The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAMIPSISKLLFVAICLFVYMGLSFGDFSIVGYSQNDLTSTERLIQLFESWMLKHNKIYK
NIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEFKEKYTGSIAGNYTTTE
LSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNE
YSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKT
DGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYG
PNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Sequence Info Allergen Name Length Opt Bits Score E Value
AAB02650 Car p papain 345 2355 596.5 5.4e-172
P14080 Cari p 2.0101 352 1502 382.6 1.3e-107
AAA32629 Act d 1 380 912 234.6 5e-63
P00785 Act d 1 380 908 233.6 1e-62
BAA21849 Ana c 2 351 906 233.2 1.2e-62
V5LU01 Amb a 11.0101 386 702 182.0 3.6e-47
AAB09252 Gly m 1 379 540 141.4 5.8e-35
P22895 Gly m 1 379 532 139.4 2.3e-34
2428875 Der f 1.0107 303 439 116.3 1.6e-27
2428875 Der f 1.0102 303 439 116.3 1.6e-27
ABL84751 Der f 1.0110 321 439 116.3 1.8e-27
BAC53948 Der f 1.0101 321 439 116.3 1.8e-27
P16311 Der f 1 321 439 116.3 1.8e-27
AAQ24541 Blo t 1.0201 333 439 116.2 1.9e-27
2428875 Der f 1.0103 303 438 116.1 1.9e-27
2428875 Der f 1.0105 303 438 116.1 1.9e-27
ABL84749 Der f 1.0108 321 434 115.0 4.3e-27
ABL84750 Der f 1.0109 321 434 115.0 4.3e-27
2428875 Der f 1.0104 303 425 112.8 1.8e-26
AAC82352 Eur m 1.0102 321 419 111.3 5.8e-26
CAQ68250 Der p 1.0124 302 416 110.6 8.7e-26
AAC82351 Eur m 1.0101 321 412 109.5 2e-25
P25780 Eur m 1.0101 321 412 109.5 2e-25
P08176 Der p 1 320 408 108.5 3.9e-25
ABA39435 Der p 1.0113 302 407 108.3 4.2e-25
CAA46316 Der f 1 212 365 98.2 3.2e-22
6771329 Der p 1.0122 222 352 94.9 3.4e-21
CAA42677 Eur m 1.0101 211 350 94.5 4.3e-21
6771329 Der p 1.0123 222 347 93.7 8e-21
6771329 Der p 1.0121 222 347 93.7 8e-21
6771329 Der p 1.0118 222 346 93.4 9.5e-21
6771329 Der p 1.0120 222 346 93.4 9.5e-21
6771329 Der p 1.0114 222 344 92.9 1.3e-20
6771329 Der p 1.0115 222 344 92.9 1.3e-20
6771329 Der p 1.0117 222 342 92.4 1.9e-20
6771329 Der p 1.0119 222 341 92.2 2.3e-20
6771329 Der p 1.0116 222 338 91.4 3.8e-20
ABM53753 Tyr p 1.0101 336 320 86.4 1.9e-18
AAK58415 Blo t 1.0101 221 304 82.9 1.4e-17
AAA28296 Der p 1 96 206 59.3 7.5e-11
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Car p papain Sequence ID: AAB02650

 Score = 596.5 bits 2355,  Expect = 5e-172
 Identities = 345/345 100%, Positives = 345/345 100%, Gaps = 0/345 0%
Query  1    MAMIPSISKLLFVAICLFVYMGLSFGDFSIVGYSQNDLTSTERLIQLFESWMLKHNKIYK 60
            MAMIPSISKLLFVAICLFVYMGLSFGDFSIVGYSQNDLTSTERLIQLFESWMLKHNKIYK
Sbjct  1    MAMIPSISKLLFVAICLFVYMGLSFGDFSIVGYSQNDLTSTERLIQLFESWMLKHNKIYK 60
Query  61   NIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEFKEKYTGSIAGNYTTTE 120
            NIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEFKEKYTGSIAGNYTTTE
Sbjct  61   NIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEFKEKYTGSIAGNYTTTE 120
Query  121  LSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNE 180
            LSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNE
Sbjct  121  LSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNE 180
Query  181  YSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKT 240
            YSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKT
Sbjct  181  YSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKT 240
Query  241  DGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYG 300
            DGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYG
Sbjct  241  DGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYG 300
Query  301  PNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN 345
            PNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Sbjct  301  PNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN 345

Sequence Alignment: 2. Allergen Name: Cari p 2.0101 Sequence ID: P14080

 Score = 382.6 bits 1502,  Expect = 1e-107
 Identities = 218/343 63%, Positives = 267/343 77%, Gaps = 7/343 2%
Query  1    MAMIPSISKLLFVAICLFVYMGLSFGDFSIVGYSQNDLTSTERLIQLFESWMLKHNKIYK 60
            MA + SISK++F+A CL ++MGLS  DF  VGYSQ+DLTS ERLIQLF+SWMLKHNKIY+
Sbjct  1    MATMSSISKIIFLATCLIIHMGLSSADFYTVGYSQDDLTSIERLIQLFDSWMLKHNKIYE 60
Query  61   NIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEFKEKYTGSIAGNYTTTE 120
            +IDEKIYRFEIF+DNL YIDETNKKNNSYWLGLN FAD+SNDEFK+KY G +A ++T  E
Sbjct  61   SIDEKIYRFEIFRDNLMYIDETNKKNNSYWLGLNGFADLSNDEFKKKYVGFVAEDFTGLE 120
Query  121  -LSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLN 179
             +  E+       N P+ +DWR KGAVTPVKNQG+CGSCWAFS + T+EGI KI TGNL 
Sbjct  121  HFDNEDFTYKHVTNYPQSIDWRAKGAVTPVKNQGACGSCWAFSTIATVEGINKIVTGNLL 180
Query  180  EYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREK-GPYAA 238
            E SEQEL+DCD+ SYGC GGY  ++LQ VA  G+H    YPY+  Q  CR+ +K GP   
Sbjct  181  ELSEQELVDCDKHSYGCKGGYQTTSLQYVANNGVHTSKVYPYQAKQYKCRATDKPGP-KV 239
Query  239  KTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVG 298
            K  G ++V    E ++L ++ANQP+SV++EA GK FQLY+ G+F GPCG K+DHAV AVG
Sbjct  240  KITGYKRVPSNCETSFLGALANQPLSVLVEAGGKPFQLYKSGVFDGPCGTKLDHAVTAVG 299
Query  299  YGP----NYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVK 344
            YG     NYI+IKNSWG  WGE GY+R+KR +GNS G CG+Y SS+YP K
Sbjct  300  YGTSDGKNYIIIKNSWGPNWGEKGYMRLKRQSGNSQGTCGVYKSSYYPFK 349

Sequence Alignment: 3. Allergen Name: Act d 1 Sequence ID: AAA32629

 Score = 234.6 bits 912,  Expect = 5e-63
 Identities = 152/322 47%, Positives = 201/322 62%, Gaps = 20/322 6%
Query  18   FVYMGLSFGDFSIV---GYSQNDLT--STERLIQLFESWMLKHNKIYKNIDEKIYRFEIF 72
            FV M L F    ++    ++  +LT  + + +  ++ESW++K+ K Y ++ E   RFEIF
Sbjct  7    FVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYGKSYNSLGEWERRFEIF 66
Query  73   KDNLKYIDETNKKNN-SYWLGLNVFADMSNDEFKEKYTGSIAG-NYTTTELSYEEVLNDG 130
            K+ L++IDE N   N SY +GLN FAD++++EF+  Y G  +G N T     YE  +  G
Sbjct  67   KETLRFIDEHNADTNRSYKVGLNQFADLTDEEFRSTYLGFTSGSNKTKVSNRYEPRV--G 124
Query  131  DVNIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCD 190
             V +P YVDWR  GAV  +K+QG CG CWAFSA+ T+EGI KI TG L   SEQEL+DC 
Sbjct  125  QV-LPSYVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCG 183
Query  191  RR--SYGCNGGYPWSALQLVAQYG-IHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQ 247
            R   + GCNGGY    +Q++   G I+    YPY      C    +       D    V 
Sbjct  184  RTQNTRGCNGGYITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENV- 242
Query  248  PYN-EGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGP----N 302
            PYN E AL  ++  QPVSV L+AAG  F+ Y  GIF GPCG  +DHAV  VGYG     +
Sbjct  243  PYNNEWALQTAVTYQPVSVALDAAGDAFKQYSSGIFTGPCGTAIDHAVTIVGYGTEGGID 302
Query  303  YILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVK 344
            Y ++KNSW T WGE GY+RI R  G + G CG+ T   YPVK
Sbjct  303  YWIVKNSWDTTWGEEGYMRILRNVGGA-GTCGIATMPSYPVK 343

Sequence Alignment: 4. Allergen Name: Act d 1 Sequence ID: P00785

 Score = 233.6 bits 908,  Expect = 1e-62
 Identities = 152/322 47%, Positives = 201/322 62%, Gaps = 20/322 6%
Query  18   FVYMGLSFGDFSIV---GYSQNDLT--STERLIQLFESWMLKHNKIYKNIDEKIYRFEIF 72
            FV M L F    ++    ++  +LT  + + +  ++ESW++K+ K Y ++ E   RFEIF
Sbjct  7    FVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYGKSYNSLGEWERRFEIF 66
Query  73   KDNLKYIDETNKKNN-SYWLGLNVFADMSNDEFKEKYTGSIAG-NYTTTELSYEEVLNDG 130
            K+ L++IDE N   N SY +GLN FAD++++EF+  Y G  +G N T     YE  +  G
Sbjct  67   KETLRFIDEHNADTNRSYKVGLNQFADLTDEEFRSTYLGFTSGSNKTKVSNRYEPRF--G 124
Query  131  DVNIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCD 190
             V +P YVDWR  GAV  +K+QG CG CWAFSA+ T+EGI KI TG L   SEQEL+DC 
Sbjct  125  QV-LPSYVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCG 183
Query  191  RR--SYGCNGGYPWSALQLVAQYG-IHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQ 247
            R   + GCNGGY    +Q++   G I+    YPY      C    +       D    V 
Sbjct  184  RTQNTRGCNGGYITDGFQFIINNGGINTEENYPYTAQDGECNLDLQNEKYVTIDTYENV- 242
Query  248  PYN-EGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGP----N 302
            PYN E AL  ++  QPVSV L+AAG  F+ Y  GIF GPCG  +DHAV  VGYG     +
Sbjct  243  PYNNEWALQTAVTYQPVSVALDAAGDAFKHYSSGIFTGPCGTAIDHAVTIVGYGTEGGID 302
Query  303  YILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVK 344
            Y ++KNSW T WGE GY+RI R  G + G CG+ T   YPVK
Sbjct  303  YWIVKNSWDTTWGEEGYMRILRNVGGA-GTCGIATMPSYPVK 343

Sequence Alignment: 5. Allergen Name: Ana c 2 Sequence ID: BAA21849

 Score = 233.2 bits 906,  Expect = 1e-62
 Identities = 132/291 45%, Positives = 202/291 69%, Gaps = 19/291 6%
Query  44   LIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKN-NSYWLGLNVFADMSND 102
            +++ FE WM ++ ++YK+ DEK+ RF+IFK+N+K+I+  N +N NSY LG+N F DM+  
Sbjct  33   MMKRFEEWMAEYGRVYKDDDEKMRRFQIFKNNVKHIETFNSRNENSYTLGINQFTDMTKS 92
Query  103  EFKEKYTG-SIAGNYTTTELSYEEVLNDGDVNI---PEYVDWRQKGAVTPVKNQGSCGSC 158
            EF  +YTG S+  N     +  E V++  DVNI   P+ +DWR  GAV  VKNQ  CGSC
Sbjct  93   EFVAQYTGVSLPLN-----IEREPVVSFDDVNISAVPQSIDWRDYGAVNEVKNQNPCGSC 147
Query  159  WAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQ-LVAQYGIHYRN 217
            W+F+A+ T+EGI KI+TG L   SEQE+LDC   SYGC GG+   A   +++  G+    
Sbjct  148  WSFAAIATVEGIYKIKTGYLVSLSEQEVLDCAV-SYGCKGGWVNKAYDFIISNNGVTTEE 206
Query  218  TYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLY 277
             YPY   Q  C +    P +A   G   V+  +E +++Y+++NQP++ +++A+ ++FQ Y
Sbjct  207  NYPYLAYQGTCNA-NSFPNSAYITGYSYVRRNDERSMMYAVSNQPIAALIDAS-ENFQYY 264
Query  278  RGGIFVGPCGNKVDHAVAAVGYGPN-----YILIKNSWGTGWGENGYIRIKRGTGNSYGV 332
             GG+F GPCG  ++HA+  +GYG +     Y +++NSWG+ WGE GY+R+ RG  +S GV
Sbjct  265  NGGVFSGPCGTSLNHAITIIGYGQDSSGTKYWIVRNSWGSSWGEGGYVRMARGVSSSSGV 324
Query  333  CGLYTSSFYP 342
            CG+  + ++P
Sbjct  325  CGIAMAPLFP 334

Sequence Alignment: 6. Allergen Name: Amb a 11.0101 Sequence ID: V5LU01

 Score = 182.0 bits 702,  Expect = 4e-47
 Identities = 132/324 40%, Positives = 196/324 60%, Gaps = 23/324 7%
Query  15   ICLFVYMGLSFGDFSIVGYSQNDLTSTERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKD 74
            +C+   + L +G      Y + +L S E ++ +++ W  +HN   ++ +    RF +FK 
Sbjct  7    VCFSFSLVLILGLVESFHYHERELESEEGFMGMYDRWREQHNIEMRSPE----RFNVFKY 62
Query  75   NLKYIDETNKKNNSYWLGLNVFADMSNDEFKEKYTGSIAGNYTTTELSYEEVLNDGDVN- 133
            N++ I E+NK +  Y L +N FADM+N EF   Y  S   ++     S    + D D N 
Sbjct  63   NVRRIHESNKMDKPYKLKVNEFADMTNLEFVNTYANSKISHFQALRGSAPGSI-DTDPNK 121
Query  134  ---------IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQ 184
                     IP+ VDWR+K AVT VK QG CGSCWAF+AVV +EGI  IRTG L ++SEQ
Sbjct  122  DFIYANVTKIPDKVDWREKNAVTDVKGQGGCGSCWAFAAVVALEGINAIRTGKLVKFSEQ 181
Query  185  ELLDCDRRSYGCNGGYPWSALQLVAQYG-IHYRNTYPYEGVQRYCRSREKGPYAAKTDGV 243
            +L+DCD  + GC+GG    A+  V ++G I    +YPY G +  C  + K     K DG 
Sbjct  182  QLVDCDMTNAGCDGGLMEPAFTYVIKHGGIAPEASYPYVGKRETC-DKAKIKDVLKIDGR 240
Query  244  RQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPN- 302
            + V   +E AL  ++A+QPV+  ++ +G  +Q+Y  G++ G CG + +H V  VGYG N 
Sbjct  241  QNVPGLDEEALRKAVAHQPVATGIQLSGHGLQFYSEGVYTGDCGTEPNHGVGIVGYGENE 300
Query  303  ----YILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN 345
                +  +KNSWG  WGE GYI ++RG     G+CG+   S +P+ N
Sbjct  301  KGIKFWTVKNSWGPTWGEKGYIHLQRGA-RKEGLCGVAMHSSFPIMN 346

Sequence Alignment: 7. Allergen Name: Gly m 1 Sequence ID: AAB09252

 Score = 141.4 bits 540,  Expect = 6e-35
 Identities = 131/330 39%, Positives = 196/330 59%, Gaps = 28/330 8%
Query  12   FVAICLFVYMGLSFGDF-----SIVGYSQNDLTSTERLIQLFESWMLKHNKIYKNIDEKI 66
            F+ + LF  +GLS         SI+      +T+ +++  LF+ W  +H ++Y N +E+ 
Sbjct  3    FLVLLLFSLLGLSSSSSISTHRSILDLDLTKFTTQKQVSSLFQLWKSEHGRVYHNHEEEA 62
Query  67   YRFEIFKDNLKYIDETN---KKNNSYWLGLNVFADMSNDEFKEKYTGSIAGNYTTTELSY 123
             R+EIFK+N  YI + N   K  +S+ LGLN FAD++  EF +KY  +        +++ 
Sbjct  63   KRLEIFKNNSNYIRDMNANRKSPHSHRLGLNKFADITPQEFSKKYLQAPKDVSQQIKMAN 122
Query  124  EEVLNDGDV--NIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEY 181
            +++  +     + P   DWR+KG +T VK QG CG  WAFSA   IE    I TG+L   
Sbjct  123  KKMKKEQYSCDHPPASWDWRKKGVITQVKYQGGCGRGWAFSATGAIEAAHAIATGDLVSL 182
Query  182  SEQELLDCDRRSYGCNGGYPWSALQLVAQYG-IHYRNTYPYEGVQRYCRSREKGPYAAKT 240
            SEQEL+DC   S G   G+ + +++ V ++G I   + YPY   +  C++  K       
Sbjct  183  SEQELVDCVEESEGSYNGWQYQSFEWVLEHGGIATDDDYPYRAKEGRCKA-NKIQDKVTI 241
Query  241  DGVRQV-------QPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGP-CGNK--V 290
            DG   +       +   E A+L +I  QP+SV ++A  KDF+LY GGI+ G  C +   +
Sbjct  242  DGYETLIMSDESTESETEQAFLSAILEQPISVSIDA--KDFHLYTGGIYDGENCTSPYGI 299
Query  291  DHAVAAVGYGP----NYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVK 344
            +H V  VGYG     +Y + KNSWG  WGE+GYI I+R TGN  GVCG+   + YP K
Sbjct  300  NHFVLLVGYGSADGVDYWIAKNSWGEDWGEDGYIWIQRNTGNLLGVCGMNYFASYPTK 357

Sequence Alignment: 8. Allergen Name: Gly m 1 Sequence ID: P22895

 Score = 139.4 bits 532,  Expect = 2e-34
 Identities = 131/330 39%, Positives = 196/330 59%, Gaps = 28/330 8%
Query  12   FVAICLFVYMGLSFGDF-----SIVGYSQNDLTSTERLIQLFESWMLKHNKIYKNIDEKI 66
            F+ + LF  +GLS         SI+      +T+ +++  LF+ W  +H ++Y N +E+ 
Sbjct  3    FLVLLLFSLLGLSSSSSISTHRSILDLDLTKFTTQKQVSSLFQLWKSEHGRVYHNHEEEA 62
Query  67   YRFEIFKDNLKYIDETN---KKNNSYWLGLNVFADMSNDEFKEKYTGSIAGNYTTTELSY 123
             R+EIFK+N  YI + N   K  +S+ LGLN FAD++  EF +KY  +        +++ 
Sbjct  63   KRLEIFKNNSNYIRDMNANRKSPHSHRLGLNKFADITPQEFSKKYLQAPKDVSQQIKMAN 122
Query  124  EEVLNDGDV--NIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEY 181
            +++  +     + P   DWR+KG +T VK QG CG  WAFSA   IE    I TG+L   
Sbjct  123  KKMKKEQYSCDHPPASWDWRKKGVITQVKYQGGCGRGWAFSATGAIEAAHAIATGDLVSL 182
Query  182  SEQELLDCDRRSYGCNGGYPWSALQLVAQYG-IHYRNTYPYEGVQRYCRSREKGPYAAKT 240
            SEQEL+DC   S G   G+ + +++ V ++G I   + YPY   +  C++  K       
Sbjct  183  SEQELVDCVEESEGSYNGWQYQSFEWVLEHGGIATDDDYPYRAKEGRCKA-NKIQDKVTI 241
Query  241  DGVRQV-------QPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGP-CGNK--V 290
            DG   +       +   E A+L +I  QP+SV ++A  KDF+LY GGI+ G  C +   +
Sbjct  242  DGYETLIMSDESTESETEQAFLSAILEQPISVSIDA--KDFHLYTGGIYDGENCTSPYGI 299
Query  291  DHAVAAVGYGP----NYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVK 344
            +H V  VGYG     +Y + KNSWG  WGE+GYI I+R TGN  GVCG+   + YP K
Sbjct  300  NHFVLLVGYGSADGVDYWIAKNSWGFDWGEDGYIWIQRNTGNLLGVCGMNYFASYPTK 357

Sequence Alignment: 9. Allergen Name: Der f 1.0107 Sequence ID: 2428875

 Score = 116.3 bits 439,  Expect = 2e-27
 Identities = 92/270 34%, Positives = 144/270 53%, Gaps = 25/270 9%
Query  45   IQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEF 104
            I+ FE +    NK Y  ++E+    + F ++LKY+ E NK        +N ++D+S DEF
Sbjct  5    IKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYV-EANKG------AINHLSDLSLDEF 57
Query  105  KEKYTGSIAGNY---TTTELSYEE-VLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWA 160
            K +Y  S        T  +L+ E        VN+P  +D R    VTP++ QG CGSCWA
Sbjct  58   KNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWA 117
Query  161  FSAVVTIEGI-IKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTY 219
            FS V   E   +  R  +L+  SEQEL+DC  + +GC+G      ++ + Q G+    +Y
Sbjct  118  FSGVAATESAYLAYRNTSLD-LSEQELVDCASQ-HGCHGDTIPRGIEYIQQNGVVEERSY 175
Query  220  PYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKD---FQL 276
            PY   ++ CR      Y        Q+ P +   +  ++     ++ +    KD   FQ 
Sbjct  176  PYVAREQRCRRPNSQHYGISN--YCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQH 233
Query  277  YRGGIFVG-PCGNKVD-HAVAAVGYGP----NYILIKNSWGTGWGENGYIRIKRG 325
            Y G   +    G + + HAV  VGYG     +Y +++NSW T WG++GY   + G
Sbjct  234  YDGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAG 288

Sequence Alignment: 10. Allergen Name: Der f 1.0102 Sequence ID: 2428875

 Score = 116.3 bits 439,  Expect = 2e-27
 Identities = 92/270 34%, Positives = 144/270 53%, Gaps = 25/270 9%
Query  45   IQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEF 104
            I+ FE +    NK Y  ++E+    + F ++LKY+ E NK        +N ++D+S DEF
Sbjct  5    IKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYV-EANKG------AINHLSDLSLDEF 57
Query  105  KEKYTGSIAGNY---TTTELSYEE-VLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWA 160
            K +Y  S        T  +L+ E        VN+P  +D R    VTP++ QG CGSCWA
Sbjct  58   KNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWA 117
Query  161  FSAVVTIEGI-IKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTY 219
            FS V   E   +  R  +L+  SEQEL+DC  + +GC+G      ++ + Q G+    +Y
Sbjct  118  FSGVAATESAYLAYRNTSLD-LSEQELVDCASQ-HGCHGDTIPRGIEYIQQNGVVEERSY 175
Query  220  PYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKD---FQL 276
            PY   ++ CR      Y        Q+ P +   +  ++     ++ +    KD   FQ 
Sbjct  176  PYVAREQQCRRPNSQHYGISN--YCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQH 233
Query  277  YRGGIFVG-PCGNKVD-HAVAAVGYGP----NYILIKNSWGTGWGENGYIRIKRG 325
            Y G   +    G + + HAV  VGYG     +Y +++NSW T WG++GY   + G
Sbjct  234  YDGRTIIQRDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAG 288

Sequence Alignment: 11. Allergen Name: Der f 1.0110 Sequence ID: ABL84751

 Score = 116.3 bits 439,  Expect = 2e-27
 Identities = 92/270 34%, Positives = 144/270 53%, Gaps = 25/270 9%
Query  45   IQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEF 104
            I+ FE +    NK Y  ++E+    + F ++LKY+ E NK        +N ++D+S DEF
Sbjct  23   IKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYV-EANKG------AINHLSDLSLDEF 75
Query  105  KEKYTGSIAGNY---TTTELSYEE-VLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWA 160
            K +Y  S        T  +L+ E        VN+P  +D R    VTP++ QG CGSCWA
Sbjct  76   KNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWA 135
Query  161  FSAVVTIEGI-IKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTY 219
            FS V   E   +  R  +L+  SEQEL+DC  + +GC+G      ++ + Q G+    +Y
Sbjct  136  FSGVAATESAYLAYRNTSLD-LSEQELVDCASQ-HGCHGDTIPRGIEYIQQNGVVEERSY 193
Query  220  PYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKD---FQL 276
            PY   ++ CR      Y        Q+ P +   +  ++     ++ +    KD   FQ 
Sbjct  194  PYVAREQQCRRPNSQHYGISN--YCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQH 251
Query  277  YRGGIFV-GPCGNKVD-HAVAAVGYGP----NYILIKNSWGTGWGENGYIRIKRG 325
            Y G   +    G + + HAV  VGYG     +Y +++NSW T WG++GY   + G
Sbjct  252  YDGRTIIRHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAG 306

Sequence Alignment: 12. Allergen Name: Der f 1.0101 Sequence ID: BAC53948

 Score = 116.3 bits 439,  Expect = 2e-27
 Identities = 92/270 34%, Positives = 144/270 53%, Gaps = 25/270 9%
Query  45   IQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEF 104
            I+ FE +    NK Y  ++E+    + F ++LKY+ E NK        +N ++D+S DEF
Sbjct  23   IKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYV-EANKG------AINHLSDLSLDEF 75
Query  105  KEKYTGSIAGNY---TTTELSYEE-VLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWA 160
            K +Y  S        T  +L+ E        VN+P  +D R    VTP++ QG CGSCWA
Sbjct  76   KNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWA 135
Query  161  FSAVVTIEGI-IKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTY 219
            FS V   E   +  R  +L+  SEQEL+DC  + +GC+G      ++ + Q G+    +Y
Sbjct  136  FSGVAATESAYLAYRNTSLD-LSEQELVDCASQ-HGCHGDTIPRGIEYIQQNGVVEERSY 193
Query  220  PYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKD---FQL 276
            PY   ++ CR      Y        Q+ P +   +  ++     ++ +    KD   FQ 
Sbjct  194  PYVAREQQCRRPNSQHYGISN--YCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQH 251
Query  277  YRGGIFVG-PCGNKVD-HAVAAVGYGP----NYILIKNSWGTGWGENGYIRIKRG 325
            Y G   +    G + + HAV  VGYG     +Y +++NSW T WG++GY   + G
Sbjct  252  YDGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAG 306

Sequence Alignment: 13. Allergen Name: Der f 1 Sequence ID: P16311

 Score = 116.3 bits 439,  Expect = 2e-27
 Identities = 92/270 34%, Positives = 144/270 53%, Gaps = 25/270 9%
Query  45   IQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEF 104
            I+ FE +    NK Y  ++E+    + F ++LKY+ E NK        +N ++D+S DEF
Sbjct  23   IKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYV-EANKG------AINHLSDLSLDEF 75
Query  105  KEKYTGSIAGNY---TTTELSYEE-VLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWA 160
            K +Y  S        T  +L+ E        VN+P  +D R    VTP++ QG CGSCWA
Sbjct  76   KNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWA 135
Query  161  FSAVVTIEGI-IKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTY 219
            FS V   E   +  R  +L+  SEQEL+DC  + +GC+G      ++ + Q G+    +Y
Sbjct  136  FSGVAATESAYLAYRNTSLD-LSEQELVDCASQ-HGCHGDTIPRGIEYIQQNGVVEERSY 193
Query  220  PYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKD---FQL 276
            PY   ++ CR      Y        Q+ P +   +  ++     ++ +    KD   FQ 
Sbjct  194  PYVAREQRCRRPNSQHYGISN--YCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQH 251
Query  277  YRGGIFVG-PCGNKVD-HAVAAVGYGP----NYILIKNSWGTGWGENGYIRIKRG 325
            Y G   +    G + + HAV  VGYG     +Y +++NSW T WG++GY   + G
Sbjct  252  YDGRTIIQHDNGYQPNYHAVNIVGYGSTQGDDYWIVRNSWDTTWGDSGYGYFQAG 306

Sequence Alignment: 14. Allergen Name: Blo t 1.0201 Sequence ID: AAQ24541

 Score = 116.2 bits 439,  Expect = 2e-27
 Identities = 106/292 36%, Positives = 166/292 56%, Gaps = 22/292 7%
Query  41   TERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMS 100
            T   I+ FE +     K+Y+N +E+  R   FK+ LK+++E N  +   +  +N ++DMS
Sbjct  21   TREEIKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWVEEHNGIDGVEY-AINEYSDMS 79
Query  101  NDEFKEKYTGS-IAGNYTTTELSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCW 159
              EF    +G  +   Y   E + E ++N    ++P+  DWRQK  +T ++ QGSCGSCW
Sbjct  80   EQEFSFHLSGGGLNFTYMKMEAAKEPLINTYG-SLPQNFDWRQKARLTRIRQQGSCGSCW 138
Query  160  AFSAVVTIEGIIKIRTGNLNEYSEQELLDC--DRR--SYGCNG---GYPWSALQLVAQYG 212
            AF+A    E +  I+     E SEQEL+DC  +R   SY CNG   GY   A++ + + G
Sbjct  139  AFAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDSSYQCNGCGSGYSTEAFKYMIRTG 198
Query  213  IHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQV--QPYNEGALLYSIANQ-PVSVVLEA 269
            +     YPY    ++C    +G       G +Q+  Q  +E  ++Y+I  + PV + +  
Sbjct  199  LVEEENYPYNMRTQWCNPDVEGQRY-HVSGYQQLRYQSSDED-VMYTIQQHGPVVIYMHG 256
Query  270  AGKDFQLYRGGIFVGPCGNKV--DHAVAAVGYGP----NYILIKNSWGTGWGENGYIRIK 323
            +   F+    G++ G   N    DHAV  VG+G     +Y +I+NSWGTGWG  GY  ++
Sbjct  257  SNNYFRNLGNGVLRGVAYNDAYTDHAVILVGWGTVQGVDYWIIRNSWGTGWGNGGYGYVE 316
Query  324  RGTGNSYGVCGLYT 337
            RG  NS G+  + T
Sbjct  317  RGH-NSLGINNFVT 329

Sequence Alignment: 15. Allergen Name: Der f 1.0103 Sequence ID: 2428875

 Score = 116.1 bits 438,  Expect = 2e-27
 Identities = 92/270 34%, Positives = 144/270 53%, Gaps = 25/270 9%
Query  45   IQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEF 104
            I+ FE +    NK Y  ++E+    + F ++LKY+ E NK        +N ++D+S DEF
Sbjct  5    IKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYV-EANKG------AINHLSDLSLDEF 57
Query  105  KEKYTGSIAGNY---TTTELSYEE-VLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWA 160
            K +Y  S        T  +L+ E        VN+P  +D R    VTP++ QG CGSCWA
Sbjct  58   KNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWA 117
Query  161  FSAVVTIEGI-IKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTY 219
            FS V   E   +  R  +L+  SEQEL+DC  + +GC+G      ++ + Q G+    +Y
Sbjct  118  FSGVAATESAYLAYRNTSLD-LSEQELVDCASQ-HGCHGDTIPRGIEYIQQNGVVEERSY 175
Query  220  PYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKD---FQL 276
            PY   ++ CR      Y        Q+ P +   +  ++     ++ +    KD   FQ 
Sbjct  176  PYVAREQQCRRPNSQHYGISN--YCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQH 233
Query  277  YRGGIFVG-PCGNKVD-HAVAAVGYGP----NYILIKNSWGTGWGENGYIRIKRG 325
            Y G   +    G + + HAV  VGYG     +Y +++NSW T WG++GY   + G
Sbjct  234  YGGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAG 288

Sequence Alignment: 16. Allergen Name: Der f 1.0105 Sequence ID: 2428875

 Score = 116.1 bits 438,  Expect = 2e-27
 Identities = 92/270 34%, Positives = 144/270 53%, Gaps = 25/270 9%
Query  45   IQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEF 104
            I+ FE +    NK Y  ++E+    + F ++LKY+ E NK        +N ++D+S DEF
Sbjct  5    IKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYV-EANKG------AINHLSDLSLDEF 57
Query  105  KEKYTGSIAGNY---TTTELSYEE-VLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWA 160
            K +Y  S        T  +L+ E        VN+P  +D R    VTP++ QG CGSCWA
Sbjct  58   KNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWA 117
Query  161  FSAVVTIEGI-IKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTY 219
            FS V   E   +  R  +L+  SEQEL+DC  + +GC+G      ++ + Q G+    +Y
Sbjct  118  FSGVAATESAYLAYRNTSLD-LSEQELVDCASQ-HGCHGDTIPRGIEYIQQNGVVEERSY 175
Query  220  PYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKD---FQL 276
            PY   ++ CR      Y        Q+ P +   +  ++     ++ +    KD   FQ 
Sbjct  176  PYVAREQQCRRPNSQHY--DISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQH 233
Query  277  YRGGIFVG-PCGNKVD-HAVAAVGYGP----NYILIKNSWGTGWGENGYIRIKRG 325
            Y G   +    G + + HAV  VGYG     +Y +++NSW T WG++GY   + G
Sbjct  234  YDGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAG 288

Sequence Alignment: 17. Allergen Name: Der f 1.0108 Sequence ID: ABL84749

 Score = 115.0 bits 434,  Expect = 4e-27
 Identities = 91/270 33%, Positives = 143/270 52%, Gaps = 25/270 9%
Query  45   IQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEF 104
            I+ FE +    NK Y  ++E+    + F ++LKY+ E NK        +N ++D+S DEF
Sbjct  23   IKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYV-EANKG------AINHLSDLSLDEF 75
Query  105  KEKYTGSIAGNY---TTTELSYEE-VLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWA 160
            K +Y  S        T  +L+ E        VN+P  +D R     TP++ QG CGSCWA
Sbjct  76   KNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTATPIRMQGGCGSCWA 135
Query  161  FSAVVTIEGI-IKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTY 219
            FS V   E   +  R  +L+  SEQEL+DC  + +GC+G      ++ + Q G+    +Y
Sbjct  136  FSGVAATESAYLAYRNTSLD-LSEQELVDCASQ-HGCHGDTIPRGIEYIQQNGVVEERSY 193
Query  220  PYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKD---FQL 276
            PY   ++ CR      Y        Q+ P +   +  ++     ++ +    KD   FQ 
Sbjct  194  PYVAREQQCRRPNSQHYGISN--YCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQH 251
Query  277  YRGGIFVG-PCGNKVD-HAVAAVGYGP----NYILIKNSWGTGWGENGYIRIKRG 325
            Y G   +    G + + HAV  VGYG     +Y +++NSW T WG++GY   + G
Sbjct  252  YDGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAG 306

Sequence Alignment: 18. Allergen Name: Der f 1.0109 Sequence ID: ABL84750

 Score = 115.0 bits 434,  Expect = 4e-27
 Identities = 91/270 33%, Positives = 144/270 53%, Gaps = 25/270 9%
Query  45   IQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEF 104
            I+ FE +    NK Y  ++E+    + F ++LKY+ E NK        +N ++D+S DEF
Sbjct  23   IKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYV-EANKG------AINHLSDLSLDEF 75
Query  105  KEKYTGSIAGNY---TTTELSYEE-VLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWA 160
            K +Y  S        T  +L+ E        VN+P  +D R    VTP++ QG CGSCWA
Sbjct  76   KNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWA 135
Query  161  FSAVVTIEGI-IKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTY 219
            FS V   E   +  R  +L+  SEQ+L+DC  + +GC+G      ++ + Q G+    +Y
Sbjct  136  FSGVAATESAYLAYRNTSLD-LSEQKLVDCASQ-HGCHGDTIPRGIEYIQQNGVVEERSY 193
Query  220  PYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKD---FQL 276
            PY   ++ CR      Y        Q+ P +   +  ++     ++ +    KD   FQ 
Sbjct  194  PYVAREQQCRRPNSQHYGISN--YCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQH 251
Query  277  YRGGIFVG-PCGNKVD-HAVAAVGYGP----NYILIKNSWGTGWGENGYIRIKRG 325
            Y G   +    G + + HAV  VGYG     +Y +++NSW T WG++GY   + G
Sbjct  252  YDGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAG 306

Sequence Alignment: 19. Allergen Name: Der f 1.0104 Sequence ID: 2428875

 Score = 112.8 bits 425,  Expect = 2e-26
 Identities = 90/270 33%, Positives = 144/270 53%, Gaps = 25/270 9%
Query  45   IQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEF 104
            I+ FE +    NK Y  ++E+    + F ++LKY+ E NK        +N ++D+S DEF
Sbjct  5    IKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYV-EANKG------AINHLSDLSLDEF 57
Query  105  KEKYTGSI-AGNYTTTELSYEEVLND---GDVNIPEYVDWRQKGAVTPVKNQGSCGSCWA 160
            K +Y  S  A     T++     ++      VN+P  +D R    VTP++ QG CGSCWA
Sbjct  58   KNRYLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWA 117
Query  161  FSAVVTIEGI-IKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTY 219
            FS V   E   +  R  +L+  SEQEL+DC  + +G +G      ++ + Q G+    +Y
Sbjct  118  FSGVAATESAYLAYRNTSLD-LSEQELVDCASQ-HGRHGDTIPRGIEYIQQNGVVEERSY 175
Query  220  PYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKD---FQL 276
            PY   ++ CR      Y        Q+ P +   +  ++     ++ +    KD   FQ 
Sbjct  176  PYVAREQQCRRPNSQHYGISN--YCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQH 233
Query  277  YRGGIFVG-PCGNKVD-HAVAAVGYGP----NYILIKNSWGTGWGENGYIRIKRG 325
            Y G   +    G + + HAV  VGYG     +Y +++NSW T WG++GY   + G
Sbjct  234  YDGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAG 288

Sequence Alignment: 20. Allergen Name: Eur m 1.0102 Sequence ID: AAC82352

 Score = 111.3 bits 419,  Expect = 6e-26
 Identities = 89/264 33%, Positives = 144/264 54%, Gaps = 25/264 9%
Query  45   IQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEF 104
            I+ FE +    NK Y   +++    + F ++LKY+ E+NK        +N ++D+S DEF
Sbjct  23   IKTFEEFKKAFNKSYATPEKEEVARKNFLESLKYV-ESNKG------AINHLSDLSLDEF 75
Query  105  KEKY---TGSIAGNYTTTELSYEEVLND-GDVNIPEYVDWRQKGAVTPVKNQGSCGSCWA 160
            K ++     +     T  +L+ E        V++P  +D R    VTP++NQG CGSCWA
Sbjct  76   KNQFLMNANAFEQLKTQFDLNAETYACSINSVSLPSELDLRSLRTVTPIRNQGGCGSCWA 135
Query  161  FSAVVTIEGI-IKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTY 219
            FS V + E   +  R  +L+  +EQEL+DC  ++ GC+G      ++ + Q G+   + Y
Sbjct  136  FSGVASTESAYLAYRNMSLD-LAEQELVDCASQN-GCHGDTIPRGIEYIQQNGVVQEHYY 193
Query  220  PYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKD---FQL 276
            PY   ++ C       Y  K     Q+ P +   +  ++     +V +    KD   F+ 
Sbjct  194  PYVAREQSCHRPNAQRYGLK--NYCQISPPDSNKIRQALTQTHTAVAVIIGIKDLNAFRH 251
Query  277  YRG-GIFVGPCGNKVD-HAVAAVGYGP----NYILIKNSWGTGWGENGY 319
            Y G  I     G + + HAV  VGYG     +Y +++NSW T WG+NGY
Sbjct  252  YDGRTIMQHDNGYQPNYHAVNIVGYGNTQGVDYWIVRNSWDTTWGDNGY 300

Sequence Alignment: 21. Allergen Name: Der p 1.0124 Sequence ID: CAQ68250

 Score = 110.6 bits 416,  Expect = 9e-26
 Identities = 91/260 35%, Positives = 146/260 56%, Gaps = 32/260 12%
Query  45   IQLFESWMLKHNKIYKNI-DEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDE 103
            I+ FE +    NK Y    DE+  R + F +++KY+    + N      +N ++D+S DE
Sbjct  5    IKTFEEYKKAFNKSYATFEDEEAAR-KNFLESVKYV----QSNGG---AINHLSDLSLDE 56
Query  104  FKEKYTGSI-AGNYTTTELSYEEVLNDGDVN--IPEYVDWRQKGAVTPVKNQGSCGSCWA 160
            FK ++  S  A  +  T++      N   +N   P  +D RQ   VTP++ QG CGSCWA
Sbjct  57   FKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWA 116
Query  161  FSAVVTIEGI-IKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTY 219
            FS V   E   +  R  +L+  +EQEL+DC  + +GCNG      ++ + + G+   + Y
Sbjct  117  FSGVAATESAYLAYRNQSLD-LAEQELVDCASQ-HGCNGDTIPRGIEYIQHNGVVQESYY 174
Query  220  PYEGVQRYCRSREKGPYAAKTDGVR---QVQPYNEGALLYSIANQPVSVVLEAAGKD--- 273
             Y   ++ CR     P A +  G+    Q+ P N   +  ++A    ++ +    KD   
Sbjct  175  RYVAREQSCRR----PNAQRF-GISNYCQIYPPNANKIREALAQTHSAIAVIIGIKDLDA 229
Query  274  FQLYRGGIFVG-PCGNKVD-HAVAAVGY----GPNYILIKNSWGTGWGENGY 319
            F+ Y G   +    G + + HAV  VGY    G +Y +++NSW T WG+NGY
Sbjct  230  FRHYDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGY 281

Sequence Alignment: 22. Allergen Name: Eur m 1.0101 Sequence ID: AAC82351

 Score = 109.5 bits 412,  Expect = 2e-25
 Identities = 88/264 33%, Positives = 143/264 54%, Gaps = 25/264 9%
Query  45   IQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEF 104
            I+ FE +    NK Y   +++    + F ++LKY+ E+NK        +N ++D+S DEF
Sbjct  23   IKTFEEFKKAFNKTYATPEKEEVARKNFLESLKYV-ESNKG------AINHLSDLSLDEF 75
Query  105  KEKY---TGSIAGNYTTTELSYEEVLND-GDVNIPEYVDWRQKGAVTPVKNQGSCGSCWA 160
            K ++     +     T  +L+ E        V++P  +D R    VTP++ QG CGSCWA
Sbjct  76   KNQFLMNANAFEQLKTQFDLNAETYACSINSVSLPSELDLRSLRTVTPIRMQGGCGSCWA 135
Query  161  FSAVVTIEGI-IKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTY 219
            FS V + E   +  R  +L+  +EQEL+DC  ++ GC+G      ++ + Q G+   + Y
Sbjct  136  FSGVASTESAYLAYRNMSLD-LAEQELVDCASQN-GCHGDTIPRGIEYIQQNGVVQEHYY 193
Query  220  PYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKD---FQL 276
            PY   ++ C       Y  K     Q+ P +   +  ++     +V +    KD   F+ 
Sbjct  194  PYVAREQSCHRPNAQRYGLK--NYCQISPPDSNKIRQALTQTHTAVAVIIGIKDLNAFRH 251
Query  277  YRG-GIFVGPCGNKVD-HAVAAVGYGP----NYILIKNSWGTGWGENGY 319
            Y G  I     G + + HAV  VGYG     +Y +++NSW T WG+NGY
Sbjct  252  YDGRTIMQHDNGYQPNYHAVNIVGYGNTQGVDYWIVRNSWDTTWGDNGY 300

Sequence Alignment: 23. Allergen Name: Eur m 1.0101 Sequence ID: P25780

 Score = 109.5 bits 412,  Expect = 2e-25
 Identities = 88/264 33%, Positives = 143/264 54%, Gaps = 25/264 9%
Query  45   IQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEF 104
            I+ FE +    NK Y   +++    + F ++LKY+ E+NK        +N ++D+S DEF
Sbjct  23   IKTFEEFKKAFNKTYATPEKEEVARKNFLESLKYV-ESNKG------AINHLSDLSLDEF 75
Query  105  KEKY---TGSIAGNYTTTELSYEEVLND-GDVNIPEYVDWRQKGAVTPVKNQGSCGSCWA 160
            K ++     +     T  +L+ E        V++P  +D R    VTP++ QG CGSCWA
Sbjct  76   KNQFLMNANAFEQLKTQFDLNAETYACSINSVSLPSELDLRSLRTVTPIRMQGGCGSCWA 135
Query  161  FSAVVTIEGI-IKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTY 219
            FS V + E   +  R  +L+  +EQEL+DC  ++ GC+G      ++ + Q G+   + Y
Sbjct  136  FSGVASTESAYLAYRNMSLD-LAEQELVDCASQN-GCHGDTIPRGIEYIQQNGVVQEHYY 193
Query  220  PYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKD---FQL 276
            PY   ++ C       Y  K     Q+ P +   +  ++     +V +    KD   F+ 
Sbjct  194  PYVAREQSCHRPNAQRYGLK--NYCQISPPDSNKIRQALTQTHTAVAVIIGIKDLNAFRH 251
Query  277  YRG-GIFVGPCGNKVD-HAVAAVGYGP----NYILIKNSWGTGWGENGY 319
            Y G  I     G + + HAV  VGYG     +Y +++NSW T WG+NGY
Sbjct  252  YDGRTIMQHDNGYQPNYHAVNIVGYGNTQGVDYWIVRNSWDTTWGDNGY 300

Sequence Alignment: 24. Allergen Name: Der p 1 Sequence ID: P08176

 Score = 108.5 bits 408,  Expect = 4e-25
 Identities = 90/260 34%, Positives = 146/260 56%, Gaps = 32/260 12%
Query  45   IQLFESWMLKHNKIYKNI-DEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDE 103
            I+ FE +    NK Y    DE+  R + F +++KY+    + N      +N ++D+S DE
Sbjct  23   IKTFEEYKKAFNKSYATFEDEEAAR-KNFLESVKYV----QSNGG---AINHLSDLSLDE 74
Query  104  FKEKYTGSI-AGNYTTTELSYEEVLNDGDVN--IPEYVDWRQKGAVTPVKNQGSCGSCWA 160
            FK ++  S  A  +  T++      N   +N   P  +D RQ   VTP++ QG CGSCWA
Sbjct  75   FKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWA 134
Query  161  FSAVVTIEGI-IKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTY 219
            FS V   E   +  R  +L+  +EQEL+DC  + +GC+G      ++ + + G+   + Y
Sbjct  135  FSGVAATESAYLAYRNQSLD-LAEQELVDCASQ-HGCHGDTIPRGIEYIQHNGVVQESYY 192
Query  220  PYEGVQRYCRSREKGPYAAKTDGVR---QVQPYNEGALLYSIANQPVSVVLEAAGKD--- 273
             Y   ++ CR     P A +  G+    Q+ P N   +  ++A    ++ +    KD   
Sbjct  193  RYVAREQSCRR----PNAQRF-GISNYCQIYPPNVNKIREALAQTHSAIAVIIGIKDLDA 247
Query  274  FQLYRGGIFVG-PCGNKVD-HAVAAVGY----GPNYILIKNSWGTGWGENGY 319
            F+ Y G   +    G + + HAV  VGY    G +Y +++NSW T WG+NGY
Sbjct  248  FRHYDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGY 299

Sequence Alignment: 25. Allergen Name: Der p 1.0113 Sequence ID: ABA39435

 Score = 108.3 bits 407,  Expect = 4e-25
 Identities = 90/260 34%, Positives = 146/260 56%, Gaps = 32/260 12%
Query  45   IQLFESWMLKHNKIYKNI-DEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDE 103
            I+ FE +    NK Y    DE+  R + F +++KY+    + N      +N ++D+S DE
Sbjct  5    IKPFEEYKKAFNKSYATFEDEEAAR-KNFLESVKYV----QSNGG---AINHLSDLSLDE 56
Query  104  FKEKYTGSI-AGNYTTTELSYEEVLNDGDVN--IPEYVDWRQKGAVTPVKNQGSCGSCWA 160
            FK ++  S  A  +  T++      N   +N   P  +D RQ   VTP++ QG CGSCWA
Sbjct  57   FKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWA 116
Query  161  FSAVVTIEGI-IKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTY 219
            FS V   E   +  R  +L+  +EQEL+DC  + +GC+G      ++ + + G+   + Y
Sbjct  117  FSGVAATESAYLAYRNQSLD-LAEQELVDCASQ-HGCHGDTIPRGIEYIQHNGVVQESYY 174
Query  220  PYEGVQRYCRSREKGPYAAKTDGVR---QVQPYNEGALLYSIANQPVSVVLEAAGKD--- 273
             Y   ++ CR     P A +  G+    Q+ P N   +  ++A    ++ +    KD   
Sbjct  175  RYVAREQSCRR----PNAQRF-GISNYCQIYPPNANKIREALAQTHSAIAVIIGIKDLDA 229
Query  274  FQLYRGGIFVG-PCGNKVD-HAVAAVGY----GPNYILIKNSWGTGWGENGY 319
            F+ Y G   +    G + + HAV  VGY    G +Y +++NSW T WG+NGY
Sbjct  230  FRHYDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGY 281

Sequence Alignment: 26. Allergen Name: Der f 1 Sequence ID: CAA46316

 Score = 98.2 bits 365,  Expect = 3e-22
 Identities = 66/190 34%, Positives = 102/190 53%, Gaps = 14/190 7%
Query  132  VNIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGI-IKIRTGNLNEYSEQELLDCD 190
            VN+P  +D R    VTP++ QG CGSCWAFS V   E   +  R  +L+  SEQEL+DC 
Sbjct  10   VNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLD-LSEQELVDCA 68
Query  191  RRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYN 250
             + +GC+G      ++ + Q G+    +YPY   ++ CR      Y        Q+ P +
Sbjct  69   SQ-HGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISN--YCQIYPPD 125
Query  251  EGALLYSIANQPVSVVLEAAGKD---FQLYRGGIFVG-PCGNKVD-HAVAAVGYGP---- 301
               +  ++     ++ +    KD   FQ Y G   +    G + + HAV  VGYG     
Sbjct  126  VKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGSTQGV 185
Query  302  NYILIKNSWGTGWGENGYIRIKRG 325
            +Y +++NSW T WG++GY   + G
Sbjct  186  DYWIVRNSWDTTWGDSGYGYFQAG 209

Sequence Alignment: 27. Allergen Name: Der p 1.0122 Sequence ID: 6771329

 Score = 94.9 bits 352,  Expect = 3e-21
 Identities = 66/181 36%, Positives = 102/181 56%, Gaps = 18/181 9%
Query  133  NIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGI-IKIRTGNLNEYSEQELLDCDR 191
            N P  +D RQ   VTP++ QG CGSCWAFS V   E   +  R  +L+  +EQEL+DC  
Sbjct  9    NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLD-LAEQELVDCAS 67
Query  192  RSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAK--TDGVRQVQPY 249
            + +GC+G      ++ + + G+   + Y Y   ++ CR     P A +  T    Q+ P 
Sbjct  68   Q-HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRR----PNAQRFGTSNYCQIYPP 122
Query  250  NEGALLYSIANQPVSVVLEAAGKD---FQLYRGGIFVG-PCGNKVD-HAVAAVGY----G 300
            N   +  ++A    ++ +    KD   F+ Y G   +    G + + HAV  VGY    G
Sbjct  123  NANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNAQG 182
Query  301  PNYILIKNSWGTGWGENGY 319
             +Y +++NSW T WG+NGY
Sbjct  183  VDYWIVRNSWDTNWGDNGY 201

Sequence Alignment: 28. Allergen Name: Eur m 1.0101 Sequence ID: CAA42677

 Score = 94.5 bits 350,  Expect = 4e-21
 Identities = 65/184 35%, Positives = 101/184 54%, Gaps = 14/184 7%
Query  132  VNIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGI-IKIRTGNLNEYSEQELLDCD 190
            V++P  +D R    VTP++ QG CGSCWAFS V + E   +  R  +L+  +EQEL+DC 
Sbjct  9    VSLPSELDLRSLRTVTPIRMQGGCGSCWAFSGVASTESAYLAYRNMSLD-LAEQELVDCA 67
Query  191  RRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYN 250
             ++ GC+G      ++ + Q G+   + YPY   ++ C       Y  K     Q+ P +
Sbjct  68   SQN-GCHGDTIPRGIEYIQQNGVVQEHYYPYVAREQSCHRPNAQRYGLKN--YCQISPPD 124
Query  251  EGALLYSIANQPVSVVLEAAGKD---FQLYRG-GIFVGPCGNKVD-HAVAAVGYGP---- 301
               +  ++     +V +    KD   F+ Y G  I     G + + HAV  VGYG     
Sbjct  125  SNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIMQHDNGYQPNYHAVNIVGYGNTQGV 184
Query  302  NYILIKNSWGTGWGENGY 319
            +Y +++NSW T WG+NGY
Sbjct  185  DYWIVRNSWDTTWGDNGY 202

Sequence Alignment: 29. Allergen Name: Der p 1.0123 Sequence ID: 6771329

 Score = 93.7 bits 347,  Expect = 8e-21
 Identities = 66/180 36%, Positives = 103/180 57%, Gaps = 20/180 11%
Query  133  NIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGI-IKIRTGNLNEYSEQELLDCDR 191
            N P  +D RQ   VTP++ QG CGSCWAFS V   E   +  R  +L+  +EQEL+DC  
Sbjct  9    NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLD-LAEQELVDCAS 67
Query  192  RSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVR---QVQP 248
            + +GC+G      ++ + + G+   + Y Y   ++ CR     P A +  G+    Q+ P
Sbjct  68   Q-HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRR----PNAQRF-GISNYCQIYP 121
Query  249  YNEGALLYSIANQPVSVVLEAAGKD---FQLYRGGIFVG-PCGNKVD-HAVAAVGY---- 299
             N   +  ++A    ++ +    KD   F+ Y G   +    G + + HAV  VGY    
Sbjct  122  PNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNAQ 181
Query  300  GPNYILIKNSWGTGWGENGY 319
            G +Y +++NSW T WG+NGY
Sbjct  182  GVDYWIVRNSWDTNWGDNGY 201

Sequence Alignment: 30. Allergen Name: Der p 1.0121 Sequence ID: 6771329

 Score = 93.7 bits 347,  Expect = 8e-21
 Identities = 66/180 36%, Positives = 104/180 57%, Gaps = 20/180 11%
Query  133  NIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGI-IKIRTGNLNEYSEQELLDCDR 191
            N P  +D RQ   VTP++ QG CGSCWAFS V   E   +  R+ +L+  +EQEL+DC  
Sbjct  9    NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLD-LAEQELVDCAS 67
Query  192  RSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVR---QVQP 248
            + +GC+G      ++ + + G+   + Y Y   ++ CR     P A +  G+    Q+ P
Sbjct  68   Q-HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRR----PNAQRF-GISNYCQIYP 121
Query  249  YNEGALLYSIANQPVSVVLEAAGKD---FQLYRGGIFVG-PCGNKVD-HAVAAVGY---- 299
             N   +  ++A    ++ +    KD   F+ Y G   +    G + + HAV  VGY    
Sbjct  122  PNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNAQ 181
Query  300  GPNYILIKNSWGTGWGENGY 319
            G +Y +++NSW T WG+NGY
Sbjct  182  GVDYWIVRNSWDTNWGDNGY 201

Sequence Alignment: 31. Allergen Name: Der p 1.0118 Sequence ID: 6771329

 Score = 93.4 bits 346,  Expect = 1e-20
 Identities = 66/180 36%, Positives = 103/180 57%, Gaps = 20/180 11%
Query  133  NIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGI-IKIRTGNLNEYSEQELLDCDR 191
            N P  +D RQ   VTP++ QG CGSCWAFS V   E   +  R  +L+  +EQEL+DC  
Sbjct  9    NAPAEIDLRQIRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLD-LAEQELVDCAS 67
Query  192  RSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVR---QVQP 248
            + +GC+G      ++ + + G+   + Y Y   ++ CR     P A +  G+    Q+ P
Sbjct  68   Q-HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRR----PNAQRF-GISNYCQIYP 121
Query  249  YNEGALLYSIANQPVSVVLEAAGKD---FQLYRGGIFVG-PCGNKVD-HAVAAVGY---- 299
             N   +  ++A    ++ +    KD   F+ Y G   +    G + + HAV  VGY    
Sbjct  122  PNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNAQ 181
Query  300  GPNYILIKNSWGTGWGENGY 319
            G +Y +++NSW T WG+NGY
Sbjct  182  GVDYWIVRNSWDTNWGDNGY 201

Sequence Alignment: 32. Allergen Name: Der p 1.0120 Sequence ID: 6771329

 Score = 93.4 bits 346,  Expect = 1e-20
 Identities = 66/180 36%, Positives = 103/180 57%, Gaps = 20/180 11%
Query  133  NIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGI-IKIRTGNLNEYSEQELLDCDR 191
            N P  +D RQ   VTP++ QG CGSCWAFS V   E   +  R  +L+  +EQEL+DC  
Sbjct  9    NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLD-LAEQELVDCAS 67
Query  192  RSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVR---QVQP 248
            + +GC+G      ++ + + G+   + Y Y   ++ CR     P A +  G+    Q+ P
Sbjct  68   Q-HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRR----PNAQRF-GISNYCQIYP 121
Query  249  YNEGALLYSIANQPVSVVLEAAGKD---FQLYRGGIFVG-PCGNKVD-HAVAAVGY---- 299
             N   +  ++A    ++ +    KD   F+ Y G   +    G + + HAV  VGY    
Sbjct  122  PNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIRRDNGYQPNYHAVNIVGYSNAQ 181
Query  300  GPNYILIKNSWGTGWGENGY 319
            G +Y +++NSW T WG+NGY
Sbjct  182  GVDYWIVRNSWDTNWGDNGY 201

Sequence Alignment: 33. Allergen Name: Der p 1.0114 Sequence ID: 6771329

 Score = 92.9 bits 344,  Expect = 1e-20
 Identities = 66/180 36%, Positives = 102/180 56%, Gaps = 20/180 11%
Query  133  NIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGI-IKIRTGNLNEYSEQELLDCDR 191
            N P  +D RQ   VTP++ QG CGSCWAFS V   E   +  R  +L+  +EQEL+DC  
Sbjct  9    NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLD-LAEQELVDCAS 67
Query  192  RSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVR---QVQP 248
            + +GC+G      +  + + G+   + Y Y   ++ CR     P A +  G+    Q+ P
Sbjct  68   Q-HGCHGDTIPRGIAYIQHNGVVQESYYRYVAREQSCRR----PNAQRF-GISNYCQIYP 121
Query  249  YNEGALLYSIANQPVSVVLEAAGKD---FQLYRGGIFVG-PCGNKVD-HAVAAVGY---- 299
             N   +  ++A    ++ +    KD   F+ Y G   +    G + + HAV  VGY    
Sbjct  122  PNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNAQ 181
Query  300  GPNYILIKNSWGTGWGENGY 319
            G +Y +++NSW T WG+NGY
Sbjct  182  GVDYWIVRNSWDTNWGDNGY 201

Sequence Alignment: 34. Allergen Name: Der p 1.0115 Sequence ID: 6771329

 Score = 92.9 bits 344,  Expect = 1e-20
 Identities = 63/183 34%, Positives = 99/183 54%, Gaps = 14/183 7%
Query  133  NIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGI-IKIRTGNLNEYSEQELLDCDR 191
            N P  +D RQ   VTP++ QG CGSCWAFS V   E   +  R  +L+  +EQEL+DC  
Sbjct  9    NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLD-LAEQELVDCAS 67
Query  192  RSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNE 251
            + +GC+G      ++ + + G+   + Y Y   ++ CR      +        Q+ P N 
Sbjct  68   Q-HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNTQRFGISN--YCQIYPPNA 124
Query  252  GALLYSIANQPVSVVLEAAGKD---FQLYRGGIFVG-PCGNKVD-HAVAAVGY----GPN 302
              +  ++A    ++ +    KD   F+ Y G   +    G + + HAV  VGY    G +
Sbjct  125  NKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVD 184
Query  303  YILIKNSWGTGWGENGY 319
            Y +++NSW T WG+NGY
Sbjct  185  YWIVRNSWDTNWGDNGY 201

Sequence Alignment: 35. Allergen Name: Der p 1.0117 Sequence ID: 6771329

 Score = 92.4 bits 342,  Expect = 2e-20
 Identities = 65/180 36%, Positives = 102/180 56%, Gaps = 20/180 11%
Query  133  NIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGI-IKIRTGNLNEYSEQELLDCDR 191
            N P  +D RQ   VTP++ QG CGSCWAFS V   E   +  R  +L+  +EQEL+DC  
Sbjct  9    NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLD-LAEQELVDCAS 67
Query  192  RSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVR---QVQP 248
            + +GC+G      ++ + + G+   + Y Y   ++ CR     P A +  G+    Q+ P
Sbjct  68   Q-HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRR----PNAQRF-GISNYCQIYP 121
Query  249  YNEGALLYSIANQPVSVVLEAAGKD---FQLYRGGIFVG-PCGNKVD-HAVAAVGY---- 299
             N   +  ++     ++ +    KD   F+ Y G   +    G + + HAV  VGY    
Sbjct  122  PNANKIREALTQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNAQ 181
Query  300  GPNYILIKNSWGTGWGENGY 319
            G +Y +++NSW T WG+NGY
Sbjct  182  GVDYWIVRNSWDTNWGDNGY 201

Sequence Alignment: 36. Allergen Name: Der p 1.0119 Sequence ID: 6771329

 Score = 92.2 bits 341,  Expect = 2e-20
 Identities = 66/180 36%, Positives = 102/180 56%, Gaps = 20/180 11%
Query  133  NIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGI-IKIRTGNLNEYSEQELLDCDR 191
            N P  +D RQ   VTP++ QG CGSCWAFS V   E   +  R  +L+  +EQEL+DC  
Sbjct  9    NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLD-LAEQELVDCAS 67
Query  192  RSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVR---QVQP 248
            + +GC+G      +  + + G+   + Y Y   ++ CR     P A +  G+    Q+ P
Sbjct  68   Q-HGCHGDTIPRGIGYIQHNGVVQESYYRYVAREQSCRR----PNAQRF-GISNYCQIYP 121
Query  249  YNEGALLYSIANQPVSVVLEAAGKD---FQLYRGGIFVG-PCGNKVD-HAVAAVGY---- 299
             N   +  ++A    ++ +    KD   F+ Y G   +    G + + HAV  VGY    
Sbjct  122  PNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNAQ 181
Query  300  GPNYILIKNSWGTGWGENGY 319
            G +Y +++NSW T WG+NGY
Sbjct  182  GVDYWIVRNSWDTNWGDNGY 201

Sequence Alignment: 37. Allergen Name: Der p 1.0116 Sequence ID: 6771329

 Score = 91.4 bits 338,  Expect = 4e-20
 Identities = 65/180 36%, Positives = 103/180 57%, Gaps = 20/180 11%
Query  133  NIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGI-IKIRTGNLNEYSEQELLDCDR 191
            N P  +D RQ   VTP++ QG CGSCWAFS V   E   +  R  +L+  +EQEL+DC  
Sbjct  9    NAPAEIDLRQLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLD-LAEQELVDCAS 67
Query  192  RSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVR---QVQP 248
            + +GC+G      ++ + + G+   + Y Y   ++ CR     P A +  G+    Q+ P
Sbjct  68   Q-HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRR----PNAQRF-GISNYCQIYP 121
Query  249  YNEGALLYSIANQPVSVVLEAAGKD---FQLYRGGIFVG-PCGNKVDH-AVAAVGY---- 299
             N   +  ++A    ++ +    KD   F+ Y G   +    G + ++ AV  VGY    
Sbjct  122  PNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYYAVNIVGYSNAQ 181
Query  300  GPNYILIKNSWGTGWGENGY 319
            G +Y +++NSW T WG+NGY
Sbjct  182  GVDYWIVRNSWDTNWGDNGY 201

Sequence Alignment: 38. Allergen Name: Tyr p 1.0101 Sequence ID: ABM53753

 Score = 86.4 bits 320,  Expect = 2e-18
 Identities = 97/290 33%, Positives = 150/290 51%, Gaps = 32/290 11%
Query  45   IQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEF 104
            +  +E + +K  K Y  I+E+ +R   + ++L  I + N KN    LGLN  +D S++EF
Sbjct  23   VPTWEQYKVKFGKNYLTINEENFRKNNYFNSLTKIVKNNGKNG-VTLGLNDMSDWSDEEF 81
Query  105  KEKYTGSIAGNYTTTELSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAV 164
                + S +  + +   +    +N      P+  DWR   A   ++ QG C SCWAF+A 
Sbjct  82   FSLNSKSPSSVFVSARPT--STVNTSP--FPKSWDWRNIIAFNSIEQQGRCSSCWAFAAA 137
Query  165  VTIEGIIKIRTGNLNEY-SEQELLDCDRRS-------YGCNGGYPWSALQLVAQYGIHYR 216
             T+E     +    N + S QEL+DC  R+       YGC GG+P  A + +  +G++  
Sbjct  138  TTVEAAYAHQKNKHNLHLSRQELVDCTNRTFDQHYLNYGCKGGWPTEAYKYIMDHGVYED 197
Query  217  NTYPY-EGVQRYCRS----REKG-P--YAAKTDGVRQVQPYNEGALLYSIANQPVSVVLE 268
              Y Y E     C +     +KG P  Y     G       +E  +   +   P +V + 
Sbjct  198  KLYHYTETFNEVCYADKVAHDKGHPVKYYISNYGRLAYNDTDEAIMAMLVTYGPGTVDIH 257
Query  269  AAGKDFQLYRGGIF--VGPCGNKVDHAVAAVGYGPN-----YILIKNSWGTGWGENGYIR 321
                 F++Y+GGI   V P     +H V  VGYG +     Y +I+NSWG  WGE+GY R
Sbjct  258  GTSDTFRFYKGGIMRNVMPNSAYTNHIVVVVGYGTDSSGVDYWIIRNSWGKTWGEHGYGR 317
Query  322  IKRGTGNSYGVCGLYTSSFYPV 343
            ++R   N  G    Y    YP+
Sbjct  318  LERHP-NLLGFNNKYN---YPI 335

Sequence Alignment: 39. Allergen Name: Blo t 1.0101 Sequence ID: AAK58415

 Score = 82.9 bits 304,  Expect = 1e-17
 Identities = 74/196 37%, Positives = 109/196 55%, Gaps = 19/196 9%
Query  134  IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRS 193
            IP   DWRQK  V P++NQG CGSCWAF+A    E +  I        SEQELLDC    
Sbjct  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
Query  194  Y-------GCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGP--YAAKTDGVR 244
            Y       GC  G    A++ + Q G+   + YPY+     C++  +G   + +  + +R
Sbjct  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSLR 120
Query  245  QVQPYNEGALLYSIANQ-PVSVVLEAAGKDFQLYRGGIFVGPCGN--KVDHAVAAVGYGP 301
                  E  +  +I N+ PV + +      F+  R GI+ G   N  ++DHAV  VG+G 
Sbjct  121  YRAGDQE--IQAAIMNHGPVVIYIHGTEAHFRNLRKGILRGAGYNDAQIDHAVVLVGWGT 178
Query  302  ----NYILIKNSWGTGWGENGYIRIKRGTGNSYGV 332
                +Y +++ SWGT WG+ GY  ++R   NS G+
Sbjct  179  QNGIDYWIVRTSWGTQWGDAGYGFVERHH-NSLGI 212

Sequence Alignment: 40. Allergen Name: Der p 1 Sequence ID: AAA28296

 Score = 59.3 bits 206,  Expect = 7e-11
 Identities = 29/65 44%, Positives = 38/65 58%, Gaps = 1/65 1%
Query  133  NIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRR 192
            N P  +D RQ   VTP++ QG CGSCWAFS V   E           + +EQEL+DC  +
Sbjct  27   NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAHRNQSLDLAEQELVDCASQ 86
Query  193  SYGCNG 198
             +GC+G
Sbjct  87   -HGCHG 91

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.