The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MANPKVFFDMTIGGQPVGRIVMELFADVVPRTSENFRALCTGEKGVGKSGKPLHYKGSAF
HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFF
ICTAKTEWLDGKHVVFGQVVEGFYVVKAIEQVGSGSGKTAKPVVVADCGQLS
Sequence Info Allergen Name Length Opt Bits Score E Value
AVV30163 Ole e 15.0101 172 1174 263.8 1.9e-72
A0A444XS96 Ara h 18.0101 226 1072 241.2 1.5e-65
Q8L5T1 Bet v 7 173 1062 239.3 4.5e-65
CAA59468 Cat r 1.0101 172 1049 236.5 3.2e-64
P21568 Sola l 5.0101 171 1036 233.6 2.2e-63
A1KXG2 Der f 29.0101 164 809 184.1 1.8e-48
ALM24136 Rhi o 2.0101 164 777 177.1 2.3e-46
CAA09884 Mala s 6 162 743 169.7 3.8e-44
AJ937743 Asp f 27.0101 163 742 169.4 4.5e-44
QAT18640 Der p 29.0101 247 723 164.9 1.6e-42
CAB44442 Asp f 11 178 620 142.7 5.4e-36
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ole e 15.0101 Sequence ID: AVV30163

 Score = 263.8 bits 1174,  Expect = 2e-72
 Identities = 172/172 100%, Positives = 172/172 100%, Gaps = 0/172 0%
Query  1    MANPKVFFDMTIGGQPVGRIVMELFADVVPRTSENFRALCTGEKGVGKSGKPLHYKGSAF 60
            MANPKVFFDMTIGGQPVGRIVMELFADVVPRTSENFRALCTGEKGVGKSGKPLHYKGSAF
Sbjct  1    MANPKVFFDMTIGGQPVGRIVMELFADVVPRTSENFRALCTGEKGVGKSGKPLHYKGSAF 60
Query  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFF 120
            HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFF 120
Query  121  ICTAKTEWLDGKHVVFGQVVEGFYVVKAIEQVGSGSGKTAKPVVVADCGQLS 172
            ICTAKTEWLDGKHVVFGQVVEGFYVVKAIEQVGSGSGKTAKPVVVADCGQLS
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGFYVVKAIEQVGSGSGKTAKPVVVADCGQLS 172

Sequence Alignment: 2. Allergen Name: Ara h 18.0101 Sequence ID: A0A444XS96

 Score = 241.2 bits 1072,  Expect = 2e-65
 Identities = 152/171 88%, Positives = 163/171 95%, Gaps = 0/171 0%
Query  1    MANPKVFFDMTIGGQPVGRIVMELFADVVPRTSENFRALCTGEKGVGKSGKPLHYKGSAF 60
            MANP+VFFDMTIGGQP GRI+MELFAD  PRT+ENFRALCTGEKGVG+SGKPLHYKGS+F
Sbjct  1    MANPRVFFDMTIGGQPAGRIIMELFADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSSF 60
Query  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFF 120
            HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENF+KKHTGPGILSMANAG  TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGQNTNGSQFF 120
Query  121  ICTAKTEWLDGKHVVFGQVVEGFYVVKAIEQVGSGSGKTAKPVVVADCGQL 171
            ICTAKTEWLDGKHVVFGQVVEG+ VV+ IE+VGS SG+T+KPVVVADCGQL
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGLDVVREIEKVGSSSGRTSKPVVVADCGQL 171

Sequence Alignment: 3. Allergen Name: Bet v 7 Sequence ID: Q8L5T1

 Score = 239.3 bits 1062,  Expect = 4e-65
 Identities = 150/171 87%, Positives = 163/171 95%, Gaps = 0/171 0%
Query  2    ANPKVFFDMTIGGQPVGRIVMELFADVVPRTSENFRALCTGEKGVGKSGKPLHYKGSAFH 61
            +NPKVFFDM +GGQPVGRIVMEL+AD  PRT+ENFRALCTGEKG G+SGKPLHYK S+FH
Sbjct  3    SNPKVFFDMEVGGQPVGRIVMELYADTTPRTAENFRALCTGEKGNGRSGKPLHYKKSSFH 62
Query  62   RVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFI 121
            RVIP FMCQGGDFTAGNGTGGESIYG+KFADENF+KKHTGPGILSMANAGPGTNGSQFFI
Sbjct  63   RVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPGTNGSQFFI 122
Query  122  CTAKTEWLDGKHVVFGQVVEGFYVVKAIEQVGSGSGKTAKPVVVADCGQLS 172
            CTAKTEWLDGKHVVFGQVVEG+ +VKAIE+VGS SG+T+KPVVVADCGQLS
Sbjct  123  CTAKTEWLDGKHVVFGQVVEGLDIVKAIEKVGSSSGRTSKPVVVADCGQLS 173

Sequence Alignment: 4. Allergen Name: Cat r 1.0101 Sequence ID: CAA59468

 Score = 236.5 bits 1049,  Expect = 3e-64
 Identities = 149/172 86%, Positives = 159/172 92%, Gaps = 0/172 0%
Query  1    MANPKVFFDMTIGGQPVGRIVMELFADVVPRTSENFRALCTGEKGVGKSGKPLHYKGSAF 60
            M NP+VFFDM++GGQP GRIVMELFAD  PRT+ENFRALCTGEKG G+SGKPLHYK S+F
Sbjct  1    MPNPRVFFDMSVGGQPAGRIVMELFADTTPRTAENFRALCTGEKGTGRSGKPLHYKDSSF 60
Query  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFF 120
            HRVIP FMCQGGDFTAGNGTGGESIYG+KFADENF+KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPNTNGSQFF 120
Query  121  ICTAKTEWLDGKHVVFGQVVEGFYVVKAIEQVGSGSGKTAKPVVVADCGQLS 172
            ICTAKTEWLDGKHVVFGQVVEG  VVKAIE+VGS SG+TAK VVV DCGQLS
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTAKKVVVEDCGQLS 172

Sequence Alignment: 5. Allergen Name: Sola l 5.0101 Sequence ID: P21568

 Score = 233.6 bits 1036,  Expect = 2e-63
 Identities = 146/171 85%, Positives = 156/171 91%, Gaps = 0/171 0%
Query  1    MANPKVFFDMTIGGQPVGRIVMELFADVVPRTSENFRALCTGEKGVGKSGKPLHYKGSAF 60
            MANPKVFFD+TIGG P GR+VMELFAD  P+T+ENFRALCTGEKGVGK GKPLHYKGS F
Sbjct  1    MANPKVFFDLTIGGAPAGRVVMELFADTTPKTAENFRALCTGEKGVGKMGKPLHYKGSTF 60
Query  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFF 120
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENFVKKHTGPGILSMANAGPGTNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFNDENFVKKHTGPGILSMANAGPGTNGSQFF 120
Query  121  ICTAKTEWLDGKHVVFGQVVEGFYVVKAIEQVGSGSGKTAKPVVVADCGQL 171
            ICTAKTEWL+GKHVVFGQVVEG  V+K  E VGS SG+ +KPVV+ADCGQL
Sbjct  121  ICTAKTEWLNGKHVVFGQVVEGMDVIKKAEAVGSSSGRCSKPVVIADCGQL 171

Sequence Alignment: 6. Allergen Name: Der f 29.0101 Sequence ID: A1KXG2

 Score = 184.1 bits 809,  Expect = 2e-48
 Identities = 118/164 71%, Positives = 137/164 83%, Gaps = 7/164 4%
Query  1    MANPKVFFDMTIGGQPVGRIVMELFADVVPRTSENFRALCTGEKGVGKSGKPLHYKGSAF 60
            MA P+VFFD+    QP+GRIV+EL +DVVP+T+ENFRALCTGEKG G       +K S+F
Sbjct  1    MALPRVFFDIAADNQPLGRIVIELRSDVVPKTAENFRALCTGEKGFG-------FKSSSF 53
Query  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFF 120
            HR+IPNFM QGGDFT  NGTGG+SIYG+KFADENF  +HTGPGI+SMANAGP TNGSQFF
Sbjct  54   HRIIPNFMIQGGDFTNHNGTGGKSIYGNKFADENFTLQHTGPGIMSMANAGPNTNGSQFF 113
Query  121  ICTAKTEWLDGKHVVFGQVVEGFYVVKAIEQVGSGSGKTAKPVVVADCGQL 171
            I T KT WLDGKHVVFG VVEG  +VK +E  GS SGK +K V +A+CGQL
Sbjct  114  ITTVKTTWLDGKHVVFGSVVEGMDIVKKVESYGSQSGKPSKKVTIANCGQL 164

Sequence Alignment: 7. Allergen Name: Rhi o 2.0101 Sequence ID: ALM24136

 Score = 177.1 bits 777,  Expect = 2e-46
 Identities = 115/164 70%, Positives = 133/164 81%, Gaps = 7/164 4%
Query  1    MANPKVFFDMTIGGQPVGRIVMELFADVVPRTSENFRALCTGEKGVGKSGKPLHYKGSAF 60
            M+NPKVFFD++   +P+GRIVMEL ADVVP+T+ENFRALCTGEKG G       YKG +F
Sbjct  1    MSNPKVFFDVSANSKPLGRIVMELRADVVPQTAENFRALCTGEKGFG-------YKGCSF 53
Query  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFF 120
            HRVIP FM QGGDFT  NGTGG+SIYG+KF DENF  KHTGPG LSMANAGP TNGSQFF
Sbjct  54   HRVIPEFMLQGGDFTNHNGTGGKSIYGNKFRDENFTLKHTGPGDLSMANAGPNTNGSQFF 113
Query  121  ICTAKTEWLDGKHVVFGQVVEGFYVVKAIEQVGSGSGKTAKPVVVADCGQL 171
            I T K  WLDGKHVVFG+V EG  VV+ IE +GS +G     +++ +CGQL
Sbjct  114  ITTIKCSWLDGKHVVFGRVTEGMDVVQNIESLGSPNGTPRAKIIIDNCGQL 164

Sequence Alignment: 8. Allergen Name: Mala s 6 Sequence ID: CAA09884

 Score = 169.7 bits 743,  Expect = 4e-44
 Identities = 114/160 71%, Positives = 129/160 80%, Gaps = 9/160 5%
Query  1    MANPKVFFDMTIGGQPVGRIVMELFADVVPRTSENFRALCTGEKGVGKSGKPLHYKGSAF 60
            M+N  VFFD+T  G P+G I  +LF DVVP+T+ NFRALCTGEKG G       Y GS F
Sbjct  1    MSN--VFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFG-------YAGSHF 51
Query  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFF 120
            HRVIP+FM QGGDFTAGNGTGG+SIYG+KFADENF  KH  PG+LSMANAGP TNGSQFF
Sbjct  52   HRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFF 111
Query  121  ICTAKTEWLDGKHVVFGQVVEGFYVVKAIEQVGSGSGKTAKPVVVADCG 169
            I T  T WLDGKHVVFG+V++G  VVKAIE  GSGSGK    + +A CG
Sbjct  112  ITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAEGSGSGKPRSRIEIAKCG 160

Sequence Alignment: 9. Allergen Name: Asp f 27.0101 Sequence ID: AJ937743

 Score = 169.4 bits 742,  Expect = 4e-44
 Identities = 110/160 68%, Positives = 124/160 77%, Gaps = 7/160 4%
Query  5    KVFFDMTIGGQPVGRIVMELFADVVPRTSENFRALCTGEKGVGKSGKPLHYKGSAFHRVI 64
            K FFD+TI GQP GRI  +LF +VVP+T ENFRALCTGEKG G       YKGS+FHR+I
Sbjct  4    KTFFDITIDGQPAGRITFKLFDEVVPKTVENFRALCTGEKGFG-------YKGSSFHRII 56
Query  65   PNFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFICTA 124
            P FM QGGDFT GNGTGG+SIYG +F DENF  KH  PG+LSMANAG  TNGSQFFI T 
Sbjct  57   PQFMLQGGDFTKGNGTGGKSIYGDRFPDENFQLKHDKPGLLSMANAGKNTNGSQFFITTV 116
Query  125  KTEWLDGKHVVFGQVVEGFYVVKAIEQVGSGSGKTAKPVVVADCGQL 171
             T WLDG HVVFG+V +G  +VK IE  GS SG   K + +ADCGQL
Sbjct  117  VTSWLDGAHVVFGEVEDGMDLVKKIESYGSASGTPKKKITIADCGQL 163

Sequence Alignment: 10. Allergen Name: Der p 29.0101 Sequence ID: QAT18640

 Score = 164.9 bits 723,  Expect = 2e-42
 Identities = 106/162 65%, Positives = 128/162 79%, Gaps = 7/162 4%
Query  3    NPKVFFDMTIGGQPVGRIVMELFADVVPRTSENFRALCTGEKGVGKSGKPLHYKGSAFHR 62
            NP+VFFD+ +  Q  GRIV+ L  DVVP+T+ENFR LCT EKG G       ++GS FHR
Sbjct  85   NPQVFFDIRVDNQYCGRIVILLRKDVVPKTTENFRCLCTHEKGFG-------FRGSIFHR 137
Query  63   VIPNFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFIC 122
            +IP FM QGGDFT  NGTGG+SIYG KF DENF  KHTG G LSMAN+GP TNGSQFFI 
Sbjct  138  IIPGFMIQGGDFTNHNGTGGKSIYGRKFEDENFQLKHTGAGTLSMANSGPNTNGSQFFIT 197
Query  123  TAKTEWLDGKHVVFGQVVEGFYVVKAIEQVGSGSGKTAKPVVVADCGQL 171
             ++TEWLDGKHVVFGQV++G  +V+ IE+ GS SGK  K V +A+CG++
Sbjct  198  ASRTEWLDGKHVVFGQVMQGMDIVRKIEECGSKSGKPNKRVKIANCGEF 246

Sequence Alignment: 11. Allergen Name: Asp f 11 Sequence ID: CAB44442

 Score = 142.7 bits 620,  Expect = 5e-36
 Identities = 104/162 64%, Positives = 121/162 74%, Gaps = 18/162 11%
Query  2    ANPKVFFDMT---IGGQP--VGRIVMELFADVVPRTSENFRALCTGEKGVGKSGKPLHYK 56
            A  +VFFD+    +G     VGRIV  LF   VP+T++NFR LC    G G       Y+
Sbjct  7    AMSQVFFDVEYAPVGTAETKVGRIVFNLFDKDVPKTAKNFRELCKRPAGEG-------YR 59
Query  57   GSAFHRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNG 116
             S FHR+IPNFM QGGDFT GNGTGG SIYG KFADENF +KH   GILSMANAGP TNG
Sbjct  60   ESTFHRIIPNFMIQGGDFTRGNGTGGRSIYGDKFADENFSRKHDKKGILSMANAGPNTNG 119
Query  117  SQFFICTAKTEWLDGKHVVFGQVVE--GFYVVKAIEQVGSGSGKT---AKPVVVADCGQL 171
            SQFFI TA T WLDGKHVVFG+V +   + VVK IE +GS SG      +P +V +CG+L
Sbjct  120  SQFFITTAVTSWLDGKHVVFGEVADEKSYSVVKEIEALGSSSGSVRSNTRPKIV-NCGEL 178

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.