D6FZ45 Uro m 1.0101 262 719 157.0 6.6e-40
Q41260 Pha a 1 269 715 156.1 1.2e-39
AAL14077 Cyn d 1.0202 262 706 154.3 4.2e-39
CAB63699 Lol p 1.0103 263 704 153.9 5.6e-39
AAA63279 Lol p 1.0101 263 704 153.9 5.6e-39
P14946 Lol p 1 263 701 153.3 8.7e-39
AAA63278 Lol p 1.0102 252 700 153.1 9.4e-39
AAF72988 Ory s 1 327 702 153.4 1e-38
AAK96255 Cyn d 1.0201 244 688 150.6 5e-38
AAF80379 Cyn d 1.0204 244 688 150.6 5e-38
AAL14078 Cyn d 1 262 688 150.6 5.6e-38
ABC58726 Sor h 1.0101 239 655 143.8 5.5e-36
Q07154 Zea m 1 191 627 138.1 2.2e-34
Q40638 Ory s 1 263 617 135.9 1.5e-33
CAB37496 Ara t expansin 265 405 92.1 2.3e-20
AAG13596 Ory s 1 275 350 80.7 6.3e-17
BAA85432 Ory s 1 284 342 79.0 2.1e-16
CAA10346 Cyn d 2 122 231 56.5 5.2e-10
CAA10345 Dac g 2 122 229 56.1 7e-10
CAA10348 Poa p 2 122 229 56.1 7e-10
P43214 Phl p 2 122 229 56.1 7e-10
P14947 Lol p 2 97 193 48.8 8.8e-08
CAA51775 Lol p 2 88 173 44.7 1.4e-06
2JNZ_A Phl p 3.0101 108 161 42.1 1e-05
P93124 Dac g 3 96 153 40.6 2.7e-05
P14948 Lol p 3 97 147 39.3 6.4e-05
AAP80171 Cyn d 15 112 139 37.6 0.00025
CAA90746 Tri a 3 118 136 36.9 0.00041
A0A077B7S9 Sor h 2.0101 119 115 32.6 0.0083
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 400.2 bits 1896,  Expect = 4e-113
 Identities = 277/277 100%, Positives = 277/277 100%, Gaps = 0/277 0%
Query  1    MALTLQRALSELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSDWSPAVATWYGPAN 60
            MALTLQRALSELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSDWSPAVATWYGPAN
Sbjct  1    MALTLQRALSELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSDWSPAVATWYGPAN 60
Query  61   GDGSEGGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVV 120
            GDGSEGGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVV
Sbjct  61   GDGSEGGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVV 120
Query  121  ITDECAGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRSIAFH 180
            ITDECAGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRSIAFH
Sbjct  121  ITDECAGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRSIAFH 180
Query  181  VDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPF 240
            VDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPF
Sbjct  181  VDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPF 240
Query  241  SIKLTTLESGQTIVANNVIPAGWTPGQTYRSIVNFAT 277
            SIKLTTLESGQTIVANNVIPAGWTPGQTYRSIVNFAT
Sbjct  241  SIKLTTLESGQTIVANNVIPAGWTPGQTYRSIVNFAT 277

Sequence Alignment: 2. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 205.5 bits 954,  Expect = 2e-54
 Identities = 141/255 55%, Positives = 188/255 73%, Gaps = 16/255 6%
Query  18   ILSIFLVIPSFCFNPKKLYNASYYSPSSSD--------WSPAVATWYGPANGDGSEGGAC 69
            ++++++ +P + + P   Y  +Y +   S         WS   ATWYG   GDGSEGGAC
Sbjct  8    VFAVLVALPILSL-PVSGYEQNYTAGRRSTMSLGRGYGWSSGGATWYGGPQGDGSEGGAC 66
Query  70   GYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECAG-- 127
            GY +AVGQ PFSS+I+AG P ++ +GKGCGSCY++KCTGN ACSG PV VVITD C G  
Sbjct  67   GYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVTVVITDSCPGGV 126
Query  128  CGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRSIAFHVDSGSNQ 187
            C ++A  HFD+SG AFGAMA  G  + LR+AG + IQ++R+ C +   ++AF VD+GSN 
Sbjct  127  CLNEAA-HFDMSGTAFGAMANRGMGDRLRSAGVLKIQYKRVPCRF-AMNVAFKVDAGSNP 184
Query  188  EYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDK--GSPLRAPFSIKLT 245
             Y+A LV+Y +GDGDLA V + +A   G W +MQQSWGA W+++   G PL  PFSI+LT
Sbjct  185  YYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGKPLSPPFSIRLT 244
Query  246  TLESGQTIVANNVIPAGWTPGQTYRSIVNFA 276
            +  SG+ +VANNVIP+GW  G TYRS VN+A
Sbjct  245  S-GSGKVLVANNVIPSGWQAGLTYRSTVNYA 274

Sequence Alignment: 3. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 195.0 bits 903,  Expect = 3e-51
 Identities = 138/265 52%, Positives = 184/265 69%, Gaps = 12/265 4%
Query  7    RALSELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSDWSPAVATWYGPANGDGSE- 65
            R  S++  ++AILS+ LV+   C      YN S  S   S W PA ATWYG   G G + 
Sbjct  4    RMGSKVAAILAILSV-LVVHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPDD 62
Query  66   -GGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDE 124
             GGACG+ N V Q PFSS+ S G+  I+  GKGCGSCY+++C  + +CSGN   V+ITD 
Sbjct  63   NGGACGFKN-VNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITD- 120
Query  125  CAGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRSIAFHVDSG 184
                   A+YHFDLSG AFGAMA  G ++ LR++G I+IQ RR+ CNYPG  I FHV+ G
Sbjct  121  -MNYYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPGLKINFHVEEG 179
Query  185  SNQEYFATLVEYEDGDGDLAKVELKEALD-----SGSWDSMQQSWGAVWKFDKGSPLRAP 239
            SN  YFA LVEYED DGD+ +V+L E+       +G W  M++SWG++W++D    L+AP
Sbjct  180  SNPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAP 239
Query  240  FSIKLTTLESGQTIVANNVIPAGWTPGQTYRSIVNFA 276
            FS+++ + +SG+T+VANNVIPA W+P   YRSIV F+
Sbjct  240  FSLRIRS-DSGKTLVANNVIPANWSPNSNYRSIVQFS 275

Sequence Alignment: 4. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 189.6 bits 877,  Expect = 1e-49
 Identities = 129/256 50%, Positives = 177/256 69%, Gaps = 8/256 3%
Query  16   IAILSIFLVIPSFCFNPKKLYNASYYSPSSSDWSPAVATWYGPANGDG--SEGGACGYGN 73
            +A L  FLV+          ++AS ++ +  +W  A ATWYG   G G   +GGACG+ N
Sbjct  11   VAALFSFLVVTCVAGARPGNFSASDFT-ADPNWEVARATWYGAPTGAGPDDDGGACGFKN 69
Query  74   AVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECAGCGSDAQ 133
               Q PFSS+ S G+  I+  GKGCGSCY+++C  + ACSGNP  V+ITD        ++
Sbjct  70   T-NQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITD--MNYYPVSK 126
Query  134  YHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRSIAFHVDSGSNQEYFATL 193
            YHFDLSG AFGAMA  GQ++ LR+AG I+IQ +R+ CN+PG  + FHV+ GSN  YFA L
Sbjct  127  YHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPGLKVTFHVEEGSNPVYFAVL 186
Query  194  VEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLTTLESGQTI 253
            VEYEDGDGD+ +V+L EA +S SW  M++SWG++W++D    L APFS+++T  ESG+ +
Sbjct  187  VEYEDGDGDVVQVDLMEA-NSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITN-ESGKQL 244
Query  254  VANNVIPAGWTPGQTYRSIVNFAT 277
            VA+ VIPA W P   YRS V +++
Sbjct  245  VASQVIPANWAPMAVYRSFVQYSS 268

Sequence Alignment: 5. Allergen Name: Ory s 1 Sequence ID: AAF72989

 Score = 177.0 bits 816,  Expect = 6e-46
 Identities = 121/240 50%, Positives = 162/240 67%, Gaps = 7/240 2%
Query  34   KLYNASYYSPSSSDWSPAVATWYGPANGDGS--EGGACGYGNAVGQPPFSSLISAGSPLI 91
            + YN S     ++ W  A ATWYG  NG G+   GGACG+   V Q PF  + S G+  +
Sbjct  29   RWYNESEAIGGAAAWGNAKATWYGQPNGAGAADNGGACGF-KKVNQYPFMGMTSCGNQPL 87
Query  92   YDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECAGCGSDAQYHFDLSGNAFGAMAISGQ 151
            Y  GKGCGSCY V+C  N ACSGN   V ITD        +QYHFDLSG AFG +A  G+
Sbjct  88   YKGGKGCGSCYRVRCNRNPACSGNAQTVAITD--MNYFPLSQYHFDLSGIAFGRLAKPGR 145
Query  152  DENLRNAGKINIQHRRIECNYPGRSIAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEA 211
             ++LR AG I++Q  R+ C +PG  + FHV+ GS+  Y+A LVEYE+GDGD+A+V+LKEA
Sbjct  146  ADDLRRAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEA 205
Query  212  -LDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLTTLESGQTIVANNVIPAGWTPGQTYR 270
                G W  M++SWG+VW++D    LRAPFSI++ + +SG+T+VA +VIP  WTP   YR
Sbjct  206  GAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRS-DSGKTLVAPDVIPLNWTPNTFYR 264
Query  271  SIVNFAT 277
            S V +++
Sbjct  265  SFVQYSS 271

Sequence Alignment: 6. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 173.9 bits 801,  Expect = 5e-45
 Identities = 123/257 47%, Positives = 160/257 62%, Gaps = 8/257 3%
Query  10   SELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSDWSPAVATWYGPANGDGSE--GG 67
            S  L L  +++  +V    C  PK     +  +     W  A  TWYG   G G +  GG
Sbjct  3    SSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDNGG 62
Query  68   ACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECAG 127
            ACGY + + + PF  + S G+  I+  GKGCGSC+EVKC+   ACS  PV + ITD    
Sbjct  63   ACGYKD-IDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITD--MN 119
Query  128  CGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRS-IAFHVDSGSN 186
                A YHFDLSG+AFGAMA  G+DE LR AG I++Q RR+ C YPG + + FHV+ GSN
Sbjct  120  TEPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSN 179
Query  187  QEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLTT 246
              YFA LV+Y  GDGD+ KVELKE   S  W  + +SWGA+W+ D   PL+ PFS+++TT
Sbjct  180  PNYFAVLVKYVGGDGDVVKVELKEK-GSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTT 238
Query  247  LESGQTIVANNVIPAGWTPGQTYRS 271
             ES Q +VAN+VIP  W     Y+S
Sbjct  239  -ESDQKLVANDVIPDNWKANALYKS 262

Sequence Alignment: 7. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 173.7 bits 800,  Expect = 6e-45
 Identities = 121/260 46%, Positives = 170/260 65%, Gaps = 9/260 3%
Query  10   SELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSDWSPAVATWYGPANGDGS--EGG 67
            + ++  +A+++  LV    C  PK     +  +  ++ W PA ATWYG   G GS   GG
Sbjct  6    TNIVLAVAVVAA-LVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGSTDNGG 64
Query  68   ACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECAG 127
            ACG  N V  PP++ +IS G+  I+  G+GCGSCYEVKC   +ACS  PV V ITD    
Sbjct  65   ACGIKN-VNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITD--MN 121
Query  128  CGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPG-RSIAFHVDSGSN 186
                + YHFD+SG AFGAMA  G++  LR AG I++Q RR+ C YPG + + FHV+ GSN
Sbjct  122  YEPISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSN 181
Query  187  QEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLTT 246
              Y+A LV++   DGD+ +++L+EA    +W  M+ SWGA+W+ D  +PL+APFSI++TT
Sbjct  182  PNYLAVLVKFVADDGDVIQMDLQEA-GLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTT 240
Query  247  LESGQTIVANNVIPAGWTPGQTYRSIVNF 275
             ESG++++A +VIP  W P   Y S V F
Sbjct  241  -ESGKSLIAKDVIPVNWMPDAIYVSNVQF 268

Sequence Alignment: 8. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 172.0 bits 792,  Expect = 2e-44
 Identities = 119/258 46%, Positives = 175/258 67%, Gaps = 15/258 5%
Query  10   SELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSDWSPAVATWYGPANGDGSE--GG 67
            S  + L+A+LS+++       N    Y+ +     +S W PA ATWYG  NG G +  GG
Sbjct  6    SNAIALVALLSMLFTSVRSAVN----YDTAVARSYTSGWLPAKATWYGAPNGAGPDDNGG 61
Query  68   ACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKC--TGNSACSGNPVKVVITDEC 125
            ACG+ N V Q P SS+ + G+  I+  G+GCG CYE+KC  + N +CSG P ++VITD  
Sbjct  62   ACGFKN-VNQYPISSMGACGNEPIFAGGEGCGMCYEIKCEYSNNPSCSGQPRRIVITD-- 118
Query  126  AGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRSIAFHVDSGS 185
                  A+YH+DLSG AFG+MA  G ++ LR+AG I++Q RR+ CN+PG  + FHV  GS
Sbjct  119  MNYYPVARYHLDLSGTAFGSMAKYGLNDRLRHAGIIDMQFRRVPCNFPGMKVTFHVQRGS 178
Query  186  NQEYFATLVEYEDGDGDLAKVELKEALD---SGSWDSMQQSWGAVWKFDKGSPLRAPFSI 242
            N  Y+A LVEY + DG + ++EL + ++   +G W  M++SWG+VW+ D   P++ PFSI
Sbjct  179  NPNYLAVLVEYVNVDGTVVRMELMQTMNGRPTGYWQDMRRSWGSVWRMDTNRPVQGPFSI 238
Query  243  KLTTLESGQTIVANNVIPAGWTPGQTYRSIVNF 275
            ++T+ ++G+T+VANN IPA W   + Y S + F
Sbjct  239  RITS-DTGKTLVANNAIPAYWQQDHAYWSNLQF 270

Sequence Alignment: 9. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 170.8 bits 786,  Expect = 5e-44
 Identities = 116/231 50%, Positives = 160/231 69%, Gaps = 15/231 6%
Query  38   ASYYSPSSSDWSPAVATWYGPANGDGSE--GGACGYGNAVGQPPFSSLISAGSPLIYDSG 95
            A Y+ P    W+ A ATWYG  NG G +  GGACG+ +   Q PF S+ S G+  ++  G
Sbjct  49   AVYWGP----WTKARATWYGQPNGAGPDDNGGACGFKHT-NQYPFMSMTSCGNQPLFKDG 103
Query  96   KGCGSCYEVKCTGNSACSGNPVKVVITDECAGCGSDAQYHFDLSGNAFGAMAISGQDENL 155
            KGCGSCY+++CT + +CSG    V+ITD        A +HFDLSG AFG +A  G ++ L
Sbjct  104  KGCGSCYKIRCTKDQSCSGRSETVIITD--MNYYPVAPFHFDLSGTAFGRLAKPGLNDKL 161
Query  156  RNAGKINIQHRRIECNYPGRSIAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALD-- 213
            R++G I+I+  R+ C +PG  I FHV+  SN  YFA LVEYEDGDGD+ +V+L E+    
Sbjct  162  RHSGIIDIEFTRVPCEFPGLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAH 221
Query  214  ---SGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLTTLESGQTIVANNVIPAGWTPGQTYR 270
               +G W  M++SWG++W++D    L+APFSI++   ESG+T+VANNVIPA W P   YR
Sbjct  222  GPPTGKWTPMRESWGSIWRLDTNHRLQAPFSIRIRN-ESGKTLVANNVIPANWRPNTFYR 280
Query  271  SIVNFA 276
            S V ++
Sbjct  281  SFVQYS 286

Sequence Alignment: 10. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 168.5 bits 775,  Expect = 2e-43
 Identities = 116/261 44%, Positives = 164/261 62%, Gaps = 9/261 3%
Query  9    LSELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSDWSPAVATWYGPANGDGS--EG 66
            ++ ++ + A+L+  LV    C  PK     +  +  +  W  A ATWYG  NG G+   G
Sbjct  5    VNNIMVVGAVLAA-LVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAPDNG 63
Query  67   GACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECA 126
            GACG  N V  PP+S + + G+  I+  GKGCGSCYEV+C     CSGNPV V ITD   
Sbjct  64   GACGIKN-VNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITD--M 120
Query  127  GCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYP-GRSIAFHVDSGS 185
                 A YHFDLSG AFG++A  G ++ +R+ G ++++ RR+ C YP G+ I FH++ G 
Sbjct  121  NYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGC 180
Query  186  NQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLT 245
            N  Y+A LV+Y   DGD+  +E+++ L S  W  M+ SWGA+W+ D    L+ PFSI+LT
Sbjct  181  NPNYLAVLVKYVADDGDIVLMEIQDKL-SAEWKPMKLSWGAIWRMDTAKALKGPFSIRLT 239
Query  246  TLESGQTIVANNVIPAGWTPGQTYRSIVNF 275
            + ESG+ ++A +VIPA W P   Y S V F
Sbjct  240  S-ESGKKVIAKDVIPANWRPDAVYTSNVQF 268

Sequence Alignment: 11. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 167.9 bits 772,  Expect = 3e-43
 Identities = 120/260 46%, Positives = 163/260 62%, Gaps = 11/260 4%
Query  8    ALSELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSDWSPAVATWYGPANGDGSE-- 65
            +L++++ + A+L+  LV    C  PK     +  +  +  W PA ATWYG  NG G +  
Sbjct  3    SLAKIVAVAAVLAA-LVAGGSCGPPKVPPGPNITTNYNGKWLPAKATWYGQPNGAGPDDN 61
Query  66   GGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDEC 125
            GGACG  N V  PP++ + + G+P I+  GKGCGSCYE++C     CSG PV V ITD  
Sbjct  62   GGACGIKN-VNLPPYNGFTACGNPPIFKDGKGCGSCYEIRCN-KPECSGQPVTVFITD-- 117
Query  126  AGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPG-RSIAFHVDSG 184
                  A YHFDLSG AFGAMA  G ++ LR+ G  +++ RR+ C Y G + I FHV+ G
Sbjct  118  MNYEPIAPYHFDLSGKAFGAMAKPGLNDKLRHYGIFDLEFRRVRCKYQGGQKIVFHVEKG 177
Query  185  SNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKL 244
            SN  Y+A LV++   DGD+  +ELKE   S  W  M+ SWGA+W+ D    L  PFSI+L
Sbjct  178  SNPNYLAMLVKFVADDGDIVLMELKE--KSSDWKPMKLSWGAIWRMDTPKALVPPFSIRL 235
Query  245  TTLESGQTIVANNVIPAGWTPGQTYRSIVNF 275
            T+ ESG+ ++A +VIP  W P   Y S V F
Sbjct  236  TS-ESGKKVIAQDVIPVNWKPDTVYNSNVQF 265

Sequence Alignment: 12. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 166.7 bits 766,  Expect = 8e-43
 Identities = 110/227 48%, Positives = 157/227 69%, Gaps = 10/227 4%
Query  45   SSDWSPAVATWYGPANGDGSE--GGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCY 102
            ++DW PA ATWYG  NG G +  GGACG+ N   Q PF S+ S G+  ++  GKGCG+CY
Sbjct  28   TNDWLPAKATWYGQPNGAGPDDNGGACGFKNT-NQYPFMSMTSCGNEPLFQDGKGCGACY 86
Query  103  EVKCTGNSACSGNPVKVVITDECAGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKIN 162
            +++CT N +CSG P  V+ITD        A+YHFDLSG AFGAMA  G ++ LR+AG I+
Sbjct  87   QIRCTNNPSCSGQPRTVIITD--MNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIID 144
Query  163  IQHRRIECNYPGRSIAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGS----WD 218
            IQ RR+ C + G  + FHV++GSN  Y+A LVE+ + DG + ++++ E+L SG     W 
Sbjct  145  IQFRRVPCYHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWT 204
Query  219  SMQQSWGAVWKFDKGSPLRAPFSIKLTTLESGQTIVANNVIPAGWTPGQTYRSIVNF 275
             M++SWG++W++D    L+ P S+++ + ESGQT++A+ VIPA W     Y S V F
Sbjct  205  PMRRSWGSIWRLDANHRLQGPXSLRMVS-ESGQTVIAHQVIPANWRANTNYGSKVQF 260

Sequence Alignment: 13. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 165.2 bits 759,  Expect = 2e-42
 Identities = 115/255 45%, Positives = 162/255 63%, Gaps = 10/255 3%
Query  10   SELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSDWSPAVATWYGPANGDGSE--GG 67
            S +L ++ ++++FL   S    PK     +  +     W  A +TWYG   G G +  GG
Sbjct  5    SSVLLVVVLFAVFL--GSAYGIPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGG 62
Query  68   ACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECAG 127
            ACGY + V +PPFS +   G+  I+ SG+GCGSC+E+KCT   ACSG PV V ITD+   
Sbjct  63   ACGYKD-VDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEE 121
Query  128  CGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYP-GRSIAFHVDSGSN 186
                A YHFDLSG+AFGAMA  G ++ LR+AG++ +Q RR++C YP G  + FHV+ GSN
Sbjct  122  --PIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSN 179
Query  187  QEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLTT 246
              Y+A LV+Y +GDGD+  V++KE      W  +++SWGA+W+ D    L  PF+++ TT
Sbjct  180  PNYLALLVKYVNGDGDVVAVDIKEK-GKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTT 238
Query  247  LESGQTIVANNVIPAGWTPGQTYRS 271
             E G    A +VIP GW    +Y S
Sbjct  239  -EGGTKTEAEDVIPEGWKADTSYES 262

Sequence Alignment: 14. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 165.2 bits 759,  Expect = 2e-42
 Identities = 115/254 45%, Positives = 160/254 62%, Gaps = 9/254 3%
Query  15   LIAILSIFLVIPSFCFNPKKLYNASYYSPSSSD-WSPAVATWYGPANGDGSE--GGACGY 71
            L+A + +  ++ +    P K+      + S  D W  A ATWYG   G G +  GGACGY
Sbjct  7    LLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDNGGACGY 66
Query  72   GNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECAGCGSD 131
             + V + PF  + S G+  I+  GKGCGSC+E+KC+   ACS  P  + +TD        
Sbjct  67   KD-VDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTD--MNDEPI 123
Query  132  AQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRS-IAFHVDSGSNQEYF 190
            A YHFDLSG AFGAMA  G+DE LR AG I+ Q RR++C YP  + I FH++  SN  Y+
Sbjct  124  AAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYL 183
Query  191  ATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLTTLESG 250
            A LV+Y  GDGD+ +VE+KE   S  W ++++SWGA+W+ D   PL+ PFS+++TT E G
Sbjct  184  ALLVKYVAGDGDVVEVEIKEK-GSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTT-EGG 241
Query  251  QTIVANNVIPAGWTPGQTYRSIV 273
            + I+A + IP GW     Y+S V
Sbjct  242  EKIIAEDAIPDGWKADSVYKSNV 264

Sequence Alignment: 15. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 163.4 bits 750,  Expect = 8e-42
 Identities = 113/254 44%, Positives = 163/254 64%, Gaps = 12/254 4%
Query  10   SELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSD-WSPAVATWYGPANGDGSE--G 66
            S +L ++A++++FL          K+      + +  D W  A +TWYG   G G +  G
Sbjct  5    SLVLLVVALFAVFL---GTAHGIAKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNG 61
Query  67   GACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECA 126
            GACGY + V +PPFS +   G+  I+ SG+GCGSC+E+KCT   +CSG P+ V ITD+  
Sbjct  62   GACGYKD-VDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPIVVHITDDNE 120
Query  127  GCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYP-GRSIAFHVDSGS 185
                 A YH+DLSG AFGAMA  G+++ LR+AG++ ++ RR++C YP G  + FHV+ GS
Sbjct  121  E--PIAAYHLDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPKGTKVTFHVEKGS 178
Query  186  NQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLT 245
            N  Y+A LV+Y DGDGD+  V++KE      W  +++SWGAVW+ D    L  PF+++ T
Sbjct  179  NPNYLALLVKYVDGDGDVVAVDIKEK-GKDKWIELKESWGAVWRVDTPDKLTGPFTVRYT 237
Query  246  TLESGQTIVANNVIPAGWTPGQTYRS 271
            T E G  + A +VIP GW     Y S
Sbjct  238  T-EGGTKVEAEDVIPEGWKADTAYES 262

Sequence Alignment: 16. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 163.0 bits 748,  Expect = 1e-41
 Identities = 116/255 45%, Positives = 162/255 63%, Gaps = 10/255 3%
Query  10   SELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSDWSPAVATWYG-P-ANGDGSEGG 67
            S +L ++A++++FL   S    PK     +  +     W  A +TWYG P A G    GG
Sbjct  5    SSVLLVVALFAVFL--GSAHGIPKVPPGPNITATYGDKWLDAKSTWYGKPTAAGPKDNGG 62
Query  68   ACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECAG 127
            ACGY + V +PPFS +   G+  I+ SG+GCGSC+E+KCT   ACSG PV V ITD+   
Sbjct  63   ACGYKD-VDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEE 121
Query  128  CGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYP-GRSIAFHVDSGSN 186
                A YHFDLSG AFG+MA  G ++ LR+AG++ IQ RR++C YP G  + FHV+ GSN
Sbjct  122  --PIAAYHFDLSGIAFGSMAKKGDEQKLRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSN 179
Query  187  QEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLTT 246
              Y+A LV++  GDGD+  V++KE      W ++++SWGA+W+ D    L+ PF+++ TT
Sbjct  180  PNYLALLVKFVAGDGDVVAVDIKEK-GKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTT 238
Query  247  LESGQTIVANNVIPAGWTPGQTYRS 271
             E G    A +VIP GW     Y S
Sbjct  239  -EGGTKGEAKDVIPEGWKADTAYES 262

Sequence Alignment: 17. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 161.6 bits 741,  Expect = 2e-41
 Identities = 108/223 48%, Positives = 149/223 66%, Gaps = 8/223 3%
Query  48   WSPAVATWYGPANGDGSE--GGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVK 105
            W  A ATWYG   G G +  GGACGY + V + PF+S+ + G+P I+  G GCGSCYE+K
Sbjct  4    WLDAKATWYGKPTGAGPDDNGGACGYKD-VNKAPFNSMGACGNPPIFKDGLGCGSCYEIK 62
Query  106  CTGNSACSGNPVKVVITDECAGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQH 165
            C   + CSG PV V ITD+       A YHFDL+G AFGAMA  G++E LR AG I++Q 
Sbjct  63   CDKPAECSGEPVIVHITDQ--NYEPIAAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQF 120
Query  166  RRIECNYPGRS-IAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSW 224
            RR++C YP  + IAFHV+ G N  YFA L++Y  GDGD+  V++KE   S  +  +++SW
Sbjct  121  RRVKCKYPANTKIAFHVEKGCNPNYFALLIKYAAGDGDIVAVDIKEK-GSEEFIPLKHSW 179
Query  225  GAVWKFDKGSPLRAPFSIKLTTLESGQTIVANNVIPAGWTPGQTYRSIVNF 275
            GA+W+ D   P++ P +++LT+ E G T+V ++ IP GW     Y S + F
Sbjct  180  GAIWRIDSPKPIKGPIAVRLTS-EGGTTLVQDDAIPEGWKADTVYTSKLQF 229

Sequence Alignment: 18. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 159.2 bits 730,  Expect = 1e-40
 Identities = 113/254 44%, Positives = 160/254 62%, Gaps = 12/254 4%
Query  10   SELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSD-WSPAVATWYGPANGDGSE--G 66
            S LL + A++++FL          K+      + +  D W  A +TWYG   G G +  G
Sbjct  7    SVLLLVAALFAVFL---GSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNG 63
Query  67   GACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECA 126
            GACGY + V +PPFS +   G+  I+  G+GCGSC+E+KCT   +CSG PV V ITD+  
Sbjct  64   GACGYKD-VDKPPFSGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEPVTVHITDDNE 122
Query  127  GCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYP-GRSIAFHVDSGS 185
                 A YHFDLSG+AFG+MA  G+++ LR+AG++ ++ RR++C YP G    FHV+ GS
Sbjct  123  E--PIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGS 180
Query  186  NQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLT 245
            N  Y+A LV+Y DGDGD+  V++KE      W  +++SWGAVW+ D    L  PF+++ T
Sbjct  181  NPNYLALLVKYIDGDGDVVAVDIKEK-GKDKWIELKESWGAVWRVDTPDKLTGPFTVRYT 239
Query  246  TLESGQTIVANNVIPAGWTPGQTYRS 271
            T E G    A +VIP GW     Y +
Sbjct  240  T-EGGTKGEAEDVIPEGWKADTAYEA 264

Sequence Alignment: 19. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 158.2 bits 725,  Expect = 3e-40
 Identities = 111/254 43%, Positives = 160/254 62%, Gaps = 12/254 4%
Query  10   SELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSD-WSPAVATWYGPANGDGSE--G 66
            S +L ++A++++FL          K+      + +  D W  A +TWYG   G G +  G
Sbjct  5    SSVLLVVALFAVFL---GTAHGIAKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNG 61
Query  67   GACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECA 126
            GACGY + V + PFS +   G+  I+ SG+GCGSC+E+KCT   +CSG PV V ITD+  
Sbjct  62   GACGYKD-VDKAPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPVLVHITDDNE 120
Query  127  GCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYP-GRSIAFHVDSGS 185
                 A YHFDLSG AFGAMA  G+++ LR+AG++ ++ RR++C YP G  + FHV+ GS
Sbjct  121  E--PIAAYHFDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPEGTKVTFHVEKGS 178
Query  186  NQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLT 245
            N  Y+A LV+Y  GDGD+  V++KE      W  +++SWG++W+ D    L  PF+++ T
Sbjct  179  NPNYLALLVKYVTGDGDVVAVDIKEK-GKDKWIELKESWGSIWRVDTPDKLTGPFTVRYT 237
Query  246  TLESGQTIVANNVIPAGWTPGQTYRS 271
            T E G    A +VIP GW     Y S
Sbjct  238  T-EGGTKGEAEDVIPEGWKADTAYAS 262

Sequence Alignment: 20. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 157.8 bits 723,  Expect = 4e-40
 Identities = 117/264 44%, Positives = 169/264 64%, Gaps = 19/264 7%
Query  1    MALTLQRALSELLTLIAILSIFLVIPSFCF---NPKKLYNASYYSPSSSDWSPAVATWYG 57
            MA +  R  ++L  +  +LS  +V  ++C     P     A+Y    + +W  A AT+YG
Sbjct  1    MASSSARRQAQLAAVAVLLSA-MVGSALCEIGDKPGPNITATY----NEEWQDAKATFYG 55
Query  58   PANGDGS----EGGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACS 113
             +N  G+    +GGACGY N V + PF  +   G+  I+  G GCGSC+E+KC   + CS
Sbjct  56   -SNPRGAAPDDDGGACGYKN-VDKAPFFGMTGCGNEPIFKDGLGCGSCFEIKCKEPAECS 113
Query  114  GNPVKVVITDECAGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYP 173
              PV + ITD+       A YHFDLSG AFG+MA  GQ++NLR AG++ +Q RR++C YP
Sbjct  114  DKPVLIRITDK--NYEHIAAYHFDLSGKAFGSMAKQGQEDNLRKAGELTLQFRRVKCEYP 171
Query  174  GRS-IAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDK 232
             ++ I FHV+ G N  Y+A LVEY  GDGD+  V++K    S  +  M+ SWGA+W+ D 
Sbjct  172  SKTKITFHVEKGCNDNYLALLVEYAAGDGDIVAVDIKPK-GSDEFLPMKPSWGAIWRIDP 230
Query  233  GSPLRAPFSIKLTTLESGQTIVANNVIPAGWTPGQTYRSIVNF 275
              PL+ PF+++LT+ ESG  +V  +VIPA W P   Y S + +
Sbjct  231  KKPLKGPFTVRLTS-ESGAKLVQEDVIPADWKPNTAYTSNLQY 272

Sequence Alignment: 21. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 157.6 bits 722,  Expect = 4e-40
 Identities = 104/220 47%, Positives = 145/220 65%, Gaps = 8/220 3%
Query  47   DWSPAVATWYGPANGDGSE--GGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEV 104
            +W  A +TWYG   G G +  GGACGY + V +PPFS +   G+  I+  G+GCGSC+E+
Sbjct  25   EWLDAKSTWYGKPTGAGPKDNGGACGYKD-VDKPPFSGMTGCGNTPIFKDGRGCGSCFEI 83
Query  105  KCTGNSACSGNPVKVVITDECAGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQ 164
            KC+   +CSG PV V ITD+       A YHFDLSG+AFG+MA  G+++ LR+AG++ ++
Sbjct  84   KCSKPESCSGEPVTVHITDDNE--EPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELK 141
Query  165  HRRIECNYP-GRSIAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQS 223
             RR++C YP G    FHV+ GSN  Y+A LV+Y DGDGD+  V++KE      W  +++S
Sbjct  142  FRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEK-GKDKWIELKES 200
Query  224  WGAVWKFDKGSPLRAPFSIKLTTLESGQTIVANNVIPAGWTPGQTYRS 271
            WGAVW+ D    L  PF+++ TT E G    A +VIP GW     Y +
Sbjct  201  WGAVWRVDTPDKLTGPFTVRYTT-EGGTKGEAEDVIPEGWKADTAYEA 247

Sequence Alignment: 22. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 157.0 bits 719,  Expect = 6e-40
 Identities = 110/224 49%, Positives = 148/224 66%, Gaps = 11/224 4%
Query  46   SDWSPAVATWYGPANGDGS----EGGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSC 101
            S W  A AT+YG +N  G+     GGACGY + V +PPF  + + G+  I+  G GC +C
Sbjct  16   SKWLEARATFYG-SNPRGAAPDDHGGACGYKD-VDKPPFDGMTACGNEPIFKDGLGCRAC 73
Query  102  YEVKCTGNSACSGNPVKVVITDECAGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKI 161
            YE+KC     CSG PV V ITD+       A YHFDLSG AFGAMA  GQ++ LR AG++
Sbjct  74   YEIKCKEPVECSGEPVLVKITDK--NYEHIAAYHFDLSGKAFGAMAKKGQEDKLRKAGEL 131
Query  162  NIQHRRIECNYP-GRSIAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSM 220
             +Q RR++C YP G  I FH++ GSN  Y+A LV+Y  GDG++  V++K   DS  +  M
Sbjct  132  TLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPR-DSDEFIPM 190
Query  221  QQSWGAVWKFDKGSPLRAPFSIKLTTLESGQTIVANNVIPAGWTPGQTYRSIVNF 275
            + SWGA+W+ D   PL+ PFSI+LT+ E G  +V ++VIPA W P   Y S + F
Sbjct  191  KSSWGAIWRIDPKKPLKGPFSIRLTS-EGGAHLVQDDVIPANWKPDTVYTSKLQF 244

Sequence Alignment: 23. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 157.0 bits 719,  Expect = 7e-40
 Identities = 114/255 44%, Positives = 161/255 63%, Gaps = 16/255 6%
Query  12   LLTLIAILSIFLVIPSFCF---NPKKLYNASYYSPSSSDWSPAVATWYG--P-ANGDGSE 65
            +L ++A++   +V  ++C     P     A+Y       W  A AT+YG  P        
Sbjct  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATY----GDKWLDAKATFYGSDPRGAAPDDH 56
Query  66   GGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDEC 125
            GGACGY + V + PF S+   G+  I+  G GCGSCYE+KC   + CSG PV + ITD+ 
Sbjct  57   GGACGYKD-VDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDK- 114
Query  126  AGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRS-IAFHVDSG 184
                  A YHFDLSG AFGAMA  G+++ LR AG++ +Q RR++C YP  + IAFHV+ G
Sbjct  115  -NYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKG 173
Query  185  SNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKL 244
            SN  Y+A LV+Y  GDG++  V++K    S  +  M+QSWGA+W+ D   PL+ PF+I+L
Sbjct  174  SNPNYLALLVKYAAGDGNIVSVDIKSK-GSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRL 232
Query  245  TTLESGQTIVANNVIPAGWTPGQTYRSIVNF 275
            T+ ESG  +   +VIP  W P   Y+S + F
Sbjct  233  TS-ESGGHVEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 24. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 157.0 bits 719,  Expect = 7e-40
 Identities = 114/255 44%, Positives = 161/255 63%, Gaps = 16/255 6%
Query  12   LLTLIAILSIFLVIPSFCF---NPKKLYNASYYSPSSSDWSPAVATWYG--P-ANGDGSE 65
            +L ++A++   +V  ++C     P     A+Y       W  A AT+YG  P        
Sbjct  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATY----GDKWLDAKATFYGSDPRGAAPDDH 56
Query  66   GGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDEC 125
            GGACGY + V + PF S+   G+  I+  G GCGSCYE+KC   + CSG PV + ITD+ 
Sbjct  57   GGACGYKD-VDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDK- 114
Query  126  AGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRS-IAFHVDSG 184
                  A YHFDLSG AFGAMA  G+++ LR AG++ +Q RR++C YP  + IAFHV+ G
Sbjct  115  -NYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKG 173
Query  185  SNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKL 244
            SN  Y+A LV+Y  GDG++  V++K    S  +  M+QSWGA+W+ D   PL+ PF+I+L
Sbjct  174  SNPNYLALLVKYAAGDGNIVSVDIKSK-GSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRL 232
Query  245  TTLESGQTIVANNVIPAGWTPGQTYRSIVNF 275
            T+ ESG  +   +VIP  W P   Y+S + F
Sbjct  233  TS-ESGGHVEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 25. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 156.1 bits 715,  Expect = 1e-39
 Identities = 109/256 42%, Positives = 158/256 61%, Gaps = 10/256 3%
Query  1    MALTLQRALSELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSDWSPAVATWYGPAN 60
            M +    + S LL + A+L++F  + S     K     +  +     W  A +TWYG   
Sbjct  2    MKMVCSSSSSSLLVVAALLAVF--VGSAQGIAKVPPGPNITAEYGDKWLDAKSTWYGKPT 59
Query  61   GDGSE--GGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVK 118
            G G +  GGACGY + V + PF+ +   G+  I+  G+GCGSC+E+KC+   +CSG P+ 
Sbjct  60   GAGPKDNGGACGYKD-VDKAPFNGMTGCGNTPIFKDGRGCGSCFELKCSKPESCSGEPIT 118
Query  119  VVITDECAGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYP-GRSI 177
            V ITD+       A YHFDLSG+AFG+MA  G++EN+R AG++ +Q RR++C YP G   
Sbjct  119  VHITDDNE--EPIAPYHFDLSGHAFGSMAKKGEEENVRGAGELELQFRRVKCKYPDGTKP 176
Query  178  AFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLR 237
             FHV+ GSN  Y+A LV+Y DGDGD+  V++KE      W  +++SWGA+W+ D    L 
Sbjct  177  TFHVEKGSNPNYLALLVKYVDGDGDVVAVDIKEK-GKDKWIELKESWGAIWRIDTPDKLT 235
Query  238  APFSIKLTTLESGQTIVANNVIPAGW 263
             PF+++ TT E G      +VIP GW
Sbjct  236  GPFTVRYTT-EGGTKAEFEDVIPEGW 260

Sequence Alignment: 26. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 154.3 bits 706,  Expect = 4e-39
 Identities = 112/255 43%, Positives = 159/255 62%, Gaps = 16/255 6%
Query  12   LLTLIAILSIFLVIPSFCF---NPKKLYNASYYSPSSSDWSPAVATWYG--P-ANGDGSE 65
            +L ++A++   +V  ++C     P     A+Y       W  A AT+YG  P        
Sbjct  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATY----GDKWLDAKATFYGSDPRGAAPDDH 56
Query  66   GGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDEC 125
            GGACGY + V + PF  +   G+  I+  G  CGSCYE+KC   + CSG PV + ITD+ 
Sbjct  57   GGACGYKD-VDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDK- 114
Query  126  AGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRS-IAFHVDSG 184
                  A YHFDLSG AFGAMA  G+++ LR AG++ +Q RR++C YP  + IAFHV+ G
Sbjct  115  -NYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKG 173
Query  185  SNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKL 244
            SN  Y+A LV+Y  GDG++  V++K    S  +  M+QSWGA+W+ D   PL+ PF+I+L
Sbjct  174  SNPNYLALLVKYAAGDGNIVSVDIKSK-GSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRL 232
Query  245  TTLESGQTIVANNVIPAGWTPGQTYRSIVNF 275
            T+ ESG  +   +VIP  W P   Y+S + F
Sbjct  233  TS-ESGGHVEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 27. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 153.9 bits 704,  Expect = 6e-39
 Identities = 108/252 42%, Positives = 156/252 61%, Gaps = 12/252 4%
Query  10   SELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSD-WSPAVATWYGPANGDGSE--G 66
            S +L ++A++++FL          K+      +    D W  A +TWYG   G G +  G
Sbjct  5    SSVLLVVALFAVFL---GSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNG 61
Query  67   GACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECA 126
            GACGY + V + PF+ +   G+  I+  G+GCGSC+E+KCT   +CSG  V V ITD+  
Sbjct  62   GACGYKD-VDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
Query  127  GCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYP-GRSIAFHVDSGS 185
                 A YHFDLSG+AFG+MA  G+++ LR+AG++ +Q RR++C YP G    FHV+  S
Sbjct  121  --EPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKAS 178
Query  186  NQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLT 245
            N  Y+A LV+Y DGDGD+  V++KE      W  +++SWGAVW+ D    L  PF+++ T
Sbjct  179  NPNYLAILVKYVDGDGDVVAVDIKEK-GKDKWIELKESWGAVWRIDTPDKLTGPFTVRYT 237
Query  246  TLESGQTIVANNVIPAGWTPGQTY 269
            T E G      +VIP GW    +Y
Sbjct  238  T-EGGTKSEVEDVIPEGWKADTSY 260

Sequence Alignment: 28. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 153.9 bits 704,  Expect = 6e-39
 Identities = 108/252 42%, Positives = 157/252 62%, Gaps = 12/252 4%
Query  10   SELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSD-WSPAVATWYGPANGDGSE--G 66
            S +L ++A++++FL          K+      +    D W  A +TWYG   G G +  G
Sbjct  5    SSVLLVVALFAVFL---GSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNG 61
Query  67   GACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECA 126
            GACGY N V + PF+ +   G+  I+  G+GCGSC+E+KCT   +CSG  V V ITD+  
Sbjct  62   GACGYKN-VDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
Query  127  GCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRSI-AFHVDSGS 185
                 A YHFDLSG+AFG+MA  G+++N+R+AG++ +Q RR++C YP  +   FHV+  S
Sbjct  121  --EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKAS 178
Query  186  NQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLT 245
            N  Y+A LV+Y DGDGD+  V++KE      W  +++SWGAVW+ D    L  PF+++ T
Sbjct  179  NPNYLAILVKYVDGDGDVVAVDIKEK-GKDKWTELKESWGAVWRIDTPDKLTGPFTVRYT 237
Query  246  TLESGQTIVANNVIPAGWTPGQTY 269
            T E G      +VIP GW    +Y
Sbjct  238  T-EGGTKSEFEDVIPEGWKADTSY 260

Sequence Alignment: 29. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 153.3 bits 701,  Expect = 9e-39
 Identities = 108/252 42%, Positives = 157/252 62%, Gaps = 12/252 4%
Query  10   SELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSD-WSPAVATWYGPANGDGSE--G 66
            S +L ++A++++FL          K+      +    D W  A +TWYG   G G +  G
Sbjct  5    SSVLLVVALFAVFL---GSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNG 61
Query  67   GACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECA 126
            GACGY N V + PF+ +   G+  I+  G+GCGSC+E+KCT   +CSG  V V ITD+  
Sbjct  62   GACGYKN-VDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
Query  127  GCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRSI-AFHVDSGS 185
                 A YHFDLSG+AFG+MA  G+++N+R+AG++ +Q RR++C YP  +   FHV+  S
Sbjct  121  --EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKAS 178
Query  186  NQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLT 245
            N  Y+A LV+Y DGDGD+  V++KE      W  +++SWGAVW+ D    L  PF+++ T
Sbjct  179  NPNYLAILVKYVDGDGDVVAVDIKEK-GKDKWIELKESWGAVWRIDTPDKLTGPFTVRYT 237
Query  246  TLESGQTIVANNVIPAGWTPGQTY 269
            T E G      +VIP GW    +Y
Sbjct  238  T-EGGTKSEFEDVIPEGWKADTSY 260

Sequence Alignment: 30. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 153.1 bits 700,  Expect = 9e-39
 Identities = 101/217 46%, Positives = 142/217 65%, Gaps = 8/217 3%
Query  48   WSPAVATWYGPANGDGSE--GGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVK 105
            W  A +TWYG   G G +  GGACGY + V + PF+ +   G+  I+  G+GCGSC+E+K
Sbjct  30   WLDAKSTWYGKPTGAGPKDNGGACGYKD-VDKAPFNGMTGCGNTPIFKDGRGCGSCFEIK 88
Query  106  CTGNSACSGNPVKVVITDECAGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQH 165
            CT   +CSG  V V ITD+       A YHFDLSG+AFG+MA  G+++N+R+AG++ +Q 
Sbjct  89   CTKPESCSGEAVTVTITDDNE--EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQF 146
Query  166  RRIECNYPGRSI-AFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSW 224
            RR++C YP  +   FHV+ GSN  Y+A LV+Y DGDGD+  V++KE      W  +++SW
Sbjct  147  RRVKCKYPDDTKPTFHVEKGSNPNYLAILVKYVDGDGDVVAVDIKEK-GKDKWIELKESW 205
Query  225  GAVWKFDKGSPLRAPFSIKLTTLESGQTIVANNVIPAGWTPGQTY 269
            GAVW+ D    L  PF+++ TT E G      +VIP GW    +Y
Sbjct  206  GAVWRIDTPDKLTGPFTVRYTT-EGGTKSEVEDVIPEGWKADTSY 249

Sequence Alignment: 31. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 153.4 bits 702,  Expect = 1e-38
 Identities = 119/224 53%, Positives = 162/224 72%, Gaps = 15/224 6%
Query  48   WSPAVATWYGPANGDGSE--GGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVK 105
            W  A ATWYG  NG G +  GGACG+ N V  PPFS++ S G+  ++  GKGCGSCY+++
Sbjct  92   WLNARATWYGAPNGAGPDDNGGACGFKN-VNLPPFSAMTSCGNEPLFKDGKGCGSCYQIR 150
Query  106  CTGNSACSGNPVKVVITDECAGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQH 165
            C G+ ACSG P  V+ITD        + YHFDLSG AFGAMA   +++ LR+AG I+IQ 
Sbjct  151  CVGHPACSGLPETVIITD--MNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQF 208
Query  166  RRIECNYPGRSIAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEA------LD---SGS 216
            RR+ C YPG ++ FHV+ GSN  Y A LVEYE+GDGD+ +V+L E+      +D   +G 
Sbjct  209  RRVPCQYPGLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTGV 268
Query  217  WDSMQQSWGAVWKFDKGSPLRAPFSIKLTTLESGQTIVANNVIPAGWTPGQTYRSIVNF 275
            W  M++SWG++W++D   PL+ PFS+++T  ESG+T++A+ VIPA W P   Y SIV F
Sbjct  269  WTPMRESWGSIWRLDTNHPLQGPFSLRITN-ESGKTLIADQVIPADWQPNTVYSSIVQF 326

Sequence Alignment: 32. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 150.6 bits 688,  Expect = 5e-38
 Identities = 104/223 46%, Positives = 144/223 64%, Gaps = 9/223 4%
Query  48   WSPAVATWYG--P-ANGDGSEGGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEV 104
            W  A AT+YG  P        GGACGY + V + PF  +   G+  I+  G  CGSCYE+
Sbjct  18   WLDAKATFYGSDPRGAAPDDHGGACGYKD-VDKAPFDGMTGCGNEPIFKDGLACGSCYEI 76
Query  105  KCTGNSACSGNPVKVVITDECAGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQ 164
            KC   + CSG PV + ITD+       A YHFDLSG AFGAMA  G+++ LR AG++ +Q
Sbjct  77   KCKEPAECSGEPVLIKITDK--NYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQ 134
Query  165  HRRIECNYPGRS-IAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQS 223
             RR++C YP  + IAFHV+ GS+  Y+A LV+Y  GDG++  V++K    S  +  M+QS
Sbjct  135  FRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPK-GSDEFLPMKQS 193
Query  224  WGAVWKFDKGSPLRAPFSIKLTTLESGQTIVANNVIPAGWTPGQTYRSIVNF 275
            WGA+W+ D   PL+ PF+I+LT+ ESG  +  ++VIP  W P   Y+S + F
Sbjct  194  WGAIWRIDPPKPLKGPFTIRLTS-ESGGHVEQDDVIPEDWKPDTVYKSKIQF 244

Sequence Alignment: 33. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 150.6 bits 688,  Expect = 5e-38
 Identities = 104/223 46%, Positives = 144/223 64%, Gaps = 9/223 4%
Query  48   WSPAVATWYG--P-ANGDGSEGGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEV 104
            W  A AT+YG  P        GGACGY + V + PF  +   G+  I+  G  CGSCYE+
Sbjct  18   WLDAKATFYGSDPRGAAPDDHGGACGYKD-VDKAPFDGMTGCGNEPIFKDGLACGSCYEI 76
Query  105  KCTGNSACSGNPVKVVITDECAGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQ 164
            KC   + CSG PV + ITD+       A YHFDLSG AFGAMA  G+++ LR AG++ +Q
Sbjct  77   KCKEPAECSGEPVLIKITDK--NYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQ 134
Query  165  HRRIECNYPGRS-IAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQS 223
             RR++C YP  + IAFHV+ GS+  Y+A LV+Y  GDG++  V++K    S  +  M+QS
Sbjct  135  FRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPK-GSDEFLPMKQS 193
Query  224  WGAVWKFDKGSPLRAPFSIKLTTLESGQTIVANNVIPAGWTPGQTYRSIVNF 275
            WGA+W+ D   PL+ PF+I+LT+ ESG  +  ++VIP  W P   Y+S + F
Sbjct  194  WGAIWRMDPPKPLKGPFTIRLTS-ESGGHVEQDDVIPEDWKPDTVYKSKIQF 244

Sequence Alignment: 34. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 150.6 bits 688,  Expect = 6e-38
 Identities = 110/255 43%, Positives = 157/255 61%, Gaps = 16/255 6%
Query  12   LLTLIAILSIFLVIPSFCF---NPKKLYNASYYSPSSSDWSPAVATWYG--P-ANGDGSE 65
            +L  +A++   +V  ++C     P     A+Y       W  A AT+YG  P        
Sbjct  1    MLAAVAVVLASMVGGAWCAMGDKPGPNITATY----GDKWLDAKATFYGSDPRGAAPDDH 56
Query  66   GGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDEC 125
            GGACGY + V + PF  +   G+  I+  G GCGSCYE+KC   + CSG PV + ITD+ 
Sbjct  57   GGACGYKD-VDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDK- 114
Query  126  AGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRS-IAFHVDSG 184
                  A YHFDLSG AFGAMA  G+++ LR AG++ +Q RR++C YP  + I FHV+ G
Sbjct  115  -NYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKG 173
Query  185  SNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKL 244
            S+  Y+A LV+Y  GDG++  V++K    S  +  M+ SWGA+W+ D   PL+ PF+I+L
Sbjct  174  SSPNYLALLVKYAAGDGNIVGVDIKPK-GSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRL 232
Query  245  TTLESGQTIVANNVIPAGWTPGQTYRSIVNF 275
            T+ ESG  +   +VIP  W P   Y+S + F
Sbjct  233  TS-ESGGHVEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 35. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 143.8 bits 655,  Expect = 6e-36
 Identities = 103/231 44%, Positives = 145/231 62%, Gaps = 11/231 4%
Query  32   PKKLYNASYYSPSSSDWSPAVATWYGPANGDGSE--GGACGYGNAVGQPPFSSLISAGSP 89
            PK     +      SDW    ATWYG   G G +  GGACGY + V + PF+S+ + G+ 
Sbjct  2    PKVAKGKNITETYGSDWLERKATWYGKPTGAGPDDNGGACGYKD-VNKAPFNSMGACGNL 60
Query  90   LIYDSGKGCGSCYEVKCTGN--SACSGNPVKVVITDECAGCGSDAQYHFDLSGNAFGAMA 147
             I+  G  CGSC+E+KC     + CSG  V V ITD        A YHFDL+G+AFGAMA
Sbjct  61   PIFKDGL-CGSCFEIKCDKPKPAECSGEAVVVHITD--MNYEQIAAYHFDLAGHAFGAMA 117
Query  148  ISGQDENLRNAGKINIQHRRIECNYPGRSIAFHVDSGSNQEYFATLVEYEDGDGDLAKVE 207
              GQ+E L  AG I+++ RR++C Y G  + FHV+ GSN  Y+A LV+Y DGDGD+  V+
Sbjct  118  KKGQEEKLAKAGIIDMKFRRVKCKY-GEKVTFHVEKGSNPNYLALLVKYVDGDGDIVGVD 176
Query  208  LKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLTTLESGQTIVANNVIPAGWTPGQ 267
            +KE     ++  +++SWGA+W+ D   P++ P ++++TT E G     ++VIP GW    
Sbjct  177  IKEK-GGDAYQPLKHSWGAIWRKDSPDPIKFPVTVQITT-EGGTKTAYDDVIPEGWKADT 234
Query  268  TY 269
            TY
Sbjct  235  TY 236

Sequence Alignment: 36. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 138.1 bits 627,  Expect = 2e-34
 Identities = 88/189 46%, Positives = 124/189 65%, Gaps = 5/189 2%
Query  83   LISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECAGCGSDAQYHFDLSGNA 142
            + + G+  I+  GKGCGSCYEV+C     CSGNPV V ITD        A YHFDLSG A
Sbjct  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITD--MNYEPIAPYHFDLSGKA 58
Query  143  FGAMAISGQDENLRNAGKINIQHRRIECNYP-GRSIAFHVDSGSNQEYFATLVEYEDGDG 201
            FG++A  G ++ LR+ G ++++ RR+ C YP G+ I FH++ G N  Y A LV++   DG
Sbjct  59   FGSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDG 118
Query  202  DLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLTTLESGQTIVANNVIPA 261
            D+  +E+++ L S  W  M+ SWGA+W+ D    L+ PFSI+LT+ ESG+ ++A ++IPA
Sbjct  119  DIVLMEIQDKL-SAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTS-ESGKKVIAKDIIPA 176
Query  262  GWTPGQTYRSIVNF 275
             W P   Y S V F
Sbjct  177  NWRPDAVYTSNVQF 190

Sequence Alignment: 37. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 135.9 bits 617,  Expect = 1e-33
 Identities = 107/252 42%, Positives = 149/252 59%, Gaps = 18/252 7%
Query  10   SELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSDW----SPAVATWYGPANGDGSE 65
            S  L L  ++   +V PS   +PK     +  +     W     P +      A  D   
Sbjct  3    SSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKD--N 60
Query  66   GGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDEC 125
            GGACGY + V + PF  + S G+  I+  GKGCGSC+E+KC+   ACS  P  + +TD  
Sbjct  61   GGACGYKD-VDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTD-- 117
Query  126  AGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRS-IAFHVDSG 184
                  A YHFDLSG A   MA  G+DE LR AG I+ Q RR++C YP  + I FH++  
Sbjct  118  MNDEPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKA 174
Query  185  SNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKL 244
            SN  Y+A LV+Y  GDGD+ +VE+KE   S  W ++++SWGA+W+ D   PL+ PFS+++
Sbjct  175  SNPNYLALLVKYVAGDGDVVEVEIKEK-GSEEWKALKESWGAIWRIDTPKPLKGPFSVRV 233
Query  245  TTLESGQTIVANNVIPAGWTPGQTYRSIVN 274
            TT E  +   A + IP    PG+  R  VN
Sbjct  234  TT-EGARRSSAEDAIP---DPGRRQRVQVN 259

Sequence Alignment: 38. Allergen Name: Ara t expansin Sequence ID: CAB37496

 Score = 92.1 bits 405,  Expect = 2e-20
 Identities = 71/208 34%, Positives = 113/208 54%, Gaps = 13/208 6%
Query  53   ATWYGPANGDGSEGGACGYGN-AVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSA 111
            A ++  A+   S  GAC YG+ A G   F+  I+A  P IY  G GCG+C++V+C   + 
Sbjct  31   AAYFSSASALSS--GACAYGSMATGF--FAGHIAAALPSIYKDGSGCGACFQVRCKNPTL 86
Query  112  CSGNPVKVVITDECAGCGSDAQYHFDLSGNAFGAMA--ISGQDENLRNAGKINIQHRRIE 169
            CS     V++TD         Q  + LS  AF AMA  + G D +L   G ++I++RR+ 
Sbjct  87   CSSKGTTVIVTD----LNKTNQTDLVLSSRAFRAMAKPVVGADRDLLKQGIVDIEYRRVP 142
Query  170  CNYPGRSIAFHVD-SGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVW 228
            C+Y  + +   V+ S  N  Y+A  + Y+ G  ++  + + + + S  W  M +S GAVW
Sbjct  143  CDYGNKKMNVRVEESSKNPNYLAIKLLYQGGQTEVVAIYIAQ-VGSSHWSYMTRSHGAVW 201
Query  229  KFDKGSPLRAPFSIKLTTLESGQTIVANNVIPAGWTPGQTY 269
              DK       F   +T    G+ + +  V+PA W  G++Y
Sbjct  202  VTDKVPNGALQFRFVVTAGYDGKMVWSQRVLPANWEAGKSY 242

Sequence Alignment: 39. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 80.7 bits 350,  Expect = 6e-17
 Identities = 62/204 30%, Positives = 107/204 52%, Gaps = 10/204 4%
Query  67   GACGYGNAVGQPPFSS-LISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDEC 125
            G+CGYG+      F+   ++A SP ++  G GCG+C++V+C     CS    KVV+TDE 
Sbjct  52   GSCGYGSLAAS--FNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDEA 109
Query  126  AGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYP-GRSIAFHVDSG 184
                S  +  + LS  A+ AMA  G    LR    ++++++R+ C Y  GR+++  V+  
Sbjct  110  R---STNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEK 166
Query  185  SNQEYFATL-VEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIK 243
            S      ++   Y+ G  D+  V++   + S +W  M + +G  W   +       F + 
Sbjct  167  SRPPRELSIRFLYQGGQTDIVAVDVA-TVGSSNWKFMTRDYGPAWSTAQAPAGPLQFRVV 225
Query  244  LTTLESGQTIVANN-VIPAGWTPGQTYRSIVNFA 276
            +T    G+ + A+  V+P  WT G+ Y + V  A
Sbjct  226  VTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQIA 259

Sequence Alignment: 40. Allergen Name: Ory s 1 Sequence ID: BAA85432

 Score = 79.0 bits 342,  Expect = 2e-16
 Identities = 70/221 31%, Positives = 121/221 54%, Gaps = 24/221 10%
Query  45   SSDWSPAVATWYGPANGDGSE-GGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYE 103
            +SDW    AT+YG  +G G + GGACGY +      +S+  +A S  ++  G GCG CYE
Sbjct  49   TSDWHDGSATFYGDPSGMGDDFGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYE 108
Query  104  VKCTGNSACS-GNPVKVVI-TDEC----------AGCGSDAQYHFDLSGNAFGAMAISGQ 151
            ++C  +  C+ G+P  V+  T+ C           G  +  ++HFD++  +F  +A    
Sbjct  109  LRCVKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLA---- 164
Query  152  DENLRNAGKINIQHRRIECNYPGRSIAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEA 211
                R AG + +Q+RR+ C   G  + F +    N+ ++   V    G GD++ + +K +
Sbjct  165  ---QRVAGIVPVQYRRVPCQRTG-GVRFCLQ--GNHYWLLLYVMNVGGAGDVSSLSVKTS 218
Query  212  LDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLTTLESGQ-TIVANNVIPAGWTPGQTYR 270
               G+W    ++WG  ++          +++KLTT  + Q TI+ ++ I   W  G  Y+
Sbjct  219  GGGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCYQ 278
Query  271  SIVNF 275
               NF
Sbjct  279  GSNNF 283

Sequence Alignment: 41. Allergen Name: Cyn d 2 Sequence ID: CAA10346

 Score = 56.5 bits 231,  Expect = 5e-10
 Identities = 39/89 43%, Positives = 59/89 66%, Gaps = 4/89 4%
Query  177  IAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPL 236
            + F V+ GSN++++A LV+YE GD  +A+VEL+E   S  W +M +  G VW FD   PL
Sbjct  30   VTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELREH-GSDEWVAMTKGEGGVWTFDSEEPL 86
Query  237  RAPFSIKLTTLESGQTIVANNVIPAGWTPGQTY 269
            + PF+ ++ T E G   V ++V+P  +T G TY
Sbjct  87   KGPFNFRFLT-EKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 42. Allergen Name: Dac g 2 Sequence ID: CAA10345

 Score = 56.1 bits 229,  Expect = 7e-10
 Identities = 39/89 43%, Positives = 59/89 66%, Gaps = 4/89 4%
Query  177  IAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPL 236
            + F V+ GSN++++A LV+YE GD  +A+VEL+E   S  W +M +  G VW FD   PL
Sbjct  30   VTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELREH-GSDEWVAMTKGEGGVWTFDSEEPL 86
Query  237  RAPFSIKLTTLESGQTIVANNVIPAGWTPGQTY 269
            + PF+ ++ T E G   V ++V+P  +T G TY
Sbjct  87   QGPFNFRFLT-EKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 43. Allergen Name: Poa p 2 Sequence ID: CAA10348

 Score = 56.1 bits 229,  Expect = 7e-10
 Identities = 39/89 43%, Positives = 59/89 66%, Gaps = 4/89 4%
Query  177  IAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPL 236
            + F V+ GSN++++A LV+YE GD  +A+VEL+E   S  W +M +  G VW FD   PL
Sbjct  30   VTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELREH-GSDEWVAMTKGEGGVWTFDSEEPL 86
Query  237  RAPFSIKLTTLESGQTIVANNVIPAGWTPGQTY 269
            + PF+ ++ T E G   V ++V+P  +T G TY
Sbjct  87   QGPFNFRFLT-EKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 44. Allergen Name: Phl p 2 Sequence ID: P43214

 Score = 56.1 bits 229,  Expect = 7e-10
 Identities = 39/89 43%, Positives = 59/89 66%, Gaps = 4/89 4%
Query  177  IAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPL 236
            + F V+ GSN++++A LV+YE GD  +A+VEL+E   S  W +M +  G VW FD   PL
Sbjct  30   VTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELREH-GSDEWVAMTKGEGGVWTFDSEEPL 86
Query  237  RAPFSIKLTTLESGQTIVANNVIPAGWTPGQTY 269
            + PF+ ++ T E G   V ++V+P  +T G TY
Sbjct  87   QGPFNFRFLT-EKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 45. Allergen Name: Lol p 2 Sequence ID: P14947

 Score = 48.8 bits 193,  Expect = 9e-08
 Identities = 31/91 34%, Positives = 59/91 64%, Gaps = 4/91 4%
Query  177  IAFHVDSGSNQEYFATLVEY-EDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSP 235
            + F V+ GS+++ +A  ++Y ++GD  +A+VELKE   S  W +++++   VW+     P
Sbjct  4    VEFTVEKGSDEKNLALSIKYNKEGDS-MAEVELKEH-GSNEWLALKKNGDGVWEIKSDKP 61
Query  236  LRAPFSIKLTTLESGQTIVANNVIPAGWTPGQTYR 270
            L+ PF+ ++ + E G   V ++V+PA +  G TY+
Sbjct  62   LKGPFNFRFVS-EKGMRNVFDDVVPADFKVGTTYK 95

Sequence Alignment: 46. Allergen Name: Lol p 2 Sequence ID: CAA51775

 Score = 44.7 bits 173,  Expect = 1e-06
 Identities = 29/85 34%, Positives = 55/85 64%, Gaps = 4/85 4%
Query  179  FHVDSGSNQEYFATLVEY-EDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLR 237
            F V+ GS+++ +A  ++Y ++GD  +A+VELKE   S  W +++++   VW+     PL+
Sbjct  2    FTVEKGSDEKNLALSIKYSKEGDA-MAEVELKEH-GSNEWLALKKNGDGVWEIKSDKPLK 59
Query  238  APFSIKLTTLESGQTIVANNVIPAGWTPG 266
             PF+ ++ + E G   V ++V+PA +  G
Sbjct  60   GPFNFRFVS-EKGMWNVFDDVVPADFKVG 87

Sequence Alignment: 47. Allergen Name: Phl p 3.0101 Sequence ID: 2JNZ_A

 Score = 42.1 bits 161,  Expect = 1e-05
 Identities = 27/91 29%, Positives = 50/91 54%, Gaps = 3/91 3%
Query  177  IAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPL 236
            + F V  GS+ + +   ++Y      LA+VEL++   S  W+ + +  G VW+     PL
Sbjct  15   VTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQH-GSEEWEPLTKK-GNVWEVKSSKPL 72
Query  237  RAPFSIKLTTLESGQTIVANNVIPAGWTPGQTYR 270
              PF+ ++ + + G   V + VIP  ++ G+TY+
Sbjct  73   VGPFNFRFMS-KGGMRNVFDEVIPTAFSIGKTYK 105

Sequence Alignment: 48. Allergen Name: Dac g 3 Sequence ID: P93124

 Score = 40.6 bits 153,  Expect = 3e-05
 Identities = 26/90 28%, Positives = 48/90 53%, Gaps = 3/90 3%
Query  177  IAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPL 236
            + F V+ GS+ + +   ++Y      LA+VEL++   S  W+ + +  G +W+     PL
Sbjct  3    VTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQH-GSEEWEPLTKK-GNLWEVKSSKPL 60
Query  237  RAPFSIKLTTLESGQTIVANNVIPAGWTPGQTY 269
              PF+ ++ + + G   V + VIP  +  G TY
Sbjct  61   TGPFNFRFMS-KGGMRNVFDEVIPTAFKIGTTY 92

Sequence Alignment: 49. Allergen Name: Lol p 3 Sequence ID: P14948

 Score = 39.3 bits 147,  Expect = 6e-05
 Identities = 26/90 28%, Positives = 49/90 54%, Gaps = 3/90 3%
Query  177  IAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPL 236
            + + V+ GS+ + +   ++Y      LA+VEL++   S  W+ M +  G +W+     PL
Sbjct  3    VDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQH-GSEEWEPMTKK-GNLWEVKSAKPL 60
Query  237  RAPFSIKLTTLESGQTIVANNVIPAGWTPGQTY 269
              P + ++ + + G   V + VIP  +T G+TY
Sbjct  61   TGPMNFRFLS-KGGMKNVFDEVIPTAFTVGKTY 92

Sequence Alignment: 50. Allergen Name: Cyn d 15 Sequence ID: AAP80171

 Score = 37.6 bits 139,  Expect = 0.0002
 Identities = 32/91 35%, Positives = 56/91 61%, Gaps = 9/91 9%
Query  176  SIAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSP 235
            +I FHV+  S +  FA  +  +D   ++ +V+++E   + + D M +S G  W  DK  P
Sbjct  21   NIIFHVEESSPK--FALSI--KDSAKEITQVDVREH-GADNMDPMTKS-GDSWTIDK--P 72
Query  236  LRAPFSIKLTTLESGQTIVANNVIPAGWTPGQTYRSIVNF 275
            L+ P++I+L   E G + V ++VIP  W  G  Y + ++F
Sbjct  73   LKGPLNIRLRA-EGGGSRVQDDVIPENWKAGTDYPTKLHF 111

Sequence Alignment: 51. Allergen Name: Tri a 3 Sequence ID: CAA90746

 Score = 36.9 bits 136,  Expect = 0.0004
 Identities = 24/90 26%, Positives = 49/90 54%, Gaps = 3/90 3%
Query  177  IAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPL 236
            + + V  GS+++ +A  ++Y   +  L++VEL++   S  W  + +  G VW+     PL
Sbjct  25   VKLTVQKGSDKKKLALKIDYTRPNDSLSEVELRQ-YGSEEWQPLTKK-GDVWEVSCSKPL 82
Query  237  RAPFSIKLTTLESGQTIVANNVIPAGWTPGQTY 269
              PF+ ++ + ++G   V + V    +  G+TY
Sbjct  83   VGPFNFRFLS-KNGMKKVFDEVFSTDFKIGKTY 114

Sequence Alignment: 52. Allergen Name: Sor h 2.0101 Sequence ID: A0A077B7S9

 Score = 32.6 bits 115,  Expect = 0.008
 Identities = 16/69 23%, Positives = 39/69 56%, Gaps = 1/69 1%
Query  202  DLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLTTLESGQTIVANNVIPA 261
            D+++V +K+   +   D +++S    + ++   P++ P+S+++     G     ++VIPA
Sbjct  47   DVSEVAVKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYR-TTDDVIPA 105
Query  262  GWTPGQTYRS 271
             + PG  Y++
Sbjct  106  DFKPGSVYKT 115

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.