The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MANPSLLSLSVCLLILFHGCLASRQQGQQQNECQIDQLDALEPDNRVEYEAGMVETWDPN
HEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAPQQGQ
QHGQSSRFQDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMY
PRKFNLAGNPEDEFQQQQQQQSRGRRQSQQKSCNNIFCGFDTKILAEVFQVEQSLVKQLQ
NEKDNRGAIVKVKGDLQVIRPPRRQSERGFESEEESEYERGRRGRDNGLEETICTMKLKE
NIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQNNALMVPHWNFNAHSIVY
GCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQRFEWISFKTNDRAMIS
PLAGSTSVLRAMPEEVLANAFQISREDARKIKFNNEQPTLSSGQSSQQMRDDA
Sequence Info Allergen Name Length Opt Bits Score E Value
EU410073 Pis v 5.0101 473 3195 734.6 2.7e-213
AAN76862 Ana o 2 457 2217 511.6 3.4e-146
DQ631676 Pis v 2.0101 496 1584 367.3 1e-102
P13744 Cuc ma 4.0101 480 1383 321.5 6e-89
QYS16039 Zan b 2.03 389 1292 300.8 8.2e-83
QYU76045 Zan b 2.0101 389 1252 291.7 4.6e-80
QYU76046 Zan b 2.0102 388 1240 289.0 3e-79
QYU76044 Zan b 2.02 383 1239 288.8 3.5e-79
AAO38859 Ber e 2 465 1082 252.9 2.6e-68
P04405 Gly m 6.0201 485 957 224.4 1e-59
CAA68460 Gly m glycinin G2 485 957 224.4 1e-59
ADN39440 Pru du 6.0101 551 952 223.3 2.6e-59
P09802 Gos h 3 509 950 222.8 3.3e-59
3EHK_A Pru du 6 531 950 222.8 3.5e-59
BAA21758 Fag e 1 565 950 222.8 3.7e-59
Q9XFM4 Fag e 1 538 949 222.6 4.1e-59
P04776 Gly m 6.0101 495 935 219.4 3.4e-58
AAA33966 Gly m glycinin G1 495 935 219.4 3.4e-58
Q2TLW0 Sin a 2.0101 510 932 218.7 5.7e-58
ABW86978 Car i 4.0101 505 919 215.7 4.4e-57
A0A1L6K371 Jug n 4.0101 510 915 214.8 8.4e-57
Q2TPW5 Jug r 4.0101 507 914 214.6 9.7e-57
BAA21760 Fag e 1 504 902 211.9 6.4e-56
AAL73404 Cor a 9 515 862 202.7 3.7e-53
P11828 Gly m 6.0301 481 803 189.3 3.8e-49
DQ631677 Pis v 2.0201 472 753 177.9 1e-45
Q9AUD2 Ses i 7.0101 497 749 177.0 2e-45
P09800 Gos h 4 516 722 170.8 1.5e-43
ADN39441 Pru du 6.0201 504 718 169.9 2.7e-43
O82580 Ara h 3 507 632 150.3 2.2e-37
AAC63045 Ara h 3 510 632 150.3 2.2e-37
Q9SB11 Gly m 6.0401 563 604 143.9 2.1e-35
Q9XHP0 Ses i 6.0101 459 584 139.4 3.8e-34
AAD47382 Ara h 4 530 584 139.4 4.5e-34
Q7GC77 Gly m 6.0501 517 562 134.4 1.4e-32
A0A0S3B0K0 Coc n 1.0101 490 222 56.9 2.9e-09
BAB21619 Gly m Bd28K 473 181 47.5 1.8e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pis v 5.0101 Sequence ID: EU410073

 Score = 734.6 bits 3195,  Expect = 3e-213
 Identities = 473/473 100%, Positives = 473/473 100%, Gaps = 0/473 0%
Query  1    MANPSLLSLSVCLLILFHGCLASRQQGQQQNECQIDQLDALEPDNRVEYEAGMVETWDPN 60
            MANPSLLSLSVCLLILFHGCLASRQQGQQQNECQIDQLDALEPDNRVEYEAGMVETWDPN
Sbjct  1    MANPSLLSLSVCLLILFHGCLASRQQGQQQNECQIDQLDALEPDNRVEYEAGMVETWDPN 60
Query  61   HEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAPQQGQ 120
            HEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAPQQGQ
Sbjct  61   HEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAPQQGQ 120
Query  121  QHGQSSRFQDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMY 180
            QHGQSSRFQDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMY
Sbjct  121  QHGQSSRFQDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMY 180
Query  181  PRKFNLAGNPEDEFQQQQQQQSRGRRQSQQKSCNNIFCGFDTKILAEVFQVEQSLVKQLQ 240
            PRKFNLAGNPEDEFQQQQQQQSRGRRQSQQKSCNNIFCGFDTKILAEVFQVEQSLVKQLQ
Sbjct  181  PRKFNLAGNPEDEFQQQQQQQSRGRRQSQQKSCNNIFCGFDTKILAEVFQVEQSLVKQLQ 240
Query  241  NEKDNRGAIVKVKGDLQVIRPPRRQSERGFESEEESEYERGRRGRDNGLEETICTMKLKE 300
            NEKDNRGAIVKVKGDLQVIRPPRRQSERGFESEEESEYERGRRGRDNGLEETICTMKLKE
Sbjct  241  NEKDNRGAIVKVKGDLQVIRPPRRQSERGFESEEESEYERGRRGRDNGLEETICTMKLKE 300
Query  301  NIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQNNALMVPHWNFNAHSIVY 360
            NIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQNNALMVPHWNFNAHSIVY
Sbjct  301  NIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQNNALMVPHWNFNAHSIVY 360
Query  361  GCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQRFEWISFKTNDRAMIS 420
            GCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQRFEWISFKTNDRAMIS
Sbjct  361  GCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQRFEWISFKTNDRAMIS 420
Query  421  PLAGSTSVLRAMPEEVLANAFQISREDARKIKFNNEQPTLSSGQSSQQMRDDA 473
            PLAGSTSVLRAMPEEVLANAFQISREDARKIKFNNEQPTLSSGQSSQQMRDDA
Sbjct  421  PLAGSTSVLRAMPEEVLANAFQISREDARKIKFNNEQPTLSSGQSSQQMRDDA 473

Sequence Alignment: 2. Allergen Name: Ana o 2 Sequence ID: AAN76862

 Score = 511.6 bits 2217,  Expect = 3e-146
 Identities = 368/455 80%, Positives = 418/455 91%, Gaps = 12/455 2%
Query  9    LSVCLLILFHGCLASRQQGQQQNECQIDQLDALEPDNRVEYEAGMVETWDPNHEQFRCAG 68
            LSVC+LILFHGCLASRQ+ QQQ+ECQID+LDALEPDNRVEYEAG VE WDPNHEQFRCAG
Sbjct  1    LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAG 60
Query  69   VAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAPQQGQQHGQSSRF 128
            VA+ RHTIQPNGL LP+YSNAP L+Y+V+GEGMTG   PGCPETYQAPQQG+Q+GQS RF
Sbjct  61   VALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQSGRF 120
Query  129  QDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMYPRKFNLAG 188
            QD+HQKI+RFR+GDIIA+PAGVA+WCYNEGNSPVVTVTLLDVSNSQNQLD  PRKF+LAG
Sbjct  121  QDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAG 180
Query  189  NPEDEFQQQQQQQSRGRRQSQQKSCNNIFCGFDTKILAEVFQVEQSLVKQLQNEKDNRGA 248
            NP+D FQQQQQ+QSRGR         N+F GFDT++LAE FQV++ L+KQL++E DNRG 
Sbjct  181  NPKDVFQQQQQHQSRGR---------NLFSGFDTELLAEAFQVDERLIKQLKSE-DNRGG 230
Query  249  IVKVKGD-LQVIRPPRRQSERGFESEEESEYERGRRG-RDNGLEETICTMKLKENIHDPS 306
            IVKVK D L+VIRP R QSERG ESEEESE E+ R G RDNG+EETICTM+LKENI+DP+
Sbjct  231  IVKVKDDELRVIRPSRSQSERGSESEEESEDEKRRWGQRDNGIEETICTMRLKENINDPA 290
Query  307  RSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQNNALMVPHWNFNAHSIVYGCKGNA 366
            R+DIYTPEVGR+T+LNSLNLPILKWLQLS E+GVL  NAL++PHWN+N+HSI+YGCKG  
Sbjct  291  RADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKG 350
Query  367  QVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQRFEWISFKTNDRAMISPLAGST 426
            QVQVVDNFGN VFDGEV EGQ++VVPQNFAVVKRAR +RFEWISFKTNDRAM SPLAG T
Sbjct  351  QVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRT 410
Query  427  SVLRAMPEEVLANAFQISREDARKIKFNNEQPTLSSGQSSQQMRDDA 473
            SVL  MPEEVLANAFQISREDARKIKFNN+Q TL+SG+SS++MRDDA
Sbjct  411  SVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA 457

Sequence Alignment: 3. Allergen Name: Pis v 2.0101 Sequence ID: DQ631676

 Score = 367.3 bits 1584,  Expect = 1e-102
 Identities = 253/459 55%, Positives = 340/459 74%, Gaps = 28/459 6%
Query  1    MANPSLLSLSVCLLILFHGCLAS---------RQQGQQ-QNECQIDQLDALEPDNRVEYE 50
            M   SLLS+S+ +L+LFH  +A          RQQ Q+ Q +CQI  L+ALEP  R+E E
Sbjct  1    MGYSSLLSFSLGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNALEPKRRIESE 60
Query  51   AGMVETWDPNHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCP 110
            AG+ E WD N EQ++CA VAV RHTIQ  GL +P Y NAP L+Y+V+G G+ G + PGCP
Sbjct  61   AGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVPSYDNAPELVYVVQGSGIHGAVFPGCP 120
Query  111  ETYQAPQQGQQHGQSSRFQ---DKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTL 167
            ET+Q  ++ Q   +S R Q   ++HQK++  ++GD+IALPAGVA+W YN G S +V V L
Sbjct  121  ETFQ--EESQSRSRSERSQQSGEQHQKVRPIQEGDVIALPAGVAHWIYNNGQSKLVLVAL 178
Query  168  LDVSNSQNQLDMYPRKFNLAGNPEDEFQQQQQQQSRGRRQS-----QQKSCNNIFCGFDT 222
             DV NS+NQLD Y RKF L G+P+ E Q   Q +SR + QS     Q +  NNI+  FD 
Sbjct  179  ADVGNSENQLDQYLRKFVLGGSPQQEIQGSGQSRSRSQSQSSRRGQQGQQSNNILSAFDE 238
Query  223  KILAEVFQVEQSLVKQLQNEKDNRGAIVKVKGDLQVIRPPRRQSERGFESEEESEYERGR 282
            +ILA+ F ++  L ++LQ EK  RG IV+V+ DL+V+ P R+      E E+E E ER R
Sbjct  239  EILAQSFNIDTQLARRLQKEKRQRGIIVRVQEDLEVLSPHRQ------EQEQEYEEERER 292
Query  283  RGRDNGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQ 342
            R R NGLEET CTM LK NI+DPSR+D+Y P  GR++S+N+LNLPIL++LQLSA++GVL+
Sbjct  293  RQR-NGLEETFCTMTLKYNINDPSRADVYNPRGGRVSSVNALNLPILRFLQLSAKKGVLH 351
Query  343  NNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRAR 402
             +A++ PHWN NAHSIVY  +GN ++Q+V   G +VFD E+ EGQ+ VVPQNFAVVKRA 
Sbjct  352  RDAILAPHWNVNAHSIVYITRGNGRIQIVSENGESVFDEEIREGQLVVVPQNFAVVKRAS 411
Query  403  GQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQISREDARKIKFNNEQPTL-S 461
              +FEW+SFKTN  +  S LAG  SV+RA+P +V+ N+F ISREDAR++K +  + T+ +
Sbjct  412  SDKFEWVSFKTNGLSQTSQLAGRVSVFRALPLDVIKNSFDISREDARRLKESRSETTIFA 471
Query  462  SGQSSQQ 468
             G SSQ+
Sbjct  472  PGSSSQR 478

Sequence Alignment: 4. Allergen Name: Cuc ma 4.0101 Sequence ID: P13744

 Score = 321.5 bits 1383,  Expect = 6e-89
 Identities = 215/464 46%, Positives = 320/464 68%, Gaps = 23/464 4%
Query  1    MANPSLLSLSVCLLILFHGCLASRQQGQ----------QQNE------CQIDQLDALEPD 44
            MA  SL+++ +CL ++ +GCL+  +Q            QQ+       C+++ L A +P 
Sbjct  1    MARSSLFTF-LCLAVFINGCLSQIEQQSPWEFQGSEVWQQHRYQSPRACRLENLRAQDPV 59
Query  45   NRVEYEAGMVETWDPNHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGT 104
             R E EA   E WD ++++F+CAGV + RHTI+P GL LP +SNAP L+++ +G G+ G 
Sbjct  60   RRAEAEAIFTEVWDQDNDEFQCAGVNMIRHTIRPKGLLLPGFSNAPKLIFVAQGFGIRGI 119
Query  105  LIPGCPETYQAPQQGQQHGQSSRFQDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVT 164
             IPGC ETYQ   +  Q   S+ F+D+HQKI+ FR+GD++ +PAGV++W YN G S +V 
Sbjct  120  AIPGCAETYQTDLRRSQSAGSA-FKDQHQKIRPFREGDLLVVPAGVSHWMYNRGQSDLVL 178
Query  165  VTLLDVSNSQNQLDMYPRKFNLAGNPEDEFQQQQQQQSRGRRQSQQKSCNNIFCGFDTKI 224
            + + D  N  NQ+D Y RKF LAG PE   +  ++ +   R+ S  +   NIF GF  + 
Sbjct  179  IVFADTRNVANQIDPYLRKFYLAGRPEQVERGVEEWERSSRKGSSGEKSGNIFSGFADEF 238
Query  225  LAEVFQVEQSLVKQLQNEKDNRGAIVKVKGDLQVIRPPRRQSERGFESEEESEYERGRRG 284
            L E FQ++  LV++L+ E D R  IV+V  D++V+ P + + ER      ESE E     
Sbjct  239  LEEAFQIDGGLVRKLKGEDDERDRIVQVDEDFEVLLPEKDEEERSRGRYIESESES---- 294
Query  285  RDNGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQNN 344
             +NGLEETICT++LK+NI    R+D++ P  GRI++ N   LPIL+ ++LSAERGVL +N
Sbjct  295  -ENGLEETICTLRLKQNIGRSVRADVFNPRGGRISTANYHTLPILRQVRLSAERGVLYSN 353
Query  345  ALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQ 404
            A++ PH+  N+HS++Y  +GNA+VQVVDNFG +VFDGEV EGQ++++PQNF V+KRA  +
Sbjct  354  AMVAPHYTVNSHSVMYATRGNARVQVVDNFGQSVFDGEVREGQVLMIPQNFVVIKRASDR 413
Query  405  RFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQISREDARKIKFNNEQPTLSSGQ 464
             FEWI+FKTND A+ + LAG  S +R +P  VL+N ++ISRE+A+++K+  ++  + S  
Sbjct  414  GFEWIAFKTNDNAITNLLAGRVSQMRMLPLGVLSNMYRISREEAQRLKYGQQEMRVLSPG 473
Query  465  SSQQMRD 471
             SQ  R+
Sbjct  474  RSQGRRE 480

Sequence Alignment: 5. Allergen Name: Zan b 2.03 Sequence ID: QYS16039

 Score = 300.8 bits 1292,  Expect = 8e-83
 Identities = 216/379 56%, Positives = 280/379 73%, Gaps = 21/379 5%
Query  50   EAGMVETWDPNHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGC 109
            EAG+ E WD N++Q++CA VAV RH IQ NGL +P Y+N P L Y+V+G G+ G +IPGC
Sbjct  1    EAGVTEFWDQNNQQLQCANVAVFRHRIQQNGLLVPAYTNTPELFYVVQGRGIHGAVIPGC 60
Query  110  PETYQAPQQGQQH----GQSSRFQDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTV 165
            PETYQ  QQ QQ      + SR QD+HQK+++ R+GDIIALP G A+W YN G S +V V
Sbjct  61   PETYQDEQQQQQSFSYPSEGSRSQDQHQKVRQIREGDIIALPTGSAHWIYNNGQSQLVLV 120
Query  166  TLLDVSNSQNQLDMYPRKFNLAGNPEDEFQQQQQQQSRGRRQSQ------QKSCNNIFCG 219
             L+DV NS NQLD Y RKF L GNP+ ++Q   Q Q  GR Q +       +   NIF G
Sbjct  121  ALVDVGNSDNQLDQYFRKFYLGGNPQPQLQGTSQSQG-GRYQERLGGGDSSRRSANIFNG 179
Query  220  FDTKILAEVFQVEQSLVKQLQNEKDNRGAIVKVKGDLQVIRPPRRQSERGFESEEESEYE 279
            FD ++LAE F V   L+++LQ  +  RG I++V+ +++V+ P     +RG ES E   Y 
Sbjct  180  FDERLLAEAFNVNPELIRRLQRPQMQRGIIIRVEEEFRVLTP-----QRGQESYESDPY- 233
Query  280  RGRRGRDNGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERG 339
                GR NG+EET+CTM+L+ NI+DPSR+D+Y P  GR+T++N LNLP+L+WLQLSAE+G
Sbjct  234  ----GRYNGVEETLCTMRLRHNINDPSRADVYNPRAGRVTTVNRLNLPVLRWLQLSAEKG 289
Query  340  VLQNNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVK 399
             L  NAL  PHWN+NAHSIVY  +GN +VQ+V   GN VFDGE+ EGQ+ VVPQ FAVVK
Sbjct  290  NLYKNALTAPHWNLNAHSIVYITRGNGRVQIVSENGNNVFDGEIREGQLIVVPQGFAVVK 349
Query  400  RARGQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLAN 439
            RA  + +EWISFKTND AM + LAG  SVLRA+P +V+ N
Sbjct  350  RASNRGLEWISFKTNDYAMTNQLAGRVSVLRALPLDVIQN 389

Sequence Alignment: 6. Allergen Name: Zan b 2.0101 Sequence ID: QYU76045

 Score = 291.7 bits 1252,  Expect = 5e-80
 Identities = 207/381 54%, Positives = 283/381 74%, Gaps = 17/381 4%
Query  50   EAGMVETWDPNHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGC 109
            EAG+ E WD N+EQ++CA VAV RH IQ  GL +P Y+N   L Y+V+G G+ G + PGC
Sbjct  1    EAGVTEFWDQNNEQLQCANVAVFRHRIQQRGLLVPSYTNTAELFYVVQGRGIHGAVFPGC 60
Query  110  PETYQAPQQGQQH-GQSSRFQDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLL 168
            PETYQ  QQ Q H  + SR QD+HQK++++R+GDI+A+P G A+W YN G S +V V L+
Sbjct  61   PETYQDQQQQQSHQSEGSRSQDQHQKVRQLREGDIVAVPTGSAHWIYNNGQSQLVLVALV 120
Query  169  DVSNSQNQLDMYPRKFNLAGNPEDEFQQQQQQQ-------SRGRRQSQQKSCNNIFCGFD 221
            DV NS NQLD Y RKF + GNP+ E+Q   Q Q       S+G   S++ S  NIF GFD
Sbjct  121  DVGNSDNQLDQYLRKFYIGGNPQQELQGYSQSQGSRSYQGSQGEGSSRRSSGGNIFNGFD 180
Query  222  TKILAEVFQVEQSLVKQLQNEKDNRGAIVKVKGDLQVIRPPRRQSERGFESEEESEYERG 281
             ++LA+ F V   ++++LQ  +  RG IV+V+ +L+V+RP     +RG E E+E E+   
Sbjct  181  ERLLADAFNVNPEIIRRLQKPQLPRGIIVRVEEELEVLRP-----QRGQEQEQEQEF--- 232
Query  282  RRGRDNGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVL 341
             RGRDNGLEET CT+KLK NI++PS +D+Y P  GRI+++NS+NLP+L+W+QLSAE+G L
Sbjct  233  -RGRDNGLEETYCTIKLKHNINNPSDADVYNPRGGRISTVNSFNLPVLRWIQLSAEKGNL 291
Query  342  QNNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRA 401
              NA + PHWN+N+HS+VY  +G+ +VQ+V   GN V+DG++ EGQ+ VVPQ +AV+KRA
Sbjct  292  YQNAQLAPHWNLNSHSVVYVTRGSGRVQIVSENGNNVYDGQIKEGQLIVVPQGYAVLKRA 351
Query  402  RGQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLAN 439
              Q +EWISFKTND A  S LAG  SV+RA+P +V+ N
Sbjct  352  SNQGLEWISFKTNDNAETSQLAGRNSVIRALPLDVIQN 389

Sequence Alignment: 7. Allergen Name: Zan b 2.0102 Sequence ID: QYU76046

 Score = 289.0 bits 1240,  Expect = 3e-79
 Identities = 206/380 54%, Positives = 283/380 74%, Gaps = 18/380 4%
Query  50   EAGMVETWDPNHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGC 109
            EAG+ E WD N+EQ++CA VAV RH IQ  GL +P Y+N   L Y+V+G G+ G + PGC
Sbjct  1    EAGVTEFWDQNNEQLQCANVAVFRHRIQQRGLLVPSYTNTAELFYVVQGRGIHGAVFPGC 60
Query  110  PETYQAPQQGQQH-GQSSRFQDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLL 168
            PETYQ  QQ Q H  + SR QD+HQK++++R+GDI+A+P G A+W YN G S +V V L+
Sbjct  61   PETYQDQQQQQSHQSEGSRSQDQHQKVRQLREGDIVAMPTGSAHWIYNNGQSQLVLVALV 120
Query  169  DVSNSQNQLDMYPRKFNLAGNPEDEFQQQQQQQ-------SRGRRQSQQKSCNNIFCGFD 221
            DV NS NQLD Y RKF + GNP+ E+Q   Q Q       S+G   S++ S  NIF GFD
Sbjct  121  DVGNSDNQLDQYLRKFYIGGNPQQELQGYSQSQGSRSYQGSQGEGGSRRSSGGNIFNGFD 180
Query  222  TKILAEVFQVEQSLVKQLQNEKDNRGAIVKVKGDLQVIRPPRRQSERGFESEEESEYERG 281
             ++LA+ F V   ++++LQ  +  RG IV+V+ +L+V+RP     +RG E E+E E+   
Sbjct  181  ERLLADAFNVNPEIIRRLQKPQLPRGIIVRVEEELEVLRP-----QRG-EQEQEQEF--- 231
Query  282  RRGRDNGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVL 341
             RGRDNGLEET CT+KLK NI++PS +D+Y P  GRI+++NS+NLP+L+W+QLSAE+G L
Sbjct  232  -RGRDNGLEETYCTIKLKHNINNPSDADVYNPRGGRISTVNSFNLPVLRWIQLSAEKGNL 290
Query  342  QNNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRA 401
              NA + PHWN+N+HS+VY  +G+ +VQ+V   GN V+DG++ EGQ+ VVPQ +AV+K+A
Sbjct  291  YQNAQLAPHWNLNSHSVVYVTRGSGRVQIVSENGNNVYDGQIKEGQLIVVPQGYAVLKKA 350
Query  402  RGQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLAN 439
              Q +EWISFKTND A  S LAG  SV+RA+P +V+ N
Sbjct  351  SNQGLEWISFKTNDNAETSQLAGRNSVIRALPLDVIQN 388

Sequence Alignment: 8. Allergen Name: Zan b 2.02 Sequence ID: QYU76044

 Score = 288.8 bits 1239,  Expect = 4e-79
 Identities = 204/377 54%, Positives = 273/377 72%, Gaps = 16/377 4%
Query  50   EAGMVETWDPNHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGC 109
            EAG+ E WD N+ Q++CA VAV RH IQ NGL +P Y+N   L Y+V+G G+ G + PGC
Sbjct  1    EAGVTEFWDQNNPQLQCANVAVFRHRIQKNGLLVPAYTNTAELFYVVQGRGIHGAVFPGC 60
Query  110  PETYQAPQQGQQH-GQSSRFQDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLL 168
            PETYQ  QQ Q +  Q SR QD+HQK+++ R+GDIIALP G A+W YN G S +V V L+
Sbjct  61   PETYQDQQQQQSYQSQGSRSQDQHQKVRQIREGDIIALPTGAAHWIYNNGGSQLVLVALV 120
Query  169  DVSNSQNQLDMYPRKFNLAGNPEDEFQQQQQQQSRGRRQSQQKSCN-----NIFCGFDTK 223
            DV NS NQLD Y RKF L GNP+ E+Q   Q+Q  G  Q  Q         N+F GFD +
Sbjct  121  DVGNSDNQLDQYFRKFYLGGNPQPELQGTSQRQQGGGYQGSQGGGGGSRRGNMFNGFDER 180
Query  224  ILAEVFQVEQSLVKQLQNEKDNRGAIVKVKGDLQVIRPPRRQSERGFESEEESEYERGRR 283
            +LA+ F V   L+++LQ  +  RG IV+V+ +++V+ P     +RG E E+E E +    
Sbjct  181  LLADAFNVNPELIRRLQRPQMQRGIIVRVEEEFRVLSP-----QRGQEQEQEQEQD---- 231
Query  284  GRDNGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQN 343
              DNG+EET CTMKL+ NI+DPSR+D+Y P  GR+T++N +NLP+L+WLQLSAE+G L  
Sbjct  232  -CDNGVEETFCTMKLRHNINDPSRADVYNPRGGRVTTVNRFNLPVLRWLQLSAEKGNLYQ 290
Query  344  NALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARG 403
            NAL  PHWN+N HSIVY  +G+ ++Q+V   GN VF+GE+ EGQ+ V+PQ FAVVK+A  
Sbjct  291  NALTSPHWNLNCHSIVYITRGSGRMQIVSENGNDVFNGEIREGQLIVIPQGFAVVKKASN 350
Query  404  QRFEWISFKTNDRAMISPLAGSTSVLRAMPEEV 436
            + +EWI+FKTND AM + LAG  SV+RA+P +V
Sbjct  351  RGLEWIAFKTNDNAMTNQLAGRVSVMRALPLDV 383

Sequence Alignment: 9. Allergen Name: Ber e 2 Sequence ID: AAO38859

 Score = 252.9 bits 1082,  Expect = 3e-68
 Identities = 231/459 50%, Positives = 319/459 69%, Gaps = 20/459 4%
Query  1    MANPSLLSLSVCLLILFHGCLASRQQGQQQNECQIDQLDALEPDNRVEYEAGMVETWDPN 60
            MA   LLSL + LL  FH CLA   + ++  EC+I +L A EP  R+E EAG+ E WD  
Sbjct  1    MAKLFLLSLGIFLL--FHCCLAIEYEQEELYECRIQRLTAQEPQYRLEAEAGVSEVWDYT 58
Query  61   HEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAPQQGQ 120
             +QFRCAGVA  R+TI+P GL LP Y+NAP L Y+ +G G+ G L+PGCPET+Q+  Q Q
Sbjct  59   DQQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETFQSMSQFQ 118
Query  121  ----QHGQSSRFQDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQ 176
                Q  +  RFQD+HQK++ ++KGDIIA+PAGVA WCYN+G+  +VTV +   ++  NQ
Sbjct  119  GSREQEEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQ 178
Query  177  LDMYPRKFNLAGNPEDEFQQQQQQQSRGRRQSQQKSCNNIFCGFDTKILAEV--FQVEQS 234
            LD  PR F LAGN +    Q+Q+ +  G R  QQ   +N+F GF+ + LA+V  F ++  
Sbjct  179  LDQNPRHFFLAGNIQR--SQKQRGERYGLRGGQQILADNVFKGFNMEALADVLGFGMDTE 236
Query  235  LVKQLQNEKDNRGAIVKVKGDLQVIRPPRRQSERGFESEEESEYERGRRGRDNGLEETIC 294
              ++++ E D RG IV+V+  L+VIRPPR +        EE E + G  G  NGLEETIC
Sbjct  237  TARKVRGEDDQRGHIVRVEQGLKVIRPPRIR--------EELEQQEG--GGYNGLEETIC 286
Query  295  TMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQNNALMVPHWNFN 354
            +  + +NI +P+ +D Y P  GR+T++NSL +PIL +LQLSA +GVL  NA+M P W +N
Sbjct  287  SATFIQNIDNPAEADFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENAMMAPLWRLN 346
Query  355  AHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQRFEWISFKTN 414
            A+S+VY  +G A+VQ+VD+ G TVFD  + EGQ+ VVPQNF VVK+A  + FEW+ F TN
Sbjct  347  ANSVVYAVRGEARVQIVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEWVVFNTN 406
Query  415  DRAMISPLAGSTSVLRAMPEEVLANAFQISREDARKIKFNNEQPTLSSGQSSQQMRDDA 473
            D A+ S  AG TS LR +P  VLANA+++S+E+AR+IK+N ++  L    S  + R  A
Sbjct  407  DNALFSTAAGRTSPLRGIPVGVLANAYRLSQEEARRIKLNRDEAVLFQPGSRSRGRASA 465

Sequence Alignment: 10. Allergen Name: Gly m 6.0201 Sequence ID: P04405

 Score = 224.4 bits 957,  Expect = 1e-59
 Identities = 237/459 51%, Positives = 330/459 71%, Gaps = 22/459 4%
Query  7    LSLSVCLLILFHGCLASRQQGQQQNECQIDQLDALEPDNRVEYEAGMVETWDPNHEQFRC 66
            L LS+C+L LF GC+A R+Q QQ NECQI +L+AL+PDNR+E E G +ETW+PN++ F+C
Sbjct  4    LVLSLCFL-LFSGCFALREQAQQ-NECQIQKLNALKPDNRIESEGGFIETWNPNNKPFQC 61
Query  67   AGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAPQQGQQHGQSS 126
            AGVA++R T+  N LR P Y+N P  +YI +G G+ G + PGCP TYQ PQ+ QQ G+S 
Sbjct  62   AGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNGIFGMIFPGCPSTYQEPQESQQRGRSQ 121
Query  127  RFQDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMYPRKFNL 186
            R QD+HQK++RFR+GD+IA+P GVA W YN  ++PVV V+++D ++ +NQLD  PR+F L
Sbjct  122  RPQDRHQKVHRFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYL 181
Query  187  AGNPEDEF---QQQQQ---QQSRGRRQSQQKSCNNIFCGFDTKILAEVFQVEQSLVKQLQ 240
            AGN E EF   QQQQQ   Q  +G++Q ++   +NI+ GF  + L E F V   +V+ LQ
Sbjct  182  AGNQEQEFLKYQQQQQGGSQSQKGKQQEEENEGSNILSGFAPEFLKEAFGVNMQIVRNLQ 241
Query  241  --NEKDNRGAIVKVKGDLQVIRPPRR--QSERGFESEEES----EYERG-----RRGRDN 287
              NE+++ GAIV VKG L+V  P  R  Q E   + EEE     E ++G     +R R N
Sbjct  242  GENEEEDSGAIVTVKGGLRVTAPAMRKPQQEEDDDDEEEQPQCVETDKGCQRQSKRSR-N 300
Query  288  GLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQNNALM 347
            G++ETICTM+L++NI   S  DIY P+ G IT+  SL++P L  L+LSA+ G L+ NA+ 
Sbjct  301  GIDETICTMRLRQNIGQNSSPDIYNPQAGSITTATSLDFPALWLLKLSAQYGSLRKNAMF 360
Query  348  VPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQRFE 407
            VPH+ +NA+SI+Y   G A VQVV+  G  VFDGE+ EG +++VPQNFAV  +++   FE
Sbjct  361  VPHYTLNANSIIYALNGRALVQVVNCNGERVFDGELQEGGVLIVPQNFAVAAKSQSDNFE 420
Query  408  WISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQISREDARKIKFNNEQPTLSSGQSSQ 467
            ++SFKTNDR  I  LAG+ S+L A+PEEV+ + F +  + AR++K NN    L   Q SQ
Sbjct  421  YVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNLKSQQARQVKNNNPFSFLVPPQESQ 480
Query  468  Q 468
            +
Sbjct  481  R 481

Sequence Alignment: 11. Allergen Name: Gly m glycinin G2 Sequence ID: CAA68460

 Score = 224.4 bits 957,  Expect = 1e-59
 Identities = 237/459 51%, Positives = 330/459 71%, Gaps = 22/459 4%
Query  7    LSLSVCLLILFHGCLASRQQGQQQNECQIDQLDALEPDNRVEYEAGMVETWDPNHEQFRC 66
            L LS+C+L LF GC+A R+Q QQ NECQI +L+AL+PDNR+E E G +ETW+PN++ F+C
Sbjct  4    LVLSLCFL-LFSGCFALREQAQQ-NECQIQKLNALKPDNRIESEGGFIETWNPNNKPFQC 61
Query  67   AGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAPQQGQQHGQSS 126
            AGVA++R T+  N LR P Y+N P  +YI +G G+ G + PGCP TYQ PQ+ QQ G+S 
Sbjct  62   AGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNGIFGMIFPGCPSTYQEPQESQQRGRSQ 121
Query  127  RFQDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMYPRKFNL 186
            R QD+HQK++RFR+GD+IA+P GVA W YN  ++PVV V+++D ++ +NQLD  PR+F L
Sbjct  122  RPQDRHQKVHRFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYL 181
Query  187  AGNPEDEF---QQQQQ---QQSRGRRQSQQKSCNNIFCGFDTKILAEVFQVEQSLVKQLQ 240
            AGN E EF   QQQQQ   Q  +G++Q ++   +NI+ GF  + L E F V   +V+ LQ
Sbjct  182  AGNQEQEFLKYQQQQQGGSQSQKGKQQEEENEGSNILSGFAPEFLKEAFGVNMQIVRNLQ 241
Query  241  --NEKDNRGAIVKVKGDLQVIRPPRR--QSERGFESEEES----EYERG-----RRGRDN 287
              NE+++ GAIV VKG L+V  P  R  Q E   + EEE     E ++G     +R R N
Sbjct  242  GENEEEDSGAIVTVKGGLRVTAPAMRKPQQEEDDDDEEEQPQCVETDKGCQRQSKRSR-N 300
Query  288  GLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQNNALM 347
            G++ETICTM+L++NI   S  DIY P+ G IT+  SL++P L  L+LSA+ G L+ NA+ 
Sbjct  301  GIDETICTMRLRQNIGQNSSPDIYNPQAGSITTATSLDFPALWLLKLSAQYGSLRKNAMF 360
Query  348  VPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQRFE 407
            VPH+ +NA+SI+Y   G A VQVV+  G  VFDGE+ EG +++VPQNFAV  +++   FE
Sbjct  361  VPHYTLNANSIIYALNGRALVQVVNCNGERVFDGELQEGGVLIVPQNFAVAAKSQSDNFE 420
Query  408  WISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQISREDARKIKFNNEQPTLSSGQSSQ 467
            ++SFKTNDR  I  LAG+ S+L A+PEEV+ + F +  + AR++K NN    L   Q SQ
Sbjct  421  YVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNLKSQQARQVKNNNPFSFLVPPQESQ 480
Query  468  Q 468
            +
Sbjct  481  R 481

Sequence Alignment: 12. Allergen Name: Pru du 6.0101 Sequence ID: ADN39440

 Score = 223.3 bits 952,  Expect = 3e-59
 Identities = 256/460 55%, Positives = 353/460 76%, Gaps = 84/460 18%
Query  9    LSVCLLILFHGCLASRQ-QGQQQNECQIDQLDALEPDNRVEYEAGMVETWDPNHEQFRCA 67
            +S+CLL++F+GCLA+RQ Q   QN+CQ++QL A EPDNR++ EAG +ETW+ N+E F+CA
Sbjct  7    FSLCLLLVFNGCLAARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQEDFQCA 66
Query  68   GVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETY----QAPQQG---- 119
            GVA +R TIQ NGL LP YSNAP L+YIV+G G+ G +  GCPET+    Q+ QQG    
Sbjct  67   GVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQE 126
Query  120  -------------------------------------------QQHGQSSRFQ------- 129
                                                       QQ+GQ  R Q       
Sbjct  127  QEQERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQ 186
Query  130  -DKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMYPRKFNLAG 188
             D+HQK +R R+GD++A+PAGVA W YN+G+  +V V L+ VS+ +NQLD  PRKF LAG
Sbjct  187  FDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAG 246
Query  189  NPEDEFQQQQQQQ-----------------SRGRRQSQQKSCNNIFCGFDTKILAEVFQV 231
            NPE+EF QQ Q Q                  R R+Q QQ S NN+F GF+T++LA+ + V
Sbjct  247  NPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGSGNNVFSGFNTQLLAQALNV 306
Query  232  EQSLVKQLQNEKDNRGAIVKVKGDLQVIRPPRRQSERGFE--SEEESEYERGRRGRD--- 286
             +   + LQ + DNR  I++V+G+L  ++PPR + ER  E   +E+ + ER ++G     
Sbjct  307  NEETARNLQGQNDNRNQIIRVRGNLDFVQPPRGRQEREHEERQQEQLQQERQQQGGQLMA 366
Query  287  NGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQNNAL 346
            NGLEET C+++LKENI +P R+DI++P  GRI++LNS NLPIL++L+LSAERG +  N +
Sbjct  367  NGLEETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGI 426
Query  347  MVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQRF 406
              PHWN NAHS+VY  +GNA+VQVV+  G+ ++D EV +GQ+F+VPQN  V+++A  Q F
Sbjct  427  YSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGF 486
Query  407  EWISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQISREDARKIKFNNEQPTLSSGQSS 466
            E+ +FKT + A I+ LAG TS LRA+P+EVLANA+QISRE AR++K+N  Q T++   SS
Sbjct  487  EYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYN-RQETIALS-SS 544
Query  467  QQMR 470
            QQ R
Sbjct  545  QQRR 548

Sequence Alignment: 13. Allergen Name: Gos h 3 Sequence ID: P09802

 Score = 222.8 bits 950,  Expect = 3e-59
 Identities = 258/466 55%, Positives = 349/466 74%, Gaps = 45/466 9%
Query  3    NPSLLSLSVCLLILFHGCLASRQ---QGQQQNECQIDQLDALEPDNRVEYEAGMVETWDP 59
            NPSLL LS  LL LF+GCLA RQ     Q QNECQI++L A  P  R+  EAG  E W+P
Sbjct  4    NPSLLFLS--LLFLFNGCLA-RQTFSSQQSQNECQINRLRASAPQTRIRSEAGTTEWWNP 60
Query  60   NHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAPQQG 119
            N +Q+RCAGV+V R+TI+PNGL LP ++NAP L+YIV+G G+ G ++PGC ET+Q  QQ 
Sbjct  61   NCQQLRCAGVSVMRQTIEPNGLVLPSFTNAPQLLYIVQGRGIQGIVMPGCAETFQDSQQ- 119
Query  120  QQHGQSSRFQDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDM 179
             QH    RFQD+HQK++RFR+GDIIALP GV +W YN+GN  VVT+ LLD  NS NQLD 
Sbjct  120  WQHQSRGRFQDQHQKVRRFRQGDIIALPQGVVHWSYNDGNERVVTINLLDTGNSANQLDN 179
Query  180  YPRKFNLAGNPEDEFQQ----QQQQQSRG-----------------------RRQSQQK- 211
             PR+F+LAGNPE+E +Q     QQ Q R                        RR  +Q+ 
Sbjct  180  IPRRFHLAGNPEEEQRQLRRLAQQMQGRSERGEESEEEEGEGEEEEEEDNPSRRSRHQEE 239
Query  212  --------SCNNIFCGFDTKILAEVFQVEQSLVKQLQNEKDNRGAIVKVKGDLQVIRPPR 263
                    SCNN++C FD   LA+ F V++ +++++Q  + NRG I++V+  LQV+ PPR
Sbjct  240  EEQGRESSSCNNLLCAFDRNFLAQAFNVDHDIIRKIQRVRGNRGTIIRVRDRLQVVTPPR 299
Query  264  RQSERGFESEEESEYERGRRG-RDNGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLN 322
             + E   E ++E  Y   R G +DNGLEET C+M++KEN+ DP R+DI+ P+ GRI++LN
Sbjct  300  MEEEEREERQQEQRYRHTRGGSQDNGLEETFCSMRIKENLADPERADIFNPQAGRISTLN 359
Query  323  SLNLPILKWLQLSAERGVLQNNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGE 382
             +NLPIL+ L+LSAERGVL N A ++P+WN NAH I+Y  +G A+VQVV++ G+ VFD  
Sbjct  360  RFNLPILQRLELSAERGVLYNRAGLIPQWNVNAHKILYMLRGCARVQVVNHNGDAVFDDN 419
Query  383  VSEGQIFVVPQNFAVVKRARGQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQ 442
            V +GQ++ VPQNFA +K+A  +  EWISF TN  A  +P+AGS S +RA+PEEV+A ++Q
Sbjct  420  VEQGQLLTVPQNFAFMKQAGNEGAEWISFFTNSEATNTPMAGSVSFMRALPEEVVAASYQ 479
Query  443  ISREDARKIKFNNEQPTLSSGQSSQQMRDDA 473
            +SREDAR+IKFNN+   + +   S++ R DA
Sbjct  480  VSREDARRIKFNNKNTFFFTPSQSER-RADA 509

Sequence Alignment: 14. Allergen Name: Pru du 6 Sequence ID: 3EHK_A

 Score = 222.8 bits 950,  Expect = 3e-59
 Identities = 244/447 54%, Positives = 337/447 75%, Gaps = 83/447 18%
Query  22   ASRQQGQQQNECQIDQLDALEPDNRVEYEAGMVETWDPNHEQFRCAGVAVARHTIQPNGL 81
            A + Q   QN+CQ++QL A EPDNR++ EAG +ETW+ N+  F+CAGVA +R TIQ NGL
Sbjct  1    ARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGL 60
Query  82   RLPEYSNAPTLMYIVEGEGMTGTLIPGCPETY----QAPQQG------------------ 119
             LP YSNAP L+YIV+G G+ G +  GCPET+    Q+ QQG                  
Sbjct  61   HLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQG 120
Query  120  -----------------------------QQHGQSSRFQ--------DKHQKIQRFRKGD 142
                                         QQ+GQ  R Q        D+HQK +R R+GD
Sbjct  121  RQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREGD 180
Query  143  IIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMYPRKFNLAGNPEDEFQQQQQQQ- 201
            ++A+PAGVA W YN+G+  +V V L+ VS+ +NQLD  PRKF LAGNPE+EF QQ Q Q 
Sbjct  181  VVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQSQP 240
Query  202  ----------------SRGRRQSQQKSCNNIFCGFDTKILAEVFQVEQSLVKQLQNEKDN 245
                             R R+Q QQ + NN+F GF+T++LA+ + V +   + LQ + DN
Sbjct  241  RQQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQALNVNEETARNLQGQNDN 300
Query  246  RGAIVKVKGDLQVIRPPRRQSERGFE--SEEESEYERGRRGRD---NGLEETICTMKLKE 300
            R  I++V+G+L  ++PPR + ER  E   +E+ + ER ++G     NGLEET C+++LKE
Sbjct  301  RNQIIQVRGNLDFVQPPRGRQEREHEERQQEQLQQERQQQGEQLMANGLEETFCSLRLKE 360
Query  301  NIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQNNALMVPHWNFNAHSIVY 360
            NI +P R+DI++P  GRI++LNS NLPIL++L+LSAERG +  N +  PHWN NAHS+VY
Sbjct  361  NIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVY 420
Query  361  GCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQRFEWISFKTNDRAMIS 420
              +GNA+VQVV+  G+ ++D EV +GQ+F+VPQN  V+++A  Q FE+ +FKT + A I+
Sbjct  421  VIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFIN 480
Query  421  PLAGSTSVLRAMPEEVLANAFQISREDARKIKFNNEQPTLSSGQSSQQMR 470
             LAG TS LRA+P+EVLANA+QISRE AR++K+N  Q T++   SSQQ R
Sbjct  481  TLAGRTSFLRALPDEVLANAYQISREQARQLKYN-RQETIALS-SSQQRR 528

Sequence Alignment: 15. Allergen Name: Fag e 1 Sequence ID: BAA21758

 Score = 222.8 bits 950,  Expect = 4e-59
 Identities = 212/450 47%, Positives = 312/450 69%, Gaps = 103/450 22%
Query  1    MANPSLLSLSVCLLILFHGCLA----------SR-QQGQQQ--NECQIDQLDALEPDNRV 47
            M+   +LS+S+CL++L   C A          SR ++G+QQ  ++C + +L A EP  RV
Sbjct  1    MSTKLILSFSLCLMVL--SCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLTASEPSRRV 58
Query  48   EYEAGMVETWDPNHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIP 107
              EAG+ E WD +  +FRCAG    R  IQP GL LP YSNAP + ++ +G G+ G ++P
Sbjct  59   RSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNAPYITFVEQGRGVQGVVVP 118
Query  108  GCPETYQA------PQ----------------QGQQ---HGQSSRFQ------------- 129
            GCPET+Q+      PQ                +G Q   + +S  F              
Sbjct  119  GCPETFQSESEFEYPQSQRDQRSRQSESEESSRGDQRTRQSESEEFSRGDQRTRQSESEE 178
Query  130  ----------------------------------DKHQKIQRFRKGDIIALPAGVANWCY 155
                                              D+HQKI R R GD+I  PAGV  W +
Sbjct  179  FSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTH 238
Query  156  NEGNSPVVTVTLLDVSNSQNQLDMYPRKFNLAGNP----EDEFQQQQQQQSRGRRQSQQK 211
            N+G++ ++++TL D ++ QNQLD   R F LAG      ED   Q+Q ++    RQS++ 
Sbjct  239  NDGDNDLISITLYDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRES 298
Query  212  SCN------NIFCGFDTKILAEVFQ-VEQSLVKQLQNEKDNRGAIVKVKGDLQVIRPPRR 264
              +      NI+ GF  +IL E+F+ V+Q  + +L+ + D RG IV+ + DL+ +R P  
Sbjct  299  DDDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFIVQAR-DLK-LRVPEE 356
Query  265  QSERGFESEEESEYERGRRGRDNGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSL 324
              E      E  + +RG  GR NGLE+  C +K+K+N++ PSR+D++ P  GRI ++NS 
Sbjct  357  YEEE--LQRERGDRKRGGSGRSNGLEQAFCNLKFKQNVNRPSRADVFNPRAGRINTVNSN 414
Query  325  NLPILKWLQLSAERGVLQNNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVS 384
            NLPIL+++QLSA+  VL  NA++ P WN+NAHS +Y  +G  +VQVV + G +VFD  V 
Sbjct  415  NLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQ 474
Query  385  EGQIFVVPQNFAVVKRARGQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQIS 444
             GQI+VVPQ FAVV +A  + +EW+ +K +D A+ SP+AG TSVLRA+P EVLAN++ IS
Sbjct  475  RGQILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDIS 534
Query  445  REDARKIKFNNEQ 457
             ++A ++K N  Q
Sbjct  535  TKEAFRLK-NGRQ 546

Sequence Alignment: 16. Allergen Name: Fag e 1 Sequence ID: Q9XFM4

 Score = 222.6 bits 949,  Expect = 4e-59
 Identities = 213/450 47%, Positives = 312/450 69%, Gaps = 73/450 16%
Query  1    MANPSLLSLSVCLLILFHGCLASR---QQGQQ----------QNECQIDQLDALEPDNRV 47
            M+   +LS+S+CL++L   C A     Q+GQ+          Q++C I +L A EP  RV
Sbjct  1    MSTKLILSFSLCLMVL--SCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLTASEPSRRV 58
Query  48   EYEAGMVETWDPNHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIP 107
              EAG+ E WD +  +FRCAG    R  IQP GL LP YSNAP + ++ +G G+ G ++P
Sbjct  59   RSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNAPYITFVEQGRGVQGVVVP 118
Query  108  GCPETYQA------P-----QQGQQH--GQSSR--------------------------- 127
            GCPET+Q+      P     Q+ +Q   G+SSR                           
Sbjct  119  GCPETFQSGSEFEYPRSQRDQRSRQSESGESSRGDQRSRQSESEESSRGDQRSRQSESEE 178
Query  128  FQ--DKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMYPRKFN 185
            F   D+HQKI R R GD+I  PAGV  W +N G++ ++++TL D ++ QNQLD   R F 
Sbjct  179  FSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFF 238
Query  186  LAGNP----EDEFQQQQQQQSRGRRQSQQKSCN------NIFCGFDTKILAEVFQ-VEQS 234
            LAG      ED   Q+Q ++    RQS++   +      NI+ GF+ +IL E+F+ V+Q 
Sbjct  239  LAGQSKQSREDRRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQE 298
Query  235  LVKQLQNEKDNRGAIVKVKGDLQVIRPPRRQSERGFESEEESEYERGRRGRDNGLEETIC 294
             + +L+ E D RG IV+ + DL+ +R P    E      E  + +RG  GR NGLE+  C
Sbjct  299  TISKLRGENDQRGFIVQAR-DLK-LRVPEEYEEE--LQRERGDRKRGGSGRSNGLEQAFC 354
Query  295  TMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQNNALMVPHWNFN 354
             +K+++N++ PSR+D++ P  GRI +++S NLPIL+++QLSA+  VL  NA++ P WN+N
Sbjct  355  NLKFRQNVNRPSRADVFNPRAGRINTVDSNNLPILEFIQLSAQHVVLYKNAILGPRWNLN 414
Query  355  AHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQRFEWISFKTN 414
            AHS +Y  +G  +VQVV + G +VFD  V  GQI+VVPQ FAVV +A  + +EW+ +K +
Sbjct  415  AHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKND 474
Query  415  DRAMISPLAGSTSVLRAMPEEVLANAFQISREDARKIKFNNEQ 457
            D A+ SP+AG TSVLRA+P EVLAN++ IS ++A ++K N  Q
Sbjct  475  DNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLK-NGRQ 516

Sequence Alignment: 17. Allergen Name: Gly m 6.0101 Sequence ID: P04776

 Score = 219.4 bits 935,  Expect = 3e-58
 Identities = 236/460 51%, Positives = 335/460 72%, Gaps = 30/460 6%
Query  7    LSLSVCLLILFHGC---LASRQQGQQQNECQIDQLDALEPDNRVEYEAGMVETWDPNHEQ 63
            L +S+C+L LF GC   ++SR+Q  QQNECQI +L+AL+PDNR+E E G++ETW+PN++ 
Sbjct  4    LVFSLCFL-LFSGCCFAFSSREQ-PQQNECQIQKLNALKPDNRIESEGGLIETWNPNNKP 61
Query  64   FRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAPQQGQQHG 123
            F+CAGVA++R T+  N LR P Y+N P  +YI +G+G+ G + PGCP T++ PQQ QQ G
Sbjct  62   FQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQRG 121
Query  124  QSSRFQDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMYPRK 183
            QSSR QD+HQKI  FR+GD+IA+P GVA W YN  ++PVV V+++D ++ +NQLD  PR+
Sbjct  122  QSSRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRR 181
Query  184  FNLAGNPEDEFQQQQQQQS-----RGRRQSQQKSCN-NIFCGFDTKILAEVFQVEQSLVK 237
            F LAGN E EF + QQ+Q      +G+ Q ++++   +I+ GF  + L   F V++ + K
Sbjct  182  FYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAK 241
Query  238  QLQ--NEKDNRGAIVKVKGDLQVIRPPR-RQSERGFESEEESEYERGR-RGRD------- 286
             LQ  NE +++GAIV VKG L VI+PP   Q +R  E EEE E E+ + +G+D       
Sbjct  242  NLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPR 301
Query  287  --------NGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAER 338
                    NG++ETICTM+L+ NI   S  DIY P+ G +T+  SL++P L WL+LSAE 
Sbjct  302  GSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEF 361
Query  339  GVLQNNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVV 398
            G L+ NA+ VPH+N+NA+SI+Y   G A +QVV+  G  VFDGE+ EG++++VPQNF V 
Sbjct  362  GSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVA 421
Query  399  KRARGQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQISREDARKIKFNNEQP 458
             R++   FE++SFKTND  MI  LAG+ S+L A+PEEV+ + F +  + AR+IK NN   
Sbjct  422  ARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFK 481
Query  459  TLSSGQSSQQ 468
             L   Q SQ+
Sbjct  482  FLVPPQESQK 491

Sequence Alignment: 18. Allergen Name: Gly m glycinin G1 Sequence ID: AAA33966

 Score = 219.4 bits 935,  Expect = 3e-58
 Identities = 236/460 51%, Positives = 335/460 72%, Gaps = 30/460 6%
Query  7    LSLSVCLLILFHGC---LASRQQGQQQNECQIDQLDALEPDNRVEYEAGMVETWDPNHEQ 63
            L +S+C+L LF GC   ++SR+Q  QQNECQI +L+AL+PDNR+E E G++ETW+PN++ 
Sbjct  4    LVFSLCFL-LFSGCCFAFSSREQ-PQQNECQIQKLNALKPDNRIESEGGLIETWNPNNKP 61
Query  64   FRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAPQQGQQHG 123
            F+CAGVA++R T+  N LR P Y+N P  +YI +G+G+ G + PGCP T++ PQQ QQ G
Sbjct  62   FQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQRG 121
Query  124  QSSRFQDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMYPRK 183
            QSSR QD+HQKI  FR+GD+IA+P GVA W YN  ++PVV V+++D ++ +NQLD  PR+
Sbjct  122  QSSRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRR 181
Query  184  FNLAGNPEDEFQQQQQQQS-----RGRRQSQQKSCN-NIFCGFDTKILAEVFQVEQSLVK 237
            F LAGN E EF + QQ+Q      +G+ Q ++++   +I+ GF  + L   F V++ + K
Sbjct  182  FYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAK 241
Query  238  QLQ--NEKDNRGAIVKVKGDLQVIRPPR-RQSERGFESEEESEYERGR-RGRD------- 286
             LQ  NE +++GAIV VKG L VI+PP   Q +R  E EEE E E+ + +G+D       
Sbjct  242  NLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPR 301
Query  287  --------NGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAER 338
                    NG++ETICTM+L+ NI   S  DIY P+ G +T+  SL++P L WL+LSAE 
Sbjct  302  GSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEF 361
Query  339  GVLQNNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVV 398
            G L+ NA+ VPH+N+NA+SI+Y   G A +QVV+  G  VFDGE+ EG++++VPQNF V 
Sbjct  362  GSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVA 421
Query  399  KRARGQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQISREDARKIKFNNEQP 458
             R++   FE++SFKTND  MI  LAG+ S+L A+PEEV+ + F +  + AR+IK NN   
Sbjct  422  ARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFK 481
Query  459  TLSSGQSSQQ 468
             L   Q SQ+
Sbjct  482  FLVPPQESQK 491

Sequence Alignment: 19. Allergen Name: Sin a 2.0101 Sequence ID: Q2TLW0

 Score = 218.7 bits 932,  Expect = 6e-58
 Identities = 233/447 52%, Positives = 332/447 74%, Gaps = 63/447 14%
Query  6    LLSLSVCLLILFHGCLASRQQG---QQQNECQIDQLDALEPDNRVEYEAGMVETWDPNHE 62
            LL  +V +L++++GCLA +  G   Q ++ C +D LD L+P   ++ EAG VE WD NH 
Sbjct  7    LLVATVGVLLVLNGCLARQSLGVPPQVKDACNLDNLDVLQPTEVIKSEAGQVEYWDHNHP 66
Query  63   QFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQ--AP---Q 117
            Q RCAGV++AR  IQ  GL LP + ++P + Y+V+G G++G +IPGC ET+    P   Q
Sbjct  67   QIRCAGVSIARLVIQKGGLYLPTFFSSPFISYVVQGMGISGRVIPGCAETFMDSQPMQGQ 126
Query  118  QGQQHGQSSR-------------------------------------FQDKHQKIQRFRK 140
            QGQQ+GQ  +                                     F+D HQK++  R 
Sbjct  127  QGQQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQGFRDMHQKVEHVRH 186
Query  141  GDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMYPRKFNLAGNPEDEFQQQQQQ 200
            GD IA+  G A W YN G+ P++ V+L+D++N QNQLD  PR F LAGN +    QQQQQ
Sbjct  187  GDAIAMTPGSAQWIYNTGDQPLIIVSLIDIANYQNQLDRNPRTFRLAGNNQQGSSQQQQQ 246
Query  201  QSRGRRQSQQKSCNNIFCGFDTKILAEVFQVEQSLVKQLQNEKDNRGAIVKVKGDLQVIR 260
            Q       QQ    NI+ GFD ++LA+ ++++  L ++LQN++D RG IV+VKG +QV+R
Sbjct  247  Q-------QQ----NILSGFDPQVLAQALKIDVRLAQELQNQQDKRGNIVRVKGPFQVVR 295
Query  261  PPRRQSERGFESEEESEYERG--RRGRDNGLEETICTMKLKENIHDPSRSDIYTPEVGRI 318
            PP RQ+   +ESE+   + RG  +  +DNGLEETIC+M+  ENI DP+R+DIY P +GR+
Sbjct  296  PPLRQA---YESEQW-RHPRGPPQSPQDNGLEETICSMRTHENIDDPARADIYKPNLGRV 351
Query  319  TSLNSLNLPILKWLQLSAERGVLQNNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTV 378
            TS+NS  LPIL++++LSA RG+LQ +A+++P +N NA+ I+Y  +G A++QVV++ G  V
Sbjct  352  TSVNSYTLPILQYIRLSATRGILQGSAMVLPKYNMNANEILYCTQGQARIQVVNDNGQNV 411
Query  379  FDGEVSEGQIFVVPQNFAVVKRARGQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLA 438
            +D +V +GQ+ V+PQ FA V +++   FEWISFKTN  AMIS LAG TS LRA+P EV+ 
Sbjct  412  LDQQVQKGQLVVIPQGFAYVVQSQNN-FEWISFKTNANAMISTLAGRTSALRALPLEVIT 470
Query  439  NAFQISREDARKIKFNNEQPTLSSGQSSQQ 468
            NA+QIS E+ARKIKFN  + TL+  +  QQ
Sbjct  471  NAYQISLEEARKIKFNTLETTLTRARGGQQ 500

Sequence Alignment: 20. Allergen Name: Car i 4.0101 Sequence ID: ABW86978

 Score = 215.7 bits 919,  Expect = 4e-57
 Identities = 297/469 63%, Positives = 377/469 80%, Gaps = 33/469 7%
Query  1    MANPSLLSLSVCLLI--LFHGCLASRQQGQQQN---ECQIDQLDALEPDNRVEYEAGMVE 55
            MA P LLS+ +CL+I  LF+GCLA +  G+QQ+   +CQ+++LDALEP NR+E EAG++E
Sbjct  1    MAKPILLSIYLCLIIVALFNGCLA-QSGGRQQHKFGQCQLNRLDALEPTNRIEAEAGVIE 59
Query  56   TWDPNHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQA 115
            +WDPNH+Q++CAGVAV R TI+PNGL LP YSNAP L+YI  G G+TG L PGCPET++ 
Sbjct  60   SWDPNHQQLQCAGVAVVRRTIEPNGLLLPHYSNAPQLVYIARGRGITGVLFPGCPETFEE 119
Query  116  PQQGQQHGQSSRFQ-DKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQ 174
             Q+  Q+GQ   FQ D+HQKI+ FR+GDIIA+PAGVA+WCYN+G+SPVV + LLD  N+ 
Sbjct  120  SQRQSQQGQRREFQQDRHQKIRHFREGDIIAFPAGVAHWCYNDGSSPVVAIFLLDTHNNA 179
Query  175  NQLDMYPRKFNLAGNPEDEFQ------------QQQQQQSRGRRQSQQKSC-NNIFCGFD 221
            NQLD  PR F LAGNP+DEF+            QQQ+QQ RG    QQ+   NN+F GFD
Sbjct  180  NQLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQHQQRRGEHGEQQRDLGNNVFSGFD 239
Query  222  TKILAEVFQVEQSLVKQLQNEKDNRGAIVKVKG-DLQVIRP--------PRRQSERGFES 272
             + LA+ F V+    ++LQ+E D+RG+IV+V+G  LQVIRP           + ER  E 
Sbjct  240  AEFLADAFNVDTETARRLQSENDHRGSIVRVEGRQLQVIRPRWSREEQEHEERKERERER 299
Query  273  EEESEYERGRRG--RDNGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILK 330
            E ESE  + RRG   DNGLEETICT+ L+ENI DPSR+DIYT E GRI+++NS NLPIL+
Sbjct  300  ESESERRQSRRGGRDDNGLEETICTLSLRENIGDPSRADIYTEEAGRISTVNSHNLPILR 359
Query  331  WLQLSAERGVLQNNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFV 390
            WLQLSAERG L ++AL VPHWN+NAHS+VY  +G A+VQVVDNFG TVFD E+ EGQ++ 
Sbjct  360  WLQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDELREGQLLT 419
Query  391  VPQNFAVVKRARGQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQISREDARK 450
            +PQNFAVVKRAR + FEW+SFKTN+ AM+SPLAG TS +RA+PEEVL NAFQI REDAR+
Sbjct  420  IPQNFAVVKRARDEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLVNAFQIPREDARR 479
Query  451  IKFNNEQPTL--SSGQSSQQMR 470
            +KFN ++ TL  S  +SS+  R
Sbjct  480  LKFNRQESTLVRSRSRSSRSER 501

Sequence Alignment: 21. Allergen Name: Jug n 4.0101 Sequence ID: A0A1L6K371

 Score = 214.8 bits 915,  Expect = 8e-57
 Identities = 296/469 63%, Positives = 379/469 80%, Gaps = 38/469 8%
Query  1    MANPSLLSLSVCLLILFHGCLASRQQGQQQ---NECQIDQLDALEPDNRVEYEAGMVETW 57
            MA P LLS+S+CL+ L +GCLA +  G+QQ    EC++ +L ALEP NR+E EAG++E+W
Sbjct  1    MAKPILLSISLCLVALVNGCLA-QSGGRQQPRFGECKLKRLVALEPSNRIEAEAGVIESW 59
Query  58   DPNHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAPQ 117
            DPN++QF+CAGVAV R TI+PNGL LP+YSNAP L+YIV+G G+TG L PGCPET++  Q
Sbjct  60   DPNNQQFQCAGVAVVRRTIEPNGLLLPQYSNAPQLLYIVKGRGITGVLFPGCPETFEESQ 119
Query  118  QGQQHGQ----SSRFQ-DKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSN 172
            QGQ   +    S+ FQ D+HQKI+ FR+GD+IA+PAGVA+WCYN+G++PVV V L+D +N
Sbjct  120  QGQSRIRPSLRSASFQRDRHQKIRHFREGDVIAFPAGVAHWCYNDGDTPVVAVALMDTTN 179
Query  173  SQNQLDMYPRKFNLAGNPEDEFQ------------QQQQQQSRGRRQSQQK-SCNNIFCG 219
            + NQLD  PR F LAGNP+DEF+            QQQ+QQ  G    QQ+ S NN+F G
Sbjct  180  NANQLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQHQQRHGEPGQQQRGSGNNVFSG 239
Query  220  FDTKILAEVFQVEQSLVKQLQNEKDNRGAIVKVKG-DLQVIRP--PRRQSERGF----ES 272
            FD   LA+ F V+    ++LQ+E D+R +IV+V+G  LQVIRP   R + ER      E 
Sbjct  240  FDADFLADAFNVDTETARRLQSENDHRRSIVRVEGRQLQVIRPRWSREEQEREERKERER 299
Query  273  EEESEYER--GRRG--RDNGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPI 328
            E ESE ER   RRG   DNGLEETICT++L+ENI DPSR+DIYT E GRI++ NS  LP+
Sbjct  300  ERESESERRQSRRGGRDDNGLEETICTLRLRENIGDPSRADIYTEEAGRISTANSHTLPV 359
Query  329  LKWLQLSAERGVLQNNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQI 388
            L+WLQLSAERG L ++AL VPHWN+NAHS+VY  +G A+VQVVDNFG TVFD E+ EGQ+
Sbjct  360  LRWLQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDELREGQL 419
Query  389  FVVPQNFAVVKRARGQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQISREDA 448
            + +PQNFAVVKRAR + FEW+SFKTN+ AM+SPLAG TS +RA+PEEVLANA+QI REDA
Sbjct  420  LTIPQNFAVVKRARNEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLANALQIPREDA 479
Query  449  RKIKFNNEQPTL-----SSGQSSQQMR 470
            R++KFN ++ TL     SS +SS+  R
Sbjct  480  RRLKFNRQESTLVRSRPSSSRSSRSER 506

Sequence Alignment: 22. Allergen Name: Jug r 4.0101 Sequence ID: Q2TPW5

 Score = 214.6 bits 914,  Expect = 1e-56
 Identities = 292/466 62%, Positives = 374/466 80%, Gaps = 30/466 6%
Query  1    MANPSLLSLSVCLLI-LFHGCLAS---RQQGQQQNECQIDQLDALEPDNRVEYEAGMVET 56
            MA P LLS+ + L++ LF+GCLA    RQQ QQ  +CQ+++LDALEP NR+E EAG++E+
Sbjct  1    MAKPILLSIYLFLIVALFNGCLAQSGGRQQ-QQFGQCQLNRLDALEPTNRIEAEAGVIES 59
Query  57   WDPNHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAP 116
            WDPN++QF+CAGVAV R TI+PNGL LP+YSNAP L+YI  G G+TG L PGCPET++  
Sbjct  60   WDPNNQQFQCAGVAVVRRTIEPNGLLLPQYSNAPQLVYIARGRGITGVLFPGCPETFEES 119
Query  117  QQGQQHGQSSRFQ-DKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQN 175
            Q+  Q+GQS  FQ D+HQKI+ FR+GDIIA+PAGVA+W YN+G++PVV ++LLD +N+ N
Sbjct  120  QRQSQQGQSREFQQDRHQKIRHFREGDIIAFPAGVAHWSYNDGSNPVVAISLLDTNNNAN 179
Query  176  QLDMYPRKFNLAGNPEDEFQ------------QQQQQQSRGRRQSQQKSC-NNIFCGFDT 222
            QLD  PR F LAGNP+DEF+            QQQ+QQ  G    QQ+   NN+F GFD 
Sbjct  180  QLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQRQQRPGEHGQQQRGLGNNVFSGFDA 239
Query  223  KILAEVFQVEQSLVKQLQNEKDNRGAIVKVKG-DLQVIRP--PRRQSERGF----ESEEE 275
              LA+ F V+    ++LQ+E D+R +IV+V+G  LQVIRP   R + ER      E E E
Sbjct  240  DFLADAFNVDTETARRLQSENDHRRSIVRVEGRQLQVIRPRWSREEQEREERKERERERE 299
Query  276  SEYER--GRRG--RDNGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKW 331
            SE ER   RRG   DNGLEETICT++L+ENI DPSR+DIYT E GRI+++NS  LP+L+W
Sbjct  300  SESERRQSRRGGRDDNGLEETICTLRLRENIGDPSRADIYTEEAGRISTVNSHTLPVLRW 359
Query  332  LQLSAERGVLQNNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVV 391
            LQLSAERG L ++AL VPHWN+NAHS+VY  +G A+VQVVDNFG TVFD E+ EGQ++ +
Sbjct  360  LQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDELREGQLLTI 419
Query  392  PQNFAVVKRARGQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQISREDARKI 451
            PQNFAVVKRAR + FEW+SFKTN+ AM+SPLAG TS +RA+PEEVLA AFQI REDAR++
Sbjct  420  PQNFAVVKRARNEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLATAFQIPREDARRL 479
Query  452  KFNNEQPTLSSGQSSQ 467
            KFN ++ TL   + S+
Sbjct  480  KFNRQESTLVRSRPSR 495

Sequence Alignment: 23. Allergen Name: Fag e 1 Sequence ID: BAA21760

 Score = 211.9 bits 902,  Expect = 6e-56
 Identities = 209/444 47%, Positives = 303/444 68%, Gaps = 51/444 11%
Query  1    MANPSLLSLSVCLLILFHGCLAS---------------RQQGQQQNECQIDQLDALEPDN 45
            M+   +LS+S+CL++L   C A                RQQ Q Q++C I +L A EP  
Sbjct  1    MSTKLILSFSLCLMVL--SCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQRLTASEPSR 58
Query  46   RVEYEAGMVETWDPNHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTL 105
            RV  EAG+ E WD +  +FRC G    R  IQP GL LP YSNAP + ++ +G G+ G +
Sbjct  59   RVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYSNAPYITFVEQGRGVQGVV 118
Query  106  IPGCPETYQA------PQ--------QGQQHGQSSRFQDKHQKIQRFRKGDIIALPAGVA 151
            IPGCPET+Q+      PQ        Q +   +SSR  D+HQKI R R+GD+I  PAGV 
Sbjct  119  IPGCPETFQSDSEFEYPQSQRGRHSRQSESEEESSR-GDQHQKIFRIREGDVIPSPAGVV 177
Query  152  NWCYNEGNSPVVTVTLLDVSNSQNQLDMYPRKFNLAGNPEDEFQQQ-QQQQSRGRRQSQQ 210
             W +N+GN  +++VTLLD ++ + QLD   R F LAG  + E +++   +QSR     + 
Sbjct  178  QWTHNDGNDDLISVTLLDANSYHKQLDENVRSFFLAGQSQRETREEGSDRQSRESDDDEA 237
Query  211  KSCNNIFCGFDTKILAEVFQ-VEQSLVKQLQNEKDNRGAIVKVKGDLQVIRPPRRQSERG 269
                NI+ GF  +IL E+F+ V++  + +L+ E D RG IV+ + DL+ +R P+      
Sbjct  238  LLGANILSGFQDEILHELFRDVDRETISKLRGENDQRGFIVQAQ-DLK-LRVPQ------ 289
Query  270  FESEEESEYERGRR-------GRDNGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLN 322
             + EEE E ERG R       GR NG+E+  C +K++ N + P+ + ++ P  GRI ++N
Sbjct  290  -DFEEEYERERGDRRRGQGGSGRSNGVEQGFCNLKFRRNFNTPTNTYVFNPRAGRINTVN 348
Query  323  SLNLPILKWLQLSAERGVLQNNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGE 382
            S +LPIL++LQLSA+  VL  NA++ P WN+NAHS +Y  +G  +VQVV + G +VFD +
Sbjct  349  SNSLPILEFLQLSAQHVVLYKNAIIGPRWNLNAHSALYVTRGEGRVQVVGDEGKSVFDDK 408
Query  383  VSEGQIFVVPQNFAVVKRARGQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQ 442
            V  GQI+VVPQ FAVV +A  + +EW+ +K +  A+ SP+ G TSVLRA+P EVLAN++ 
Sbjct  409  VQRGQILVVPQGFAVVLKAGREGLEWVELKNSGNAITSPIGGRTSVLRAIPVEVLANSYD 468
Query  443  ISREDARKIKFNNEQ 457
            IS ++A K+K N  Q
Sbjct  469  ISTKEAYKLK-NGRQ 482

Sequence Alignment: 24. Allergen Name: Cor a 9 Sequence ID: AAL73404

 Score = 202.7 bits 862,  Expect = 4e-53
 Identities = 291/470 61%, Positives = 370/470 78%, Gaps = 35/470 7%
Query  1    MANPSLLSLSVCLLILFHGCLA-----SRQQGQQQNECQIDQLDALEPDNRVEYEAGMVE 55
            MA   L+S+S+CLL+LF+GCL       RQQ +   EC +D+L+ALEP NR+E EA  +E
Sbjct  1    MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIE 60
Query  56   TWDPNHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQA 115
            +WD N +QF+CAGVAV R TI+PNGL LP+YSNAP L+YI  G G+TG L PGCPET++ 
Sbjct  61   SWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFED 120
Query  116  PQQ----GQQHGQ--SSRF-QDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLL 168
            PQQ    GQ++GQ  S R  QD+HQKI+ FR+GDIIALPAGVA+WCYN+G+SPVVTV+LL
Sbjct  121  PQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLL 180
Query  169  DVSNSQNQLDMYPRKFNLAGNPEDEFQQQQQQQSRGRRQSQQKSC------------NNI 216
              +N  NQLD  PR F LAGNP+DE Q+Q QQQ   RR+ QQ S             NN+
Sbjct  181  HTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNNV 240
Query  217  FCGFDTKILAEVFQVEQSLVKQLQNEKDNRGAIVKVKGDLQVIRPPR-RQS-ERGFESEE 274
            F GFD + LA+ F V+    ++LQ+ +D R  IVKV+G LQV+RP R RQ  ER    E 
Sbjct  241  FSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWERQERQER 300
Query  275  ESEYER------GRRGRD-NGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLP 327
            ESE ER      G RGRD NG+EETIC+++L+ENI   SR+DIYT +VGRI ++NS  LP
Sbjct  301  ESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTVNSNTLP 360
Query  328  ILKWLQLSAERGVLQNNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQ 387
            +L+WLQLSAERG LQ   L VPHWN+NAHS+VY  +G A+VQVVD+ GNTVFD E+ +GQ
Sbjct  361  VLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELRQGQ 420
Query  388  IFVVPQNFAVVKRARGQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQISRED 447
            ++ +PQNFAV KRA  + FEW++FKTND A ISPLAG TS +RA+P++VLANAFQISRE+
Sbjct  421  VLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQISREE 480
Query  448  ARKIKFNNEQPTL--SSGQSSQQMR 470
            AR++K+N ++ TL  SS  SS++ R
Sbjct  481  ARRLKYNRQETTLVRSSRSSSERKR 505

Sequence Alignment: 25. Allergen Name: Gly m 6.0301 Sequence ID: P11828

 Score = 189.3 bits 803,  Expect = 4e-49
 Identities = 236/457 51%, Positives = 325/457 71%, Gaps = 22/457 4%
Query  7    LSLSVCLLILFHGC---LASRQQGQQQNECQIDQLDALEPDNRVEYEAGMVETWDPNHEQ 63
            L LS+C+L LF GC   ++ R+Q  QQNECQI +L+AL+PDNR+E E G +ETW+PN++ 
Sbjct  4    LVLSLCFL-LFSGCCFAFSFREQ-PQQNECQIQRLNALKPDNRIESEGGFIETWNPNNKP 61
Query  64   FRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAPQQGQQHG 123
            F+CAGVA++R T+  N LR P Y+NAP  +YI +G G+ G + PGCP T++ PQQ    G
Sbjct  62   FQCAGVALSRCTLNRNALRRPSYTNAPQEIYIQQGSGIFGMIFPGCPSTFEEPQQ---KG 118
Query  124  QSSRFQDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMYPRK 183
            QSSR QD+HQKI  FR+GD+IA+P G A W YN  ++PVV V+L+D ++ QNQLD  PR+
Sbjct  119  QSSRPQDRHQKIYHFREGDLIAVPTGFAYWMYNNEDTPVVAVSLIDTNSFQNQLDQMPRR 178
Query  184  FNLAGNPEDEFQQQQQQQSRGRRQSQ----QKSCNN----IFCGFDTKILAEVFQVEQSL 235
            F LAGN E EF Q Q Q+ +G  QSQ    Q+   N    I+ GF  + L   F V++ +
Sbjct  179  FYLAGNQEQEFLQYQPQKQQGGTQSQKGKRQQEEENEGGSILSGFAPEFLEHAFVVDRQI 238
Query  236  VKQLQ--NEKDNRGAIVKVKGDLQVIRPP-RRQSERGFESEEESEYERGRRGRD---NGL 289
            V++LQ  NE++ +GAIV VKG L VI PP   Q +R  E E+    E+ +  +    NG+
Sbjct  239  VRKLQGENEEEEKGAIVTVKGGLSVISPPTEEQQQRPEEEEKPDCDEKDKHCQSQSRNGI 298
Query  290  EETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQNNALMVP 349
            +ETICTM+L+ NI   S  DI+ P+ G IT+  SL++P L WL+LSA+ G L+ NA+ VP
Sbjct  299  DETICTMRLRHNIGQTSSPDIFNPQAGSITTATSLDFPALSWLKLSAQFGSLRKNAMFVP 358
Query  350  HWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQRFEWI 409
            H+N+NA+SI+Y   G A VQVV+  G  VFDGE+ EGQ+++VPQNFAV  R++   FE++
Sbjct  359  HYNLNANSIIYALNGRALVQVVNCNGERVFDGELQEGQVLIVPQNFAVAARSQSDNFEYV 418
Query  410  SFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQISREDARKIKFNNEQPTLSSGQSSQQ 468
            SFKTNDR  I  LAG+ S+L A+PEEV+   F + R+ AR++K NN    L   + SQ+
Sbjct  419  SFKTNDRPSIGNLAGANSLLNALPEEVIQQTFNLRRQQARQVKNNNPFSFLVPPKESQR 477

Sequence Alignment: 26. Allergen Name: Pis v 2.0201 Sequence ID: DQ631677

 Score = 177.9 bits 753,  Expect = 1e-45
 Identities = 260/453 57%, Positives = 332/453 73%, Gaps = 37/453 8%
Query  1    MANPSLLSLSVCLLILFHGCLAS---------RQQGQQ-QNECQIDQLDALEPDNRVEYE 50
            M   SLLS+S+ +L+LFH  +A          RQQ Q+ Q +CQI  L+ALEP  R+E E
Sbjct  1    MGYSSLLSFSLGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNALEPKRRIESE 60
Query  51   AGMVETWDPNHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCP 110
            AG+ E WD N EQ++CA VAV RHTIQ  GL +P Y+NAP L+Y+V+G G+ G + PGCP
Sbjct  61   AGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVPSYNNAPELVYVVQGSGIHGAVFPGCP 120
Query  111  ETYQAPQQGQ---QHGQSSRFQ---DKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVT 164
            ET+Q   Q Q   QH +S R Q   ++HQK++  R+GDIIALPAGVA+W YN G S +V 
Sbjct  121  ETFQEESQSQSRSQHSRSERSQQSGEQHQKVRHIREGDIIALPAGVAHWIYNNGQSKLVL 180
Query  165  VTLLDVSNSQNQLDMYPRKFNLAGNPEDEFQQ--QQQQQSRGRRQSQQKSCNNIFCGFDT 222
            V L DV NS+NQLD Y RKF L G+P+ E Q   Q   QSR  R+ QQ   NNI+  FD 
Sbjct  181  VALADVGNSENQLDQYLRKFVLGGSPQQEIQGGGQSWSQSRSSRKGQQS--NNILSAFDE 238
Query  223  KILAEVFQVEQSLVKQLQNEKDNRGAIVKVKGDLQVIRPPRRQSERGFESEEESEYERGR 282
            +ILA+ F ++  LVK+LQ E+  RG IV+VK DLQV+ P R          +E EY    
Sbjct  239  EILAQSFNIDTQLVKKLQREEKQRGIIVRVKEDLQVLSPQR----------QEKEYS--- 285
Query  283  RGRDNGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQ 342
               DNGLEET CTM LK NI+DPSR+D+Y P  GR+TS+N+LNLPIL++LQLS E+GVL 
Sbjct  286  ---DNGLEETFCTMTLKLNINDPSRADVYNPRGGRVTSINALNLPILRFLQLSVEKGVLY 342
Query  343  NNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRAR 402
             NA+M PHWN NAHSIVY  +GN ++Q+V   G +VFD E+ EGQ+ VVPQNFAVVKRA 
Sbjct  343  QNAIMAPHWNMNAHSIVYITRGNGRMQIVSENGESVFDEEIREGQLVVVPQNFAVVKRAS 402
Query  403  GQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQISREDARKIKFN-NEQPTLS 461
               FEW+SFKTN  A IS LAG  SV+R +P +V+ N+F ISREDA  +K + +E   ++
Sbjct  403  SDGFEWVSFKTNGLAKISQLAGRISVMRGLPLDVIQNSFDISREDAWNLKESRSEMTIFA 462
Query  462  SGQSSQQMRD 471
             G  SQ+ R+
Sbjct  463  PGSRSQRQRN 472

Sequence Alignment: 27. Allergen Name: Ses i 7.0101 Sequence ID: Q9AUD2

 Score = 177.0 bits 749,  Expect = 2e-45
 Identities = 236/449 52%, Positives = 319/449 71%, Gaps = 35/449 7%
Query  1    MANPSLLSLSVCLLILFHGC---LASRQ-------QGQQQN------ECQIDQLDALEPD 44
            MA  SLLS+ + + +L  G    LA  Q       Q QQQ+      +C++++L A EP 
Sbjct  1    MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCRVERLTAQEPT 60
Query  45   NRVEYEAGMVETWDPNHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGT 104
             R E EAG+ E WD N++QF CAGVA  R+ IQP GL LP Y+NAP L+Y+V G G+ GT
Sbjct  61   IRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLPHYNNAPQLLYVVRGRGIQGT 120
Query  105  LIPGCPETYQAPQQGQQHGQSSRFQDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVT 164
            +IPGC ET++   Q +Q  +  RF D+HQK+++FR+GDI+ALPAG+  W YN G  P++T
Sbjct  121  VIPGCAETFERDTQPRQD-RRRRFMDRHQKVRQFRQGDILALPAGLTLWFYNNGGEPLIT 179
Query  165  VTLLDVSNSQNQLDMYPRKFNLAGNPEDEFQQQQQQQSRGRRQS--QQKSCNNIFCGFDT 222
            V LLD  N+ NQLD   R F LAGNP     Q  +Q   GR Q+  QQ    NIF GFD 
Sbjct  180  VALLDTGNAANQLDQTFRHFFLAGNP-----QGGRQSYFGRPQTEKQQGETKNIFNGFDD 234
Query  223  KILAEVFQVEQSLVKQLQNEKDNRGAIVKVKGDLQVIRPPRRQSERGFESEEESEYERGR 282
            +ILA+ F V+    ++L+ + D RG IV+ +  L ++ P           EEE  +ER  
Sbjct  235  EILADAFGVDVQTARRLKGQDDLRGRIVRAE-RLDIVLPGE---------EEEERWERDP 284
Query  283  RGRDNGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQ 342
                NGLEET+CT KL+EN+ +P+R+D+Y P  GRI+SLNSL LP+L WL+LSAE+GVL 
Sbjct  285  YSGANGLEETLCTAKLRENLDEPARADVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVLY 344
Query  343  NNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRA- 401
             N L+ PHWN+NAHSI+Y  +G+ + QVV + G +VFDG V EGQ+ +VPQN+ V KRA 
Sbjct  345  RNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVVREGQLIIVPQNYVVAKRAS 404
Query  402  RGQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQISREDARKIKFNNEQPTLS 461
            + + +EWISFKTND AM S LAG  S +RAMPEEV+  A+Q+SR++AR++K+N E+  + 
Sbjct  405  QDEGLEWISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTAYQVSRDEARRLKYNREESRVF 464
Query  462  SGQS 465
            S  S
Sbjct  465  SSTS 468

Sequence Alignment: 28. Allergen Name: Gos h 4 Sequence ID: P09800

 Score = 170.8 bits 722,  Expect = 1e-43
 Identities = 248/464 53%, Positives = 336/464 72%, Gaps = 56/464 12%
Query  1    MANPSLLSLSVCLLILFHGCLAS---------------RQQGQ--QQNECQIDQLDALEP 43
            MA  SLLS+SVCLL+LFHGC A                 QQ Q  +Q++CQ+  L+AL+P
Sbjct  1    MAYTSLLSFSVCLLVLFHGCCAQIDLVTNHHQDPPWGQPQQPQPRHQSQCQLQNLNALQP 60
Query  44   DNRVEYEAGMVETWDPNHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTG 103
             +R   EAG  E WD N +QF+CAGVA  RH IQ  GL LP +++AP L Y+ +GEG+ G
Sbjct  61   KHRFRSEAGETEFWDQNEDQFQCAGVAFLRHKIQRKGLLLPSFTSAPMLFYVEQGEGIHG 120
Query  104  TLIPGCPETYQAPQQGQQHGQSSRFQDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVV 163
             + PGCPETYQ+  Q QQ+ Q    +D+HQK++R+++GD++ALPAGVA+W +N G S +V
Sbjct  121  AVFPGCPETYQS--QSQQNIQDRPQRDQHQKLRRLKEGDVVALPAGVAHWIFNNGRSQLV 178
Query  164  TVTLLDVSNSQNQLDMYPRKFNLAGNPED---------EFQQQQQQQSRGRRQ---SQQK 211
             V L+DV N  NQLD   RKF LAG+P+          +  Q+Q +  RG R+   SQ+ 
Sbjct  179  LVALVDVGNDANQLDENFRKFFLAGSPQGGVVRGGQSRDRNQRQSRTQRGEREEEESQES 238
Query  212  SCNNIFCGFDTKILAEVFQVEQSLVKQLQNEKDNRGAIVKVKGDLQVI------------ 259
              NN++ GF   +LA+ F ++  L ++LQNE+DNRGAIV+++  ++              
Sbjct  239  GGNNVLSGFRDNLLAQAFGIDTRLARKLQNERDNRGAIVRMEHGFEWPEEGQRRQGREEE 298
Query  260  ----RPP---RRQ--SERGFESEEESEYERGRRGRDNGLEETICTMKLKENIHDPSRSDI 310
                R P   RRQ   E G E EE  E  RGRR   NGLEET C+M+LK      S +D+
Sbjct  299  GEEEREPKWQRRQESQEEGSEEEEREERGRGRRRSGNGLEETFCSMRLKHRT-PASSADV 357
Query  311  YTPEVGRITSLNSLNLPILKWLQLSAERGVLQNNALMVPHWNFNAHSIVYGCKGNAQVQV 370
            + P  GRIT++NS+NLPIL++LQLSAERGVL NNA+  PHWN NAHSIVY  +GN ++Q+
Sbjct  358  FNPRGGRITTVNSFNLPILQYLQLSAERGVLYNNAIYAPHWNMNAHSIVYITRGNGRIQI 417
Query  371  VDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQR-FEWISFKTNDRAMISPLAGSTSVL 429
            V   G  +FD +V  GQ+  VPQN AVVK+A G+R FEWI+FKTN  A IS +AG  S++
Sbjct  418  VSENGEAIFDEQVERGQVITVPQNHAVVKKA-GRRGFEWIAFKTNANAKISQIAGRVSIM 476
Query  430  RAMPEEVLANAFQISREDARKIKFNNEQPTL-SSGQSSQQ 468
            R +P +VLAN+F ISRE+A ++K N ++ ++ S  Q SQQ
Sbjct  477  RGLPVDVLANSFGISREEAMRLKHNRQEVSVFSPRQGSQQ 516

Sequence Alignment: 29. Allergen Name: Pru du 6.0201 Sequence ID: ADN39441

 Score = 169.9 bits 718,  Expect = 3e-43
 Identities = 246/459 53%, Positives = 342/459 74%, Gaps = 38/459 8%
Query  12   CLLILFHGCLASRQQGQQQN-ECQIDQLDALEPDNRVEYEAGMVETWDPNHEQFRCAGVA 70
            CLL+LF+GCLASRQ+   QN E Q++QL+A EPDN ++ EAG+ E+W+P+  QF+ AGVA
Sbjct  1    CLLLLFNGCLASRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVA 60
Query  71   VARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQ--APQQGQQHGQSSRF 128
            V R TI+PNGL LP Y NAP L+YIV G G+ G + PGC ET++   PQQ QQ+ Q  +F
Sbjct  61   VVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQF 120
Query  129  -------------------QDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLD 169
                               QD+HQKI+  R+GDIIALPAGVA W YN G  P+V V+LLD
Sbjct  121  RPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLD 180
Query  170  VSNSQNQLDMYPRKFNLAGNPEDEFQQQQQ-QQSRGRRQSQQKSCNNIFCGFDTKILAEV 228
            ++N QNQLD  PR+F LAGNP+DEF  QQQ +Q + ++Q QQ + NNIF GFDT++LA+ 
Sbjct  181  LNNDQNQLDQVPRRFYLAGNPQDEFNPQQQGRQQQQQQQGQQGNGNNIFSGFDTQLLAQA 240
Query  229  FQVEQSLVKQLQNEKDNRGAIVKVKGDLQVIRPPRR---------------QSERGFESE 273
            + V     + LQ + DNR  IV+V+G L  + P  R               QS+R  E +
Sbjct  241  LNVNPETARNLQGQDDNRNEIVRVQGQLDFVSPFSRSAGGRGDQERQQEEQQSQREREEK 300
Query  274  EESEYERGRRGRDNGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQ 333
            +  + ++G  G+DNG+EET C+ +L +NI DPSR+D Y P+ GRI+ +N  +LPIL++L+
Sbjct  301  QREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYLR 360
Query  334  LSAERGVLQNNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQ 393
            LSAE+GVL NNA+  PHW+ NA+++VY  +GNA+VQVV+  G+ ++D EV EGQ+F++PQ
Sbjct  361  LSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREGQLFLIPQ 420
Query  394  NFAVVKRARGQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQISREDARKIKF 453
            N AV+ +A  + FE+ISF+T++    + LAG TSVLRA+P+EVL NAF+ISR++AR +K+
Sbjct  421  NHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFRISRQEARNLKY 480
Query  454  NNEQPTLSSGQSSQQMR 470
            N ++  L S  S  + R
Sbjct  481  NRQESRLLSATSPPRGR 497

Sequence Alignment: 30. Allergen Name: Ara h 3 Sequence ID: O82580

 Score = 150.3 bits 632,  Expect = 2e-37
 Identities = 218/431 50%, Positives = 304/431 70%, Gaps = 60/431 13%
Query  24   RQQGQQQNECQIDQLDALEPDNRVEYEAGMVETWDPNHEQFRCAGVAVARHTIQPNGLRL 83
            RQQ  ++N CQ  +L+A  PDNR+E E G +ETW+PN+++F CAGVA++R  ++ N LR 
Sbjct  1    RQQ-PEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRR 59
Query  84   PEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAPQ-QG------------QQHGQSSRFQD 130
            P YSNAP  ++I +G G  G + PGCP  Y+ P+ QG            Q   QS + +D
Sbjct  60   PFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRD 119
Query  131  KHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMYPRKFNLAGNP 190
             HQK++RF +GD+IA+P GVA W YN+ ++ VV V+L D +N+ NQLD +PR+FNLAGN 
Sbjct  120  SHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNT 179
Query  191  EDEFQQQQQQQSRGRR----------QSQ---------------------QKSCN---NI 216
            E EF + QQQ  + RR          QSQ                     Q+  N   NI
Sbjct  180  EQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNI 239
Query  217  FCGFDTKILAEVFQVE-QSLVKQL--QNEKDNRGAIVKVKGDLQVIRPPRRQSERGFESE 273
            F GF  + L + FQV+ + +V+ L  + E +  GAIV V+G L+++ P R++     E  
Sbjct  240  FSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEY 299
Query  274  EESEYE---------RGRRGRDNGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSL 324
            +E EYE         RG RGR NG+EETICT   K+NI      DIY P+ G + + N L
Sbjct  300  DEDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDL 359
Query  325  NLPILKWLQLSAERGVLQNNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVS 384
            NL IL+WL  SAE G L  NAL V H+N NAHSI+Y  +G A+VQVVD+ GN V+D E+ 
Sbjct  360  NLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQ 419
Query  385  EGQIFVVPQNFAVVKRARGQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQIS 444
            EG+++VVPQNFAV  +++ + FE+++FKT+ R  I+ LAG  SV+  +PEEV+AN++ + 
Sbjct  420  EGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQ 479
Query  445  REDARKIKFNN 455
            RE AR++K NN
Sbjct  480  REQARQLKNNN 490

Sequence Alignment: 31. Allergen Name: Ara h 3 Sequence ID: AAC63045

 Score = 150.3 bits 632,  Expect = 2e-37
 Identities = 218/431 50%, Positives = 304/431 70%, Gaps = 60/431 13%
Query  24   RQQGQQQNECQIDQLDALEPDNRVEYEAGMVETWDPNHEQFRCAGVAVARHTIQPNGLRL 83
            RQQ  ++N CQ  +L+A  PDNR+E E G +ETW+PN+++F CAGVA++R  ++ N LR 
Sbjct  4    RQQ-PEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRR 62
Query  84   PEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAPQ-QG------------QQHGQSSRFQD 130
            P YSNAP  ++I +G G  G + PGCP  Y+ P+ QG            Q   QS + +D
Sbjct  63   PFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRD 122
Query  131  KHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMYPRKFNLAGNP 190
             HQK++RF +GD+IA+P GVA W YN+ ++ VV V+L D +N+ NQLD +PR+FNLAGN 
Sbjct  123  SHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNT 182
Query  191  EDEFQQQQQQQSRGRR----------QSQ---------------------QKSCN---NI 216
            E EF + QQQ  + RR          QSQ                     Q+  N   NI
Sbjct  183  EQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNI 242
Query  217  FCGFDTKILAEVFQVE-QSLVKQL--QNEKDNRGAIVKVKGDLQVIRPPRRQSERGFESE 273
            F GF  + L + FQV+ + +V+ L  + E +  GAIV V+G L+++ P R++     E  
Sbjct  243  FSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEY 302
Query  274  EESEYE---------RGRRGRDNGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSL 324
            +E EYE         RG RGR NG+EETICT   K+NI      DIY P+ G + + N L
Sbjct  303  DEDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDL 362
Query  325  NLPILKWLQLSAERGVLQNNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVS 384
            NL IL+WL  SAE G L  NAL V H+N NAHSI+Y  +G A+VQVVD+ GN V+D E+ 
Sbjct  363  NLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQ 422
Query  385  EGQIFVVPQNFAVVKRARGQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQIS 444
            EG+++VVPQNFAV  +++ + FE+++FKT+ R  I+ LAG  SV+  +PEEV+AN++ + 
Sbjct  423  EGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQ 482
Query  445  REDARKIKFNN 455
            RE AR++K NN
Sbjct  483  REQARQLKNNN 493

Sequence Alignment: 32. Allergen Name: Gly m 6.0401 Sequence ID: Q9SB11

 Score = 143.9 bits 604,  Expect = 2e-35
 Identities = 222/462 48%, Positives = 317/462 68%, Gaps = 98/462 21%
Query  1    MANPSLLSLS-VCLLILFHGCLASRQQGQQQNECQIDQLDALEPDNRVEYEAGMVETWDP 59
            M  P  LSLS +CLL+L   C+A      + NECQ++ L+ALEPD+RVE E G+++TW+ 
Sbjct  1    MGKPFTLSLSSLCLLLLSSACFAI--SSSKLNECQLNNLNALEPDHRVESEGGLIQTWNS 58
Query  60   NHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAPQ-Q 118
             H +++CAGV V++ T+  NGL LP YS  P ++ I +G+G  G  IPGCPET++ PQ Q
Sbjct  59   QHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKGALGVAIPGCPETFEEPQEQ 118
Query  119  GQQHG---QSSRFQDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQN 175
              + G   Q  ++QD HQKI+ F +GD++ +P GV  W YN G+ PVV ++LLD SN  N
Sbjct  119  SNRRGSRSQKQQLQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNN 178
Query  176  QLDMYPRKFNLAGNPEDEF----QQQQQQQSRG-RRQSQQKSCN-----NIFCGFDTKIL 225
            QLD  PR F LAGNP+ E+    QQQQQQ+S G R+Q Q++        +++ GF    L
Sbjct  179  QLDQTPRVFYLAGNPDIEYPETMQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFL 238
Query  226  AEVFQVEQSLVKQLQNEKDNRGAIVKVKGDLQVI-------------------------R 260
            A+ F   + + ++LQ+  D R  IV V+G L VI                          
Sbjct  239  AQSFNTNEDIAEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSH 298
Query  261  PPRRQSE-RGFESEEESEYE---------RGRRGRD------------------------ 286
            PPRR S  +  + E+E E E         +G+R +D                        
Sbjct  299  PPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQPRKSREWRSKK 358
Query  287  -------------------NGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLP 327
                               NG+EE ICT+KL ENI  PSR+D Y P+ GRI++LNSL LP
Sbjct  359  TQPRRPRQEEPRERGCETRNGVEENICTLKLHENIARPSRADFYNPKAGRISTLNSLTLP 418
Query  328  ILKWLQLSAERGVLQNNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQ 387
             L+ +QLSA+  VL  N +  PHWN+NA+S++Y  +G  +V+VV+  GN VFDGE+  GQ
Sbjct  419  ALRQFQLSAQYVVLYKNGIYSPHWNLNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQ 478
Query  388  IFVVPQNFAVVKRARGQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQISRED 447
            ++VVPQNF V ++A  Q FE+I FKT+  A+ S L     V+RA+P EVLA+++ + +  
Sbjct  479  LLVVPQNFVVAEQAGEQGFEYIVFKTHHNAVTSYL---KDVFRAIPSEVLAHSYNLRQSQ 535
Query  448  ARKIKFNNEQPTLSSGQSSQ 467
              ++K+      L + +S Q
Sbjct  536  VSELKYEGNWGPLVNPESQQ 555

Sequence Alignment: 33. Allergen Name: Ses i 6.0101 Sequence ID: Q9XHP0

 Score = 139.4 bits 584,  Expect = 4e-34
 Identities = 191/438 43%, Positives = 287/438 65%, Gaps = 31/438 7%
Query  6    LLSLSVCLLILFHGCLASRQQGQQQNECQIDQLDALEPDNRVEYEAGMVETWDPNHEQFR 65
            LL+LS+ LL+          +  Q  +C+  ++   +P  R++ E G  E WD  +EQF+
Sbjct  7    LLALSLSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQEQFQ 66
Query  66   CAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQA--PQQGQQHG 123
            CAG+   R TI+PNGL LP Y  +P L+YI  G+G+   ++PGC ETYQ    Q+  +  
Sbjct  67   CAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQRTMERT 126
Query  124  QSSRFQDK------HQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQL 177
            ++S  QD+      HQK++R+R+GDI+A+P+G A+WCYN+G+  +V V++ DV++  NQL
Sbjct  127  EASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQL 186
Query  178  DMYPRKFNLAGN-PEDEFQQQQQQQSRGRRQSQQKSCNNIFCGFDTKILAEVFQVEQSLV 236
            D   R F LAG  P    Q+QQ +Q+           +NIF  FD ++L+E F V Q  +
Sbjct  187  DQKFRAFYLAGGVPRSGEQEQQARQT----------FHNIFRAFDAELLSEAFNVPQETI 236
Query  237  KQLQNEKDNRGAIVKVKGDLQVIRPPRRQSERGFESEEESEYERGRRGRDNGLEETICTM 296
            +++Q+E++ RG IV  +  +  +RP           EEE E E   R  DNGLEET CTM
Sbjct  237  RRMQSEEEERGLIVMARERMTFVRP----------DEEEGEQEHRGRQLDNGLEETFCTM 286
Query  297  KLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQNNALMVPHWNFNAH 356
            K++ N+     +DI++ + GR+  ++   LPILK++ LSAE+G L +NAL+ P W+   H
Sbjct  287  KFRTNVESRREADIFSRQAGRVHVVDRNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGH 346
Query  357  SIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQRFEWISFKTNDR 416
            +IVY  +G+AQVQVVD+ G  + +  V++G++FVVPQ +    RA    FEW++FKT   
Sbjct  347  TIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTARAGNNGFEWVAFKTTGS 406
Query  417  AMISPLAGSTSVLRAMPEEVLANAFQISREDARKIKFN--NEQPTLSSG 463
             M SPLAG TSV+RAMP +V+ N++QIS   A+ +K N  ++   LS G
Sbjct  407  PMRSPLAGYTSVIRAMPLQVITNSYQISPNQAQALKMNRGSQSFLLSPG 455

Sequence Alignment: 34. Allergen Name: Ara h 4 Sequence ID: AAD47382

 Score = 139.4 bits 584,  Expect = 5e-34
 Identities = 225/451 49%, Positives = 317/451 70%, Gaps = 66/451 14%
Query  1    MANPSLLSLSVCLLILFHGCLASRQQGQQQNECQIDQLDALEPDNRVEYEAGMVETWDPN 60
            MA    LS+  C+L+L    ++ RQQ  ++N CQ  +L+A  PDNR+E E G +ETW+PN
Sbjct  1    MAKLLELSFCFCFLVLGASSISFRQQ-PEENACQFQRLNAQRPDNRIESEGGYIETWNPN 59
Query  61   HEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAP-QQG 119
            +++F CAGVA++R  ++ N LR P YSNAP  ++I +G G  G + PGCP TY+ P QQG
Sbjct  60   NQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQG 119
Query  120  ------------QQHGQSSRFQDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTL 167
                        Q+  QS + QD HQK++RF +GD+IA+P GVA W YN+ ++ VV V+L
Sbjct  120  RRYQSQRPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSL 179
Query  168  LDVSNSQNQLDMYPRKFNLAGNPEDEFQQQQQQ----------------QSRGRR----- 206
             D +N+ NQLD +PR+FNLAGN E EF + QQQ                +SR RR     
Sbjct  180  TDTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREF 239
Query  207  -------------QSQQKSCNNIFCGFDTKILAEVFQVE-QSLVKQL--QNEKDNRGAIV 250
                         Q ++    NIF GF  + L + FQV+ + +V+ L  +NE +  GAIV
Sbjct  240  RPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIV 299
Query  251  KVKGDLQVIRPPRRQSERGFESEEE---SEYER----GRRGRD-----NGLEETICTMKL 298
             V+G L+++ P      RG + EEE    +YE     GRRGR      NG+EETICT  +
Sbjct  300  TVRGGLRILSP---DGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEETICTACV 356
Query  299  KENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQNNALMVPHWNFNAHSI 358
            K+NI       IY P+     + + LNL IL+WL LSAE G L  NAL VPH+N NAHSI
Sbjct  357  KKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSI 416
Query  359  VYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQRFEWISFKTNDRAM 418
            +Y  +G A+VQVVD+ GN V+D E+ EG+++VVPQNFAV  +++ + FE+++FKT+ R  
Sbjct  417  IYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPS 476
Query  419  ISPLAGSTSVLRAMPEEVLANAFQISREDARKIKFNN 455
            I+ +AG  S +  +PEEV+AN++ + RE AR++K NN
Sbjct  477  IANFAGENSFIDNLPEEVVANSYGLPREQARQLKNNN 513

Sequence Alignment: 35. Allergen Name: Gly m 6.0501 Sequence ID: Q7GC77

 Score = 134.4 bits 562,  Expect = 1e-32
 Identities = 216/456 47%, Positives = 310/456 67%, Gaps = 65/456 14%
Query  1    MANPSL-LSLS-VCLLILFHGCLASRQQGQQQNECQIDQLDALEPDNRVEYEAGMVETWD 58
            M  P + LSLS +CLL+L   C+A      + NECQ++ L+ALEPD+RVE E G++ETW+
Sbjct  1    MGKPFFTLSLSSLCLLLLSSACFAITSS--KFNECQLNNLNALEPDHRVESEGGLIETWN 58
Query  59   PNHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAPQQ 118
              H +++CAGV V++ T+  NGL LP YS  P ++ +V+G+G  G   PGCPET++ PQQ
Sbjct  59   SQHPELQCAGVTVSKRTLNRNGLHLPSYSPYPQMIIVVQGKGAIGFAFPGCPETFEKPQQ 118
Query  119  -GQQHGQSSR--FQDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQN 175
               + G  S+  +QD HQKI+ F +GD++ +P GV  W YN G+ PVV ++LLD SN  N
Sbjct  119  QSSRRGSRSQQQLQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNN 178
Query  176  QLDMYPRKFNLAGNPEDE----FQQQQQQQSRGRR-----QSQQKSCNNIFCGFDTKILA 226
            QLD  PR F LAGNP+ E     QQQQQQ+S G R     Q Q++   +++ GF    LA
Sbjct  179  QLDQNPRVFYLAGNPDIEHPETMQQQQQQKSHGGRKQGQHQQQEEEGGSVLSGFSKHFLA 238
Query  227  EVFQVEQSLVKQLQNEKDNRGAIVKVKGDLQVIRP-----------------------PR 263
            + F   +   ++L++  D R  IV V+G L VI P                       PR
Sbjct  239  QSFNTNEDTAEKLRSPDDERKQIVTVEGGLSVISPKWQEQEDEDEDEDEEYEQTPSYPPR 298
Query  264  RQSERGFESEEESEYERGR------------------RGRD----NGLEETICTMKLKEN 301
            R S    E +E+ + E  +                  RGR     NG+EE ICTMKL EN
Sbjct  299  RPSHGKHEDDEDEDEEEDQPRPDHPPQRPSRPEQQEPRGRGCQTRNGVEENICTMKLHEN 358
Query  302  IHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQNNALMVPHWNFNAHSIVYG 361
            I  PSR+D Y P+ GRI++LNSL LP L+ + LSA+  VL  N +  PHWN+NA+S++Y 
Sbjct  359  IARPSRADFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNANSVIYV 418
Query  362  CKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQRFEWISFKTNDRAMISP 421
             +G  +V+VV+  GN VFDGE+  GQ++VVPQNF V ++   Q +E++ FKT+  A+ S 
Sbjct  419  TRGKGRVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQGGEQGLEYVVFKTHHNAVSSY 478
Query  422  LAGSTSVLRAMPEEVLANAFQISREDARKIKFN-NEQPTLS 461
            +     V+RA+P EVL+N++ + +   R++K+  N  P ++
Sbjct  479  IK---DVFRAIPSEVLSNSYNLGQSQVRQLKYQGNSGPLVN 516

Sequence Alignment: 36. Allergen Name: Coc n 1.0101 Sequence ID: A0A0S3B0K0

 Score = 56.9 bits 222,  Expect = 3e-09
 Identities = 90/331 27%, Positives = 165/331 49%, Gaps = 73/331 22%
Query  75   TIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAPQQGQQHGQSSRFQDKHQK 134
            T++PN L +P+Y +A  ++++  GE   G +                      +++K  +
Sbjct  93   TMEPNTLYIPQYIDASLILFVRRGEAKVGYI----------------------YKNKLVE 130
Query  135  IQRFRKGDIIALPAGVANWCYNEGNSPVVTVTL-LDVSNSQNQLDMYPRKFNLAGNPEDE 193
             +R++ G + A+PAG + +  N   S  + +   +D   S      YP+ F + G     
Sbjct  131  -KRLKSGYVDAIPAGSSFYIVNSDKSERLHIICSIDTLESMEYYGAYPQSFYVGGGVLPR 189
Query  194  FQQQQQQQSRGRRQSQQKSCNNIFCGFDTKILAEVFQVEQSLVKQLQNEKDNRGAIVKVK 253
                                 +++ GFD   L+  F V    ++ + N +   G I+++ 
Sbjct  190  ---------------------SVLSGFDASTLSAAFNVSSDQLEMILNSQRG-GPIIRLN 227
Query  254  GDLQVIRP---------PRRQSERGFESEEESEYERG-------RRGRDNGLEETICTMK 297
            G+    R           R   E+  +S+++ E E+        R    + L +  C ++
Sbjct  228  GEAAEQRDYLSSIMQLKERMVQEKEMDSDDDDEAEQEEDDVWTWRCLLKSLLGKGDCRVQ 287
Query  298  LKENI-HDPSRSDIYTPE------VGRITSLNSLNLPILKWLQLSAERGVLQNNALMVPH 350
             K  + H P   ++Y  E       G   +++  +   LK   L      L+  A++ PH
Sbjct  288  RKHKLAHSPGSYNLYDTEPSYQNDYGYSIAIDGHDYSALKHSNLGVYLVNLKAGAMLSPH 347
Query  351  WNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRAR-GQRFEWI 409
             N  A       +G+  +QVV   G    + +VSEG +F +P+ F   + A  G  +E+ 
Sbjct  348  VNPTATEYGIILRGSGTIQVVFPNGTAAMNAKVSEGDVFWIPRYFPFCQIASDGAPLEFF 407
Query  410  SFKTNDRAMISP--LAGSTSVLRAMPEEVLANAFQISREDARKI 451
             F T+ R    P  L G +S+L +M    LA AF +S E   +I
Sbjct  408  GFTTSARKN-RPQFLVGKSSLLHSMRGPELAAAFGVSEEQLERI 450

Sequence Alignment: 37. Allergen Name: Gly m Bd28K Sequence ID: BAB21619

 Score = 47.5 bits 181,  Expect = 2e-06
 Identities = 82/327 25%, Positives = 167/327 51%, Gaps = 76/327 23%
Query  75   TIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAPQQGQQHGQSSRFQDKHQK 134
            +++P  L +P+Y ++  +++I  GE   G +                      + D+  +
Sbjct  74   SMEPKSLFVPQYLDSNLIIFIRRGEAKLGFI----------------------YDDELAE 111
Query  135  IQRFRKGDIIALPAGVANWCYNEGNSPVVTVTL-LDVSNSQNQLDMYPRKFNLAGNPEDE 193
             +R++ GD+  +P+G A +  N G    + V   +D S S   L+ + + F + G     
Sbjct  112  -RRLKTGDLYMIPSGSAFYLVNIGEGQRLHVICSIDPSTSLG-LETF-QSFYIGGGANS- 167
Query  194  FQQQQQQQSRGRRQSQQKSCNNIFCGFDTKILAEVFQVEQSLVKQLQNEKDNRGAIVKVK 253
                                ++++ GF+  IL   F   +++V+++ + K+  G I+ V 
Sbjct  168  --------------------HSVLSGFEPAILETAFNESRTVVEEIFS-KELDGPIMFVD 206
Query  254  GD---------LQVIRPPRRQS-ERGFESEEESEYERGRRGRDNGLEETI---CTMKLKE 300
                       LQ+ +  + Q  ++  + +EE E E+        L ET+      K++ 
Sbjct  207  DSHAPSLWTKFLQLKKDDKEQQLKKMMQDQEEDEEEKQTSRSWRKLLETVFGKVNEKIEN 266
Query  301  ----------NIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQNNALMVPH 350
                      N++D  ++D +    G   +L+    P L    +      L   +++ PH
Sbjct  267  KDTAGSPASYNLYDDKKAD-FKNAYGWSKALHGGEYPPLSEPDIGVLLVKLSAGSMLAPH 325
Query  351  WNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRA-RGQRFEWI 409
             N  +        G  ++++    G+     ++ +G +FVVP+ F   + A R   +E+ 
Sbjct  326  VNPISDEYTIVLSGYGELHIGYPNGSRAMKTKIKQGDVFVVPRYFPFCQVASRDGPLEFF 385
Query  410  SFKTNDRAMISP--LAGSTSVLRAMPEEVLANAFQISREDARK 450
             F T+ R    P  LAG+ S+LR +    L+ AF +S +  R+
Sbjct  386  GFSTSARKN-KPQFLAGAASLLRTLMGPELSAAFGVSEDTLRR 427

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.