The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAPIIVPCLLLVVLVLQCSVINSLDYCSLCRGGRGEHVGCGSPGFSSDCGQKARTRKFTK
EHKKVILDKINDVRDHVAKGSWGLPVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRHT
LRFWSPGQLNFEFYADKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELA
LAISDRVTAVGCGLTTWKLGGKARALLTCNFSSENDYNRPVYKTGNSPGEKCIKKDETFK
NLCSAQEPINPNEHNF
Sequence Info Allergen Name Length Opt Bits Score E Value
ADM18345 Tab y 5.0101 256 1768 382.6 7.3e-108
AAF82096 Glo m 5 259 350 83.3 9.1e-18
P10736 Dol m 5.0101 227 236 59.2 1.4e-10
QEA69430 Sco m 5.0101 210 227 57.3 4.8e-10
AAF65314 Cte f 2 264 223 56.5 1.1e-09
Q05108 Dol a 5 203 216 55.0 2.3e-09
P35785 Ves p 5 204 210 53.7 5.7e-09
P10737 Dol m 5.02 215 210 53.7 6e-09
AAA28302 Dol m 5.02 212 209 53.5 6.8e-09
Q05110 Ves v 5 227 209 53.5 7.3e-09
P35780 Pol f 5 205 207 53.1 8.8e-09
C0HJV9 Poly p 5.0101 206 205 52.7 1.2e-08
Q7Z156 Poly s 5.0101 207 204 52.5 1.4e-08
P81656 Pol d 5 206 203 52.3 1.6e-08
P35781 Vesp c 5 202 202 52.1 1.8e-08
P35782 Vesp c 5 202 198 51.2 3.2e-08
C0ITL3 Pac c 3.0101 199 196 50.8 4.3e-08
P35783 Ves f 5 204 195 50.6 5.1e-08
P35760 Ves m 5 204 194 50.4 5.9e-08
P81657 Vesp m 5 202 192 49.9 7.8e-08
P83377 Pol g 5 206 192 49.9 7.9e-08
P35784 Ves g 5 204 185 48.5 2.2e-07
P35779 Sol r 3 211 184 48.3 2.6e-07
P0DMB9 Vesp v 5.0101 202 183 48.0 2.9e-07
P35786 Ves s 5 205 180 47.4 4.6e-07
AAT95009 Pol e 5.0101 226 179 47.2 5.8e-07
P35759 Pol e 5.0101 205 178 47.0 6.1e-07
P86686 Poly p 5.0102 207 178 47.0 6.2e-07
P35778 Sol i 3 234 176 46.6 9.3e-07
Q05109 Pol a 5 209 175 46.4 9.7e-07
P35787 Ves vi 5 206 170 45.3 2e-06
ABC58726 Sol s 3.0101 90 109 32.4 0.0066
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Tab y 5.0101 Sequence ID: ADM18345

 Score = 382.6 bits 1768,  Expect = 7e-108
 Identities = 256/256 100%, Positives = 256/256 100%, Gaps = 0/256 0%
Query  1    MAPIIVPCLLLVVLVLQCSVINSLDYCSLCRGGRGEHVGCGSPGFSSDCGQKARTRKFTK 60
            MAPIIVPCLLLVVLVLQCSVINSLDYCSLCRGGRGEHVGCGSPGFSSDCGQKARTRKFTK
Sbjct  1    MAPIIVPCLLLVVLVLQCSVINSLDYCSLCRGGRGEHVGCGSPGFSSDCGQKARTRKFTK 60
Query  61   EHKKVILDKINDVRDHVAKGSWGLPVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRHT 120
            EHKKVILDKINDVRDHVAKGSWGLPVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRHT
Sbjct  61   EHKKVILDKINDVRDHVAKGSWGLPVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRHT 120
Query  121  LRFWSPGQLNFEFYADKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELA 180
            LRFWSPGQLNFEFYADKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELA
Sbjct  121  LRFWSPGQLNFEFYADKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELA 180
Query  181  LAISDRVTAVGCGLTTWKLGGKARALLTCNFSSENDYNRPVYKTGNSPGEKCIKKDETFK 240
            LAISDRVTAVGCGLTTWKLGGKARALLTCNFSSENDYNRPVYKTGNSPGEKCIKKDETFK
Sbjct  181  LAISDRVTAVGCGLTTWKLGGKARALLTCNFSSENDYNRPVYKTGNSPGEKCIKKDETFK 240
Query  241  NLCSAQEPINPNEHNF 256
            NLCSAQEPINPNEHNF
Sbjct  241  NLCSAQEPINPNEHNF 256

Sequence Alignment: 2. Allergen Name: Glo m 5 Sequence ID: AAF82096

 Score = 83.3 bits 350,  Expect = 9e-18
 Identities = 72/236 30%, Positives = 118/236 50%, Gaps = 14/236 5%
Query  11   LVVLVLQCSVINSLDYCSLCRGGRGEHVGCGSPG-FSSDCGQKARTRKFTKEHKKVILDK 69
            L +L+L  + +   DYC LC      H  C     F S C   A+   + K ++  +LD 
Sbjct  8    LSLLILGSAAVGG-DYCGLC----DNHDACVMQNVFQSGCPSGAKMIDLNK-YQSALLDA 61
Query  70   INDVRDHVAKGSWG-LPVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRHTLRFWSPGQ 128
             N  R+HVA G    L  A +M  + WD ELA LA+ + + C     +CR+T++F   GQ
Sbjct  62   HNKKRNHVAGGGESKLKRACQMATMKWDSELAKLAEYNVKQCQMNHDRCRNTVKFKYAGQ 121
Query  129  LNFEF--YADKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKG-NVKELALAISD 185
               E+       P    LI  A+ + + +  +  +  I+ Y P   +G  +  + + +++
Sbjct  122  NLAELGRSGGPPPDYRKLIEKAVDKWYEEVKDCNQGYIDSY-PMNYRGPAIGHFTVMVAE 180
Query  186  RVTAVGCGLTTW-KLGGKARALLTCNFSSENDYNRPVYKTGNSPGEKCIK-KDETFKNLC 243
            R T VGC  + + K  G    L+ CN+++ N    P+YK+  S  + C   K+  + NLC
Sbjct  181  RNTHVGCAASEYTKSNGFQYFLMACNYATTNMMEFPIYKSCGSSAQDCKSGKNSKYPNLC 240
Query  244  SAQEPINPNE 253
            S  E    N+
Sbjct  241  SPNEKYEVNK 250

Sequence Alignment: 3. Allergen Name: Dol m 5.0101 Sequence ID: P10736

 Score = 59.2 bits 236,  Expect = 1e-10
 Identities = 56/207 27%, Positives = 99/207 47%, Gaps = 18/207 8%
Query  9    LLLVVLVLQCSVINSLDYCSL-CRGGRGEHVGCG-SPGFSSDCGQKA-RTRKFTKEHKKV 65
            L+L++ ++  S   + +YC + CR  +G H  C        +CG+   +   +T + K  
Sbjct  9    LILIITIINLSFGETNNYCKIKCR--KGIHTLCKFGTSMKPNCGRNVVKAYGLTNDEKNE 66
Query  66   ILDKINDVRDHVAKG--SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRH 119
            IL + ND R +VAKG  + G     P A  M V+VW++ELA +A+     C      CR+
Sbjct  67   ILKRHNDFRQNVAKGLETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFNHDDCRN 126
Query  120  TLRFWSPGQLNFEFYADKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKEL 179
            T ++   GQ N    +    +     S  IK+   +       +  +       G+  ++
Sbjct  127  TAKY-QVGQ-NIAI-SSTTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQM 183
Query  180  ALAISDRVTAVGCGLTTWKLGGKARALLTCNFS-SENDYNRPVYK 223
               +  +   +GCG   +         L CN+    ND+N+P+Y+
Sbjct  184  ---VWGKTKEIGCGSIKYIEDNWYTHYLVCNYGPGGNDFNQPIYE 225

Sequence Alignment: 4. Allergen Name: Sco m 5.0101 Sequence ID: QEA69430

 Score = 57.3 bits 227,  Expect = 5e-10
 Identities = 57/181 31%, Positives = 96/181 53%, Gaps = 21/181 11%
Query  50   GQKARTRKFTKEHKKVILDKINDVRDHVAKGSW-GLPVASRMKVIVWDEELAALAKRHTQ 108
            G   + R +    KK+ILD  N  R  VA G   G P A+ MK + WD+++AA A+R  +
Sbjct  23   GCDMKVRGLDANMKKMILDLHNKKRQTVANGQQSGQPSAANMKELHWDDQIAANAQRSAE 82
Query  109  GCVPE--AYKCRHTLRFWSPGQ-LNFEFYADKMPSTMSLISTAIKRGHTQKHNITRDIIE 165
             CV +  A   R T ++   G+ +    Y D +P +++     +K       ++T  +++
Sbjct  83   TCVFQHTAKNLRKTSKYSYLGENIYMGSYPDPIPRSVNAWYDEVK-------DVTPAVVK 135
Query  166  KYQPAGPK-GNVKELALAISDRVTAVGCGLTTWKLGGKARALLTCNFSSENDY-NRPVYK 223
             ++  GP  G+  ++  A ++   A+GCGL T          + C +    +Y   P+YK
Sbjct  136  SFRSGGPMIGHYTQMVWANTE---ALGCGLVT---ASDKNTYIFCQYGPSGNYPGEPIYK 189
Query  224  TGNSPGEKCIK-KDETFKNLCS 244
             G SP   C K K   +  LC+
Sbjct  190  QG-SPASDCKKGKSSKYPGLCN 210

Sequence Alignment: 5. Allergen Name: Cte f 2 Sequence ID: AAF65314

 Score = 56.5 bits 223,  Expect = 1e-09
 Identities = 74/228 32%, Positives = 112/228 49%, Gaps = 33/228 14%
Query  5    IVPCLLLVVLVLQCSVI---------NSLDYCSL-CRGGRGEHVGCGSPGFSSDCGQKAR 54
            ++  +++VV+ +  SVI         N  DYC+L C  G   +VGC  P    DC Q  +
Sbjct  4    LLSSIIIVVFSVWLSVIFAVNVKPKPNQDDYCNLNCTNG--PNVGCTKPDVPRDC-QNFK 60
Query  55   TRKFTKEHKKVILDKINDVRDHVAKGSWGL-------PVASRMKVIVWDEELAALAKRHT 107
                T+  KK  L+  N  R  VA G  GL       P+A++M  + W+  LA LA+ + 
Sbjct  61   LVNITERMKKAFLNAHNRKRRLVAAGK-GLLKDGVHTPIAAKMPNLTWNIALAKLAEYNV 119
Query  108  QGCVPEAYKCRHTLRFWSPGQLNFEFYADKM-PSTMSLISTAIKRGHTQKHNITR-DIIE 165
            + C    + C  T R    GQ N+ FY   + P   S I+     G   +   TR + I+
Sbjct  120  KQC-EMKHDCAKT-RHGHTGQ-NLFFYGTTLSPIKNSTIAKMAVDGWYAESKDTRLEDIK 176
Query  166  KYQPAGPKGN-VKELALAISDRVTAVGCGLTTWKLGGKAR----ALLTCNFSSENDYNRP 220
            K     P G  +      I    T VGC ++T+K           L+ CN+   N     
Sbjct  177  KLTTIYPNGKPIGHYTQLIWGNTTKVGCAVSTYKKHSNGNMFNMTLVACNYRGGNMLEEA 236
Query  221  VYKTGNSPGEKCIKKDETFKN 241
            VY+  ++   K   K++T  N
Sbjct  237  VYQIKDAKNPK--SKNQTKNN 255

Sequence Alignment: 6. Allergen Name: Dol a 5 Sequence ID: Q05108

 Score = 55.0 bits 216,  Expect = 2e-09
 Identities = 51/189 26%, Positives = 93/189 49%, Gaps = 21/189 11%
Query  25   DYCSLCRGGRGEHVGCG-SPGFSSDCGQK-ARTRKFTKEHKKVILDKINDVRDHVAKG-- 80
            +YC +C   +G H  C        +CG K  ++   T + K  I+ + N+ R  VA+G  
Sbjct  2    NYCKIC--PKGTHTLCKYGTSMKPNCGGKIVKSYGVTNDEKNEIVKRHNEFRQKVAQGLE 59
Query  81   SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRHTLRFWSPGQLNFEFYAD 136
            + G     P A  M ++VW++ELA +A+     C     +CR+T ++  P   N    A 
Sbjct  60   TRGNPGPQPPAKNMNLLVWNDELAKIAQTWANQCNFGHDQCRNTAKY--PVGQNVAI-AS 116
Query  137  KMPSTMSLISTAIK--RGHTQKHNITRDIIEKYQPAGPKGNVKELALAISDRVTAVGCGL 194
               ++   +S  IK      + +N  +D++  +      G+  ++   +  +   +GCG 
Sbjct  117  TTGNSYQTMSYLIKMWEDEVKDYNPHKDLM--HNNFSKVGHYTQM---VWGKTKEIGCGS 171
Query  195  TTWKLGGKARALLTCNFSSENDY-NRPVYK 223
              +         L CN+    +Y N+PVY+
Sbjct  172  VKYIENKWHTHYLVCNYGPAGNYMNQPVYE 201

Sequence Alignment: 7. Allergen Name: Ves p 5 Sequence ID: P35785

 Score = 53.7 bits 210,  Expect = 6e-09
 Identities = 54/190 28%, Positives = 92/190 48%, Gaps = 22/190 11%
Query  25   DYCSL-CRGGRGEHVGCGSPGFSSDCGQK-ARTRKFTKEHKKVILDKINDVRDHVAKG-- 80
            +YC + C  G G H  C    +  +CG K   +  +TKE K+ IL + ND R  +A+G  
Sbjct  2    NYCKIKCLKG-GVHTACKYGSLKPNCGNKIVVSYGLTKEEKQDILKEHNDFRQKIARGLE 60
Query  81   SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRHTLRFWSPGQLNFEFY-- 134
            + G     P A  MK +VW++ELA +A+     C      CR   ++  P   N  +   
Sbjct  61   TRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDTCRDVAKY--PVGQNVALTGS 118
Query  135  -ADKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELALAISDRVTAVGCG 193
             ADK  + + L+   +     + +N  +   E        G+  ++  A +     +GCG
Sbjct  119  TADKYDNPVKLVK--MWEDEVKDYNPKKKFSENN--FNKIGHYTQMVWANTKE---IGCG 171
Query  194  LTTWKLGGKARALLTCNFSSENDY-NRPVYKT 224
               +      +  L CN+    ++ N  +Y+T
Sbjct  172  SIKYIQNEWHKHYLVCNYGPSGNFGNEELYQT 203

Sequence Alignment: 8. Allergen Name: Dol m 5.02 Sequence ID: P10737

 Score = 53.7 bits 210,  Expect = 6e-09
 Identities = 53/201 26%, Positives = 92/201 45%, Gaps = 19/201 9%
Query  15   VLQCSVINSLDYCSLCRGGRGEHVGCG-SPGFSSDCGQK-ARTRKFTKEHKKVILDKIND 72
            ++  S   + +YC + +  RG H  C        +CG K  +    + + K  I+++ N 
Sbjct  2    IINLSFGEANNYCKI-KCSRGIHTLCKFGTSMKPNCGSKLVKVHGVSNDEKNEIVNRHNQ 60
Query  73   VRDHVAKG--SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRHTLRFWSP 126
             R  VAKG  + G     P A  M V+VW++ELA +A+     C     +CR+T ++   
Sbjct  61   FRQKVAKGLETRGNPGPQPPAKNMNVLVWNDELAKIAQTWANQCSFGHDQCRNTEKY-QV 119
Query  127  GQLNFEFYADKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKG--NVKELALAIS 184
            GQ N    A    ++ + +S  I+       N  +D   K    G      V      + 
Sbjct  120  GQ-NVAI-ASTTGNSYATMSKLIE----MWENEVKDFNPKKGTMGDNNFSKVGHYTQMVW 173
Query  185  DRVTAVGCGLTTWKLGGKARALLTCNFSSENDY-NRPVYK 223
             +   +GCG   +         L CN+    +Y ++P+Y+
Sbjct  174  GKTKEIGCGSVKYIENNWHTHYLVCNYGPAGNYMDQPIYE 213

Sequence Alignment: 9. Allergen Name: Dol m 5.02 Sequence ID: AAA28302

 Score = 53.5 bits 209,  Expect = 7e-09
 Identities = 53/200 26%, Positives = 91/200 45%, Gaps = 19/200 9%
Query  15   VLQCSVINSLDYCSLCRGGRGEHVGCG-SPGFSSDCGQK-ARTRKFTKEHKKVILDKIND 72
            ++  S   + +YC + +  RG H  C        +CG K  +    + + K  I+++ N 
Sbjct  2    IINLSFGEANNYCKI-KCSRGIHTLCKFGTSMKPNCGSKLVKVHGVSNDEKNEIVNRHNQ 60
Query  73   VRDHVAKG--SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRHTLRFWSP 126
             R  VAKG  + G     P A  M V+VW++ELA +A+     C     +CR+T ++   
Sbjct  61   FRQKVAKGLETRGNPGPQPPAKNMNVLVWNDELAKIAQTWANQCSFGHDQCRNTEKY-QV 119
Query  127  GQLNFEFYADKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKG--NVKELALAIS 184
            GQ N    A    ++ + +S  I+       N  +D   K    G      V      + 
Sbjct  120  GQ-NVAI-ASTTGNSYATMSKLIE----MWENEVKDFNPKKGTMGDNNFSKVGHYTQMVW 173
Query  185  DRVTAVGCGLTTWKLGGKARALLTCNFSSENDY-NRPVY 222
             +   +GCG   +         L CN+    +Y ++P+Y
Sbjct  174  GKTKEIGCGSVKYIENNWHTHYLVCNYGPAGNYMDQPIY 212

Sequence Alignment: 10. Allergen Name: Ves v 5 Sequence ID: Q05110

 Score = 53.5 bits 209,  Expect = 7e-09
 Identities = 57/205 27%, Positives = 101/205 49%, Gaps = 24/205 11%
Query  9    LLLVVLVLQCSVINSLDYCSL-CRGGRGEHVGCGSPGFSSDCGQKAR-TRKFTKEHKKVI 66
            L+++V ++      + +YC + C  G G H  C    +  +CG K   +  +TK+ K+ I
Sbjct  9    LIIIVTIIDLPYGKANNYCKIKCLKG-GVHTACKYGSLKPNCGNKVVVSYGLTKQEKQDI 67
Query  67   LDKINDVRDHVAKG--SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRHT 120
            L + ND R  +A+G  + G     P A  MK +VW++ELA +A+     C      CR  
Sbjct  68   LKEHNDFRQKIARGLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDTCRDV 127
Query  121  LRFWSPGQLNFEFYADKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAG----PKGNV 176
             ++   GQ N  +      ST +     +K     +  + +D   K + +G      G+ 
Sbjct  128  AKYQV-GQ-NVALTG----STAAKYDDPVKLVKMWEDEV-KDYNPKKKFSGNDFLKTGHY 180
Query  177  KELALAISDRVTAVGCGLTTWKLGGKARALLTCNFSSENDY-NRPVYKT 224
             ++  A +  V   GCG   +      +  L CN+    ++ N  +Y+T
Sbjct  181  TQMVWANTKEV---GCGSIKYIQEKWHKHYLVCNYGPSGNFMNEELYQT 226

Sequence Alignment: 11. Allergen Name: Pol f 5 Sequence ID: P35780

 Score = 53.1 bits 207,  Expect = 9e-09
 Identities = 57/184 30%, Positives = 94/184 51%, Gaps = 22/184 11%
Query  24   LDYCSLCRGGRGEHVGCG---SPGFSSDCGQKA-RTRKFTKEHKKVILDKINDVRDHVAK 79
            +DYC + +   G H  C    S   S +C  K  ++   T+E KK+I+++ N  R  VA+
Sbjct  1    VDYCKI-KCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQ 59
Query  80   G--SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAY-KCRHTLRFWSPGQLNFE 132
            G  + G     P AS M  +VW++ELA +A+     C    + KCR+T ++   GQ N  
Sbjct  60   GLETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKY-QVGQ-NIA 117
Query  133  FYA-DKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELALAISDRVTAVG 191
            +    K+P  +SLI   +     +  N  + I +  Q  G  G+  ++  A   +   +G
Sbjct  118  YAGGSKLPDVVSLIK--LWENEVKDFNYNKGITK--QNFGKVGHYTQMIWA---KTKEIG 170
Query  192  CGLTTWKLGGKARALLTCNFSSENDY 217
            CG   +         L CN+    +Y
Sbjct  171  CGSLKYMKNNMQHHYLICNYGPAGNY 196

Sequence Alignment: 12. Allergen Name: Poly p 5.0101 Sequence ID: C0HJV9

 Score = 52.7 bits 205,  Expect = 1e-08
 Identities = 56/188 29%, Positives = 92/188 48%, Gaps = 22/188 11%
Query  26   YCSLCRGGRGEHVGCG---SPGFSSDCGQKARTR-KFTKEHKKVILDKINDVRDHVAKG- 80
            YC++ +  +  H  C    S   SS C + + T    T+E KK+I+D+ N  R  VA+G 
Sbjct  3    YCNI-KCSKVAHTVCQYGESTKPSSKCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQGL 61
Query  81   -SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAY-KCRHTLRFWSPGQLNFEFY 134
             + G     P AS M  +VW++ELA +A+     C    + KCR+T ++     + +   
Sbjct  62   ETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFVHDKCRNTAQYQVGQNIAYSAS 121
Query  135  ADKMPSTMSLISTAIKRGHTQKHNITRDII-EKYQPAGPKGNVKELALAISDRVTAVGCG 193
                P  +SLI   +     +  N ++ I  E +   G    V      +  +   VGCG
Sbjct  122  TAAYPGIVSLI--VLWENEVKDFNYSQGITKENFSKVGHYTQV------VWAKTKEVGCG 173
Query  194  LTTWKLGGKARALLTCNFSSENDY-NRPVY 222
               +   G     L CN+    +Y  +P+Y
Sbjct  174  SIKYIEKGMKSHYLVCNYGPAGNYMGQPIY 203

Sequence Alignment: 13. Allergen Name: Poly s 5.0101 Sequence ID: Q7Z156

 Score = 52.5 bits 204,  Expect = 1e-08
 Identities = 54/188 28%, Positives = 92/188 48%, Gaps = 23/188 12%
Query  26   YCSLCRGGRGEHVGC----GSPGFSSDCGQKARTR-KFTKEHKKVILDKINDVRDHVAKG 80
            YC++ +  +  H  C     +   S +C + + T    T+E KK+I+D+ N  R  VA+G
Sbjct  3    YCNI-KCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQG 61
Query  81   --SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAY-KCRHTLRFWSPGQLNFEF 133
              + G     P AS M  +VW++ELA +A+     C    + KCR+T ++     + +  
Sbjct  62   LETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFFVHDKCRNTAQYQVGQNIAYSA 121
Query  134  YADKMPSTMSLISTAIKRGHTQKHNITRDII-EKYQPAGPKGNVKELALAISDRVTAVGC 192
                 P  +SLI   +     +  N ++ I  E +   G    V      +  +   VGC
Sbjct  122  STAAYPGIVSLI--VLWENEVKDFNYSQGITKENFAKVGHYTQV------VWAKTKEVGC 173
Query  193  GLTTWKLGGKARALLTCNFSSENDY-NRPVY 222
            G   +   G     L CN+    +Y  +P+Y
Sbjct  174  GSIKYIEKGMKSHYLVCNYGPAGNYMGQPIY 204

Sequence Alignment: 14. Allergen Name: Pol d 5 Sequence ID: P81656

 Score = 52.3 bits 203,  Expect = 2e-08
 Identities = 56/190 29%, Positives = 89/190 46%, Gaps = 20/190 10%
Query  25   DYCSLCRGGRGEHVGCG---SPGFSSDC-GQKARTRKFTKEHKKVILDKINDVRDHVAKG 80
            DYC + +   G H  C    S   S +C G+  ++   T+E KK+I+++ N  R  VAKG
Sbjct  2    DYCKI-KCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKG 60
Query  81   --SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAY-KCRHTLRFWSPGQLNFEF 133
              + G     P AS M  +VW++ELA +A+     C    + KCR+T ++     + +  
Sbjct  61   LETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAG 120
Query  134  YADKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELALAISDRVTAVGCG 193
             ++  PS   LI   +     +  N    I  K       G V      +      VGCG
Sbjct  121  SSNHFPSVTKLIQ--LWENEVKDFNYNTGITNKN-----FGKVGHYTQMVWGNTKEVGCG 173
Query  194  LTTWKLGGKARALLTCNFSSENDY-NRPVY 222
               +         L CN+    +Y  +P+Y
Sbjct  174  SLKYVEKNMQIHYLICNYGPAGNYLGQPIY 203

Sequence Alignment: 15. Allergen Name: Vesp c 5 Sequence ID: P35781

 Score = 52.1 bits 202,  Expect = 2e-08
 Identities = 55/185 29%, Positives = 92/185 49%, Gaps = 28/185 15%
Query  25   DYCSL-CRGGRGEHVGCGSPGFSS--DCGQKA-RTRKFTKEHKKVILDKINDVRDHVAKG 80
            +YC + CR G   H  C   G S+  +CG+   +   +TK+    IL + N+ R  VA+G
Sbjct  2    NYCKIKCRSGI--HTLC-KYGTSTKPNCGKNVVKASGLTKQENLEILKQHNEFRQKVARG 58
Query  81   --SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRHTLRFWSPGQLNFEFY 134
              + G     P A  M  +VW++ELA +A+     C      CR++ ++ S GQ   E  
Sbjct  59   LETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYGHDNCRNSAKY-SVGQNIAE-- 115
Query  135  ADKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELA---LAISDRVTAVG 191
                      +S  +K        +  D ++ YQ   PK  + ++      +  +   +G
Sbjct  116  GSTTADNFGSVSNMVK--------MWEDEVKDYQYGSPKNKLNKVGHYTQMVWAKTKEIG 167
Query  192  CGLTTWKLGGKARALLTCNFSSENDY-NRPVYK 223
            CG   +   G  R  L CN+    +  N P+Y+
Sbjct  168  CGSIKYIENGWHRHYLVCNYGPAGNVGNEPIYE 200

Sequence Alignment: 16. Allergen Name: Vesp c 5 Sequence ID: P35782

 Score = 51.2 bits 198,  Expect = 3e-08
 Identities = 55/185 29%, Positives = 96/185 51%, Gaps = 28/185 15%
Query  25   DYCSL-CRGGRGEHVGCGSPGFSS--DCGQKA-RTRKFTKEHKKVILDKINDVRDHVAKG 80
            +YC + CR G   H  C   G S+  +CG+   +   +TK+    IL + N+ R  VA+G
Sbjct  2    NYCKIKCRSGI--HTLC-KYGTSTKPNCGKNVVKASGLTKQENLEILKQHNEFRQKVARG 58
Query  81   --SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRHTLRFWSPGQLNFEFY 134
              + G     P A  M  +VW++ELA +A+     C      CR++ ++ S GQ N    
Sbjct  59   LETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYGHDNCRNSAKY-SVGQ-NIAEG 116
Query  135  ADKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELA---LAISDRVTAVG 191
            +    + ++ +S  +K        +  D ++ YQ   PK  + ++      +  +   +G
Sbjct  117  STSADNFVN-VSNMVK--------MWEDEVKDYQYGSPKNKLNKVGHYTQMVWAKTKEIG 167
Query  192  CGLTTWKLGGKARALLTCNFSSENDY-NRPVYK 223
            CG   +   G  R  L CN+    +  N P+Y+
Sbjct  168  CGSEDYIEDGWHRHYLVCNYGPAGNVGNEPIYE 200

Sequence Alignment: 17. Allergen Name: Pac c 3.0101 Sequence ID: C0ITL3

 Score = 50.8 bits 196,  Expect = 4e-08
 Identities = 52/187 27%, Positives = 77/187 41%, Gaps = 14/187 7%
Query  33   GRGEHVGCG--SPGFSSDCGQKARTRKFTKEHKKVILDKINDVRDHV-----AKGSWG-L 84
            G   H  C   SP  S +CG  +     T   K+ IL   ND R  V      +G+ G  
Sbjct  3    GGAVHTMCQYTSPQPSPNCGTYSNAH-ITAADKETILKVHNDERQKVKAGQETRGNPGPQ 61
Query  85   PVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRHTLRFWSPGQLNFEFYADKMPSTMS- 143
            P AS M  + WD ELAA+A+R    C      CR+  R+     +       K P  M+ 
Sbjct  62   PAASNMPDLTWDNELAAIAQRWVNQCKIGHDGCRNVERYQVGQNIAMSGSTAKGPCNMNN 121
Query  144  LISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELALAISDRVTAVGCGLTTWKLGGKA 203
            L+   I   +        D+            +      +  + T VGCG+  +  G   
Sbjct  122  LVQMWINEVNALN---AADVSSMPSDGNYFMKIGHYTQLVWGKTTKVGCGIIQFLDGKFY 178
Query  204  RALLTCNFSSE-NDYNRPVYK 223
            +  L CN+    N +  P+Y+
Sbjct  179  KCYLACNYGPAGNMFGAPIYQ 199

Sequence Alignment: 18. Allergen Name: Ves f 5 Sequence ID: P35783

 Score = 50.6 bits 195,  Expect = 5e-08
 Identities = 55/189 29%, Positives = 93/189 49%, Gaps = 24/189 12%
Query  25   DYCSL-CRGGRGEHVGCGSPGFSSDCGQKAR-TRKFTKEHKKVILDKINDVRDHVAKG-- 80
            +YC + C  G G H  C    +  +CG K   +  +TK+ K+ IL + ND R  +A+G  
Sbjct  2    NYCKIKCLKG-GVHTACKYGSLKPNCGNKVVVSYGLTKQEKQDILKEHNDFRQKIARGLE 60
Query  81   SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRHTLRFWSPGQLNFEFYAD 136
            + G     P A  MK +VW++ELA +A+     C      CR   ++   GQ N  +   
Sbjct  61   TRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDTCRDIAKY-QVGQ-NVALTG- 117
Query  137  KMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPK----GNVKELALAISDRVTAVGC 192
               ST +     +K     +  + +D   K + +G      G+  ++  A +     VGC
Sbjct  118  ---STAAKYDDPVKLVKMWEDEV-KDYNPKKKFSGNNFLKTGHYTQMVWANTKE---VGC 170
Query  193  GLTTWKLGGKARALLTCNFSSENDY-NRPVYKT 224
            G   +      +  L CN+    ++ N  +Y+T
Sbjct  171  GSIKFIQEKWHKHYLVCNYGPSGNFQNEELYQT 203

Sequence Alignment: 19. Allergen Name: Ves m 5 Sequence ID: P35760

 Score = 50.4 bits 194,  Expect = 6e-08
 Identities = 56/188 29%, Positives = 92/188 48%, Gaps = 26/188 13%
Query  25   DYCSL-CRGGRGEHVGCGSPGFSSDCG-QKARTRKFTKEHKKVILDKINDVRDHVAKG-- 80
            +YC + C  G G H  C    +  +CG +K  +  +TK+ K+ IL + ND R  +A+G  
Sbjct  2    NYCKIKCLKG-GVHTACKYGSLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGLE 60
Query  81   SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRHTLRFWSPGQLNFEFYAD 136
            + G     P A  MK +VW +ELA +A+     C      CR   ++   GQ N  +   
Sbjct  61   TRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKY-QVGQ-NVALTG- 117
Query  137  KMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELALA-ISDRVTA----VG 191
               ST ++ +  +K        +  D ++ Y P         L +   +  V A    VG
Sbjct  118  ---STAAVYNDPVK-----LVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVG 169
Query  192  CGLTTWKLGGKARALLTCNFSSENDY-NRPVYKT 224
            CG   +      +  L CN+    ++ N  +Y+T
Sbjct  170  CGSIKYIQENWHKHYLVCNYGPSGNFQNEELYQT 203

Sequence Alignment: 20. Allergen Name: Vesp m 5 Sequence ID: P81657

 Score = 49.9 bits 192,  Expect = 8e-08
 Identities = 58/185 31%, Positives = 93/185 50%, Gaps = 28/185 15%
Query  25   DYCSL-CRGGRGEHVGCGSPGFSS--DCGQKA-RTRKFTKEHKKVILDKINDVRDHVAKG 80
            +YC + CR G   H  C   G S+  +CG+   +   +TK  K  IL + N+ R  VA+G
Sbjct  2    NYCKIKCRSGI--HTLC-KFGISTKPNCGKNVVKASGLTKAEKLEILKQHNEFRQKVARG 58
Query  81   --SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRHTLRFWSPGQLNFEFY 134
              + G     P A  M  +VW++ELA +A+     C      CR+T ++ S GQ N    
Sbjct  59   LETRGKPGPQPPAKSMNTLVWNDELAQIAQVWAGQCDYGHDVCRNTAKY-SVGQ-NIAEN 116
Query  135  ADKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELA---LAISDRVTAVG 191
                 S  S +S  ++        +  D ++ YQ    K  + E+      +  +   +G
Sbjct  117  GSTAASFAS-VSNMVQ--------MWADEVKNYQYGSTKNKLIEVGHYTQMVWAKTKEIG 167
Query  192  CGLTTWKLGGKARALLTCNFSSENDY-NRPVYK 223
            CG   +   G  R  L CN+    +  N P+Y+
Sbjct  168  CGSIKYIENGWHRHYLVCNYGPAGNIGNEPIYE 200

Sequence Alignment: 21. Allergen Name: Pol g 5 Sequence ID: P83377

 Score = 49.9 bits 192,  Expect = 8e-08
 Identities = 54/190 28%, Positives = 88/190 46%, Gaps = 20/190 10%
Query  25   DYCSLCRGGRGEHVGCG---SPGFSSDC-GQKARTRKFTKEHKKVILDKINDVRDHVAKG 80
            DYC + +   G H  C    S   S +C G+  ++   T+E KK+I+++ N  R  VA+G
Sbjct  2    DYCKI-KCSSGVHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVEEHNRFRQKVAQG 60
Query  81   --SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAY-KCRHTLRFWSPGQLNFEF 133
              + G     P AS M  +VW++E A +A+     C    + KCR+T ++     + +  
Sbjct  61   LETRGNPGPQPAASNMNNLVWNDEQAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAG 120
Query  134  YADKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELALAISDRVTAVGCG 193
             ++  PS   LI   +     +  N    I  K       G V      +      VGCG
Sbjct  121  SSNHFPSVTKLIQ--LWENEVKDFNYNTGITNKN-----FGKVGHYTQMVWGNTKEVGCG 173
Query  194  LTTWKLGGKARALLTCNFSSENDY-NRPVY 222
               +         L CN+    +Y  +P+Y
Sbjct  174  SLKYVEKNMKIHYLICNYGPAGNYLGQPIY 203

Sequence Alignment: 22. Allergen Name: Ves g 5 Sequence ID: P35784

 Score = 48.5 bits 185,  Expect = 2e-07
 Identities = 56/187 29%, Positives = 88/187 47%, Gaps = 28/187 14%
Query  25   DYCSL-CRGGRGEHVGCGSPGFSSDCG-QKARTRKFTKEHKKVILDKINDVRDHVAKG-- 80
            +YC + C  G G H  C    +  +C  +K     +TK+ K+ IL + ND R  +A+G  
Sbjct  2    NYCKIKCLKG-GVHTACKYESLKPNCANKKVVAYGLTKQEKQDILKEHNDFRQKIARGLE 60
Query  81   SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRHTLRFWSPGQLNFEFYAD 136
            + G     P A  MK +VW +ELA +A+     C      CR   ++  P   N  +   
Sbjct  61   TRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKY--PVGQNVALTG- 117
Query  137  KMPSTMSLISTAIKRGHTQKH-NITRDIIEKYQPAGPKGNVKELALA-ISDRVTA----V 190
                     STA K  +  K   +  D ++ Y P         L +   +  V A    V
Sbjct  118  ---------STAAKYDNPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEV 168
Query  191  GCGLTTWKLGGKARALLTCNFSSENDY-NRPVYKT 224
            GCG   +      +  L CN+    ++ N  +Y+T
Sbjct  169  GCGSIKYIQDKWHKHYLVCNYGPSGNFGNEELYQT 203

Sequence Alignment: 23. Allergen Name: Sol r 3 Sequence ID: P35779

 Score = 48.3 bits 184,  Expect = 3e-07
 Identities = 53/179 29%, Positives = 84/179 46%, Gaps = 23/179 12%
Query  25   DYCSL--CRGGRGEHVGCG--SPGFSSDCGQKARTRKFTKEHKKVILDKINDVRDHVA-- 78
            +YC+L  C+     H  C   SP     C + +    FT   K  I++K N++R  VA  
Sbjct  2    NYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNV-GFTDAEKDAIVNKHNELRQRVASG 60
Query  79   ---KGSWG-LPVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRHTLRFWSPGQLNFEFY 134
               +G+ G  P A +M  + WD ELA +A+R    C  E   CR+  RF     +     
Sbjct  61   KEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATSS 120
Query  135  ADKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPK-GN----VKELALAISDRVTA 189
            + K  ST+S +           +N  +D   ++  + P  GN    V      +  +   
Sbjct  121  SGKNKSTLSDMILLW-------YNEVKDFDNRWISSFPSDGNILMHVGHYTQIVWAKTKK 173
Query  190  VGCGLTTWKLGGKARALLTCNF 211
            +GCG   +K     +  L CN+
Sbjct  174  IGCGRIMFKEDNWNKHYLVCNY 195

Sequence Alignment: 24. Allergen Name: Vesp v 5.0101 Sequence ID: P0DMB9

 Score = 48.0 bits 183,  Expect = 3e-07
 Identities = 56/183 30%, Positives = 95/183 51%, Gaps = 32/183 17%
Query  25   DYCSL-CRGGRGEHVGCGSPGFSS--DCGQKA-RTRKFTKEHKKVILDKINDVRDHVAKG 80
            +YC + CR G   H  C   G S+  +CG+   +   +TK  K  IL + N+ R  VA+G
Sbjct  2    NYCKIKCRSGI--HTLC-KYGTSTKPNCGRSVVKASGLTKAEKLEILKQHNEFRQKVARG 58
Query  81   --SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRHTLRFWSPGQLNFEFY 134
              + G     P A  M  +VW++ELA +A+     C      CR+T ++   GQ N    
Sbjct  59   LETRGNPGPQPPAKSMNTLVWNDELAQIAQVWASQCKYGHDNCRNTAKYLV-GQ-NI--- 113
Query  135  ADKMPSTMSL--ISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELA---LAISDRVTA 189
            A++  +  S+  +S  +K        +  D ++ YQ    K  + ++      +  +   
Sbjct  114  AEQSTTAASFEPVSNMVK--------MWSDEVKDYQYGSSKNKLNDVGHYTQMVWAKTKE 165
Query  190  VGCGLTTWKLGGKARALLTCNFSSENDY-NRPVYK 223
            +GCG   +   G     L CN+    +  N P+Y+
Sbjct  166  IGCGNIKYIENGWHHHYLVCNYGPAGNIGNEPIYE 200

Sequence Alignment: 25. Allergen Name: Ves s 5 Sequence ID: P35786

 Score = 47.4 bits 180,  Expect = 5e-07
 Identities = 51/192 26%, Positives = 88/192 45%, Gaps = 19/192 9%
Query  24   LDYCSL-CRGGRGEHVGCGSPGFSS--DCGQKA-RTRKFTKEHKKVILDKINDVRDHVAK 79
            +DYC + C  G G H  C   G S+  +CG    ++   T+  K+ IL   ND R+ VA+
Sbjct  1    VDYCKIKCLKG-GVHTAC-KYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVAR 58
Query  80   G--SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRHTLRFWSPGQLNFEF 133
            G  + G     P A  M  +VW+ ELA +A+     C      C+ T ++ + GQ N   
Sbjct  59   GLETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKY-NVGQ-NIAV 116
Query  134  YADKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELALAISDRVTAVGCG 193
             +    +    +   +K    +  +    I  +       G+  ++  A   +   +GCG
Sbjct  117  -SSSTAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWA---KTKEIGCG 172
Query  194  LTTWKLGGKARALLTCNFSSENDY-NRPVYK 223
               +         L CN+    ++ N+ VY+
Sbjct  173  SIKYVDNNWYTHYLVCNYGPAGNFGNQEVYE 203

Sequence Alignment: 26. Allergen Name: Pol e 5.0101 Sequence ID: AAT95009

 Score = 47.2 bits 179,  Expect = 6e-07
 Identities = 61/197 30%, Positives = 101/197 51%, Gaps = 25/197 12%
Query  11   LVVLVLQCSVINS---LDYCSLCRGGRGEHVGCG---SPGFSSDC-GQKARTRKFTKEHK 63
            LV LV+  ++I+S   +DYC + R   G H  C    S   S +C G+  ++   T+E K
Sbjct  6    LVYLVIVVAIIHSSQGVDYCKI-RCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEK 64
Query  64   KVILDKINDVRDHVAKG--SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAY-K 116
            K+I+ + N  R  VA+G  + G     P AS M  +VW++ELA +A+     C    + K
Sbjct  65   KLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDK 124
Query  117  CRHTLRFWSPGQLNFEFYA-DKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGN 175
            CR+T ++  P   N  +    K+P  +SLI   +     +  N    I +  Q     G+
Sbjct  125  CRNTAKY--PVGQNIAYAGGSKLPDVVSLIK--LWENEVKDFNYNTGITK--QNFAKIGH 178
Query  176  VKELALAISDRVTAVGCGLTTWKLGGKARALLTCNFSSENDY 217
              ++   +  +   +GCG   +         L CN+    +Y
Sbjct  179  YTQM---VWGKTKEIGCGSLKYMENKMQNHYLICNYGPAGNY 217

Sequence Alignment: 27. Allergen Name: Pol e 5.0101 Sequence ID: P35759

 Score = 47.0 bits 178,  Expect = 6e-07
 Identities = 54/184 29%, Positives = 91/184 49%, Gaps = 22/184 11%
Query  24   LDYCSLCRGGRGEHVGCG---SPGFSSDC-GQKARTRKFTKEHKKVILDKINDVRDHVAK 79
            +DYC + +   G H  C    S   S +C G+  ++   T+E KK+I+ + N  R  VA+
Sbjct  1    VDYCKI-KCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQ 59
Query  80   G--SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAY-KCRHTLRFWSPGQLNFE 132
            G  + G     P AS M  +VW++ELA +A+     C    + KCR+T ++  P   N  
Sbjct  60   GLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKY--PVGQNIA 117
Query  133  FYA-DKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELALAISDRVTAVG 191
            +    K+P  +SLI   +     +  N    I +  Q     G+  ++   +  +   +G
Sbjct  118  YAGGSKLPDVVSLIK--LWENEVKDFNYNTGITK--QNFAKIGHYTQM---VWGKTKEIG 170
Query  192  CGLTTWKLGGKARALLTCNFSSENDY 217
            CG   +         L CN+    +Y
Sbjct  171  CGSLKYIENKMQNHYLICNYGPAGNY 196

Sequence Alignment: 28. Allergen Name: Poly p 5.0102 Sequence ID: P86686

 Score = 47.0 bits 178,  Expect = 6e-07
 Identities = 51/176 28%, Positives = 84/176 47%, Gaps = 24/176 13%
Query  26   YCSLCRGGRGEHVGCGS-----PGFSSDCGQKARTR-KFTKEHKKVILDKINDVRDHVAK 79
            YC++ +  +  H  C +     P  S +C + + T    T+E KK+I+D+ N  R  VA+
Sbjct  3    YCNI-KCSKVAHTVCQTGESTKPS-SKNCAKVSITSVGVTEEEKKLIVDEHNRFRQKVAQ 60
Query  80   G--SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAY-KCRHTLRFWSPGQLNFE 132
            G  + G     P AS M  +VW++ELA +A+     C    + KCR+T ++     + + 
Sbjct  61   GLETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFVHDKCRNTAQYQVGQNIAYS 120
Query  133  FYADKMPSTMSLISTAIKRGHTQKHNITRDII-EKYQPAGPKGNVKELALAISDRVTAVG 191
                  P  + LI   +     +  N    I  E +   G    V      +  +   VG
Sbjct  121  ASTAAYPGVVKLI--VLWENEVKDFNYNTGITKENFAKVGHYTQV------VWAKTKEVG 172
Query  192  CGLTTWKLGGKARALLTCNF 211
            CG   +   G     L CN+
Sbjct  173  CGSIKYIEKGMKSHYLVCNY 192

Sequence Alignment: 29. Allergen Name: Sol i 3 Sequence ID: P35778

 Score = 46.6 bits 176,  Expect = 9e-07
 Identities = 58/212 27%, Positives = 96/212 45%, Gaps = 25/212 11%
Query  4    IIVPCLLLVVLVLQCSVINSLDYCSL--CRGGRGEHVGCG--SPGFSSDCGQKARTRKFT 59
            +IV  L L +     +   + +YC+L  C+     H  C   SP     C + +    FT
Sbjct  3    LIVSILWLAITAENLANTLATNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNV-GFT 61
Query  60   KEHKKVILDKINDVRDHVA-----KGSWG-LPVASRMKVIVWDEELAALAKRHTQGCVPE 113
               K  I++K N++R  VA     +G+ G  P A +M  + WD ELA +A+R    C  E
Sbjct  62   DAEKDAIVNKHNELRQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFE 121
Query  114  AYKCRHTLRFWSPGQLNFEFYADKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPK 173
               CR+  RF     +     + K  ST + +           +N  +D   ++  + P 
Sbjct  122  HDACRNVERFAVGQNIAATSSSGKNKSTPNEMIL-------LWYNEVKDFDNRWISSFPS 174
Query  174  GN-----VKELALAISDRVTAVGCGLTTWKLGGK-ARALLTCNFSSE-NDYNRPVYK 223
             +     V      +  + T +GCG   +K      +  L CN+    N    P+Y+
Sbjct  175  DDNILMKVGHYTQIVWAKTTKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYE 231

Sequence Alignment: 30. Allergen Name: Pol a 5 Sequence ID: Q05109

 Score = 46.4 bits 175,  Expect = 1e-06
 Identities = 53/184 28%, Positives = 90/184 48%, Gaps = 22/184 11%
Query  24   LDYCSLCRGGRGEHVGCG---SPGFSSDC-GQKARTRKFTKEHKKVILDKINDVRDHVAK 79
            +DYC + +   G H  C    S   S +C G+  ++   T+E KK+I+ + N  R  VA+
Sbjct  5    VDYCKI-KCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQ 63
Query  80   G--SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAY-KCRHTLRFWSPGQLNFE 132
            G  + G     P AS M  +VW++ELA +A+     C    + KCR+T ++  P   N  
Sbjct  64   GLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKY--PVGQNIA 121
Query  133  FYA-DKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELALAISDRVTAVG 191
            +     +P  +SLI   +     +  N    I +  Q     G+  ++   +  +   +G
Sbjct  122  YAGGSNLPDVVSLIK--LWENEVKDFNYNTGITK--QNFAKIGHYTQM---VWGKTKEIG 174
Query  192  CGLTTWKLGGKARALLTCNFSSENDY 217
            CG   +         L CN+    +Y
Sbjct  175  CGSLKYMENNMQNHYLICNYGPAGNY 200

Sequence Alignment: 31. Allergen Name: Ves vi 5 Sequence ID: P35787

 Score = 45.3 bits 170,  Expect = 2e-06
 Identities = 53/189 28%, Positives = 92/189 48%, Gaps = 25/189 13%
Query  24   LDYCSL-CRGGRGEHVGCGSPGFSS--DCGQKA-RTRKFTKEHKKVILDKINDVRDHVAK 79
            ++YC + C  G G H  C   G S+  +CG+   +   +T+  K+ IL   ND R  VAK
Sbjct  2    VNYCKIKCLKG-GVHTAC-KYGTSTKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAK 59
Query  80   G--SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRHTLRFWSPGQLNFEF 133
            G  + G     P A  M  +VW++ELA +A+     C      C+ T ++  P   N   
Sbjct  60   GLETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKY--PVGQNIA- 116
Query  134  YADKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELA---LAISDRVTAV 190
               K  +T +L  +  K     ++ + +D     + +  K N+K+       +  +   +
Sbjct  117  ---KRSTTAALFDSPGKLVKMWENEV-KDFNPNIEWS--KNNLKKTGHYTQMVWAKTKEI 170
Query  191  GCGLTTWKLGGKARALLTCNFSSENDY-NRPVYK 223
            GCG   +         L CN+    ++ N  +Y+
Sbjct  171  GCGSVKYVKDEWYTHYLVCNYGPSGNFRNEKLYE 204

Sequence Alignment: 32. Allergen Name: Sol s 3.0101 Sequence ID: ABC58726

 Score = 32.4 bits 109,  Expect = 0.007
 Identities = 29/79 36%, Positives = 42/79 53%, Gaps = 11/79 13%
Query  25   DYCSL--CRGGRGEHVGCG--SPGFSSDCGQKARTRKFTKEHKKVILDKINDVRDHVAKG 80
            +YC+L  C+     H  C   SP     C + +    FT   K  I++K N++R  VA G
Sbjct  2    NYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNV-GFTDAEKDAIVNKHNELRQRVASG 60
Query  81   SW--GL----PVASRMKVIVWDEELAALAK 104
                G     P A +M  + WD ELA +A+
Sbjct  61   KEMRGTNSPQPPAVKMPNLTWDPELATIAQ 90

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.