The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAPKKPDPKKDEAKAGAKAAAAPAPAPAPPPAPEPSKEPEFDPSKIKIEFTPEQIEEFKE
AFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNSKMMDFDTFLP
MLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKLTEDEVEKLMAGQ
EDSNGCINYEAFVKHIMAG
Sequence Info Allergen Name Length Opt Bits Score E Value
P85100 Bos d 13.0201 199 1337 186.9 3.4e-49
A0JNJ5 Bos d 13.0101 192 922 132.4 8.7e-33
P02604 Gal d 7.0101 192 890 128.2 1.6e-31
AIO08852 Der f 26.0101 160 393 62.8 6.3e-12
A0A514C9K9 Scy p 3.0101 153 381 61.2 1.8e-11
J7HCX7 Pro c 5.0101 153 370 59.8 4.9e-11
A7L499 Art fr 5.0101 144 325 53.9 2.8e-09
QAT18638 Der p 26.0101 121 297 50.2 3.1e-08
D2DGW3 Tyr p 34.0101 153 263 45.7 8.4e-07
ACL36923 Tyr p 24.0101 153 263 45.7 8.4e-07
QBF67841 Der f 39.0101 153 259 45.2 1.2e-06
QXY82447 Der p 39.0101 153 257 45.0 1.5e-06
ABB89298 Bla g 6.0301 154 231 41.5 1.6e-05
ABB89296 Bla g 6.0101 151 218 39.8 5e-05
H6WP59 Per a 8.0101 208 214 39.4 9.5e-05
ABB89297 Bla g 6.0201 151 205 38.1 0.00016
Q1M0Y3 Per a 6.0101 151 204 38.0 0.00018
P29291 Hom a 6.0101 150 184 35.4 0.0011
ADV17344 Pen m 6.0101 150 181 35.0 0.0015
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bos d 13.0201 Sequence ID: P85100

 Score = 186.9 bits 1337,  Expect = 3e-49
 Identities = 199/199 100%, Positives = 199/199 100%, Gaps = 0/199 0%
Query  1    MAPKKPDPKKDEAKAGAKAAAAPAPAPAPPPAPEPSKEPEFDPSKIKIEFTPEQIEEFKE 60
            MAPKKPDPKKDEAKAGAKAAAAPAPAPAPPPAPEPSKEPEFDPSKIKIEFTPEQIEEFKE
Sbjct  1    MAPKKPDPKKDEAKAGAKAAAAPAPAPAPPPAPEPSKEPEFDPSKIKIEFTPEQIEEFKE 60
Query  61   AFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNSKMMDFDTFLP 120
            AFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNSKMMDFDTFLP
Sbjct  61   AFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNSKMMDFDTFLP 120
Query  121  MLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKLTEDEVEKLMAGQ 180
            MLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKLTEDEVEKLMAGQ
Sbjct  121  MLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKLTEDEVEKLMAGQ 180
Query  181  EDSNGCINYEAFVKHIMAG 199
            EDSNGCINYEAFVKHIMAG
Sbjct  181  EDSNGCINYEAFVKHIMAG 199

Sequence Alignment: 2. Allergen Name: Bos d 13.0101 Sequence ID: A0JNJ5

 Score = 132.4 bits 922,  Expect = 9e-33
 Identities = 142/189 75%, Positives = 156/189 82%, Gaps = 2/189 1%
Query  8    PKKDEAKAGAKAAAAPAPAPAPPPAPEPSKEPEFDPSKIKIEFTPEQIEEFKEAFTLFDR 67
            PKKD  K  A AA APAPAPAP PAP P KE + D S IKIEF+ +Q +EFKEAF LFDR
Sbjct  3    PKKDVKKPAAAAAPAPAPAPAPAPAPAPPKEEKIDLSAIKIEFSKQQQDEFKEAFLLFDR 62
Query  68   TPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNSKMMDFDTFLPMLQHISK 127
            T +C  KIT  Q GDVLRALG NPT AEV +VLG P  EE+N+K ++F+ FLPMLQ IS 
Sbjct  63   TGEC--KITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFEQFLPMLQAISN 120
Query  128  NKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKLTEDEVEKLMAGQEDSNGCI 187
            NKD GTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEK+ E+EVE LMAGQEDSNGCI
Sbjct  121  NKDQGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCI 180
Query  188  NYEAFVKHIMA 198
            NYEAFVKHIM+
Sbjct  181  NYEAFVKHIMS 191

Sequence Alignment: 3. Allergen Name: Gal d 7.0101 Sequence ID: P02604

 Score = 128.2 bits 890,  Expect = 2e-31
 Identities = 134/189 70%, Positives = 154/189 81%, Gaps = 2/189 1%
Query  8    PKKDEAKAGAKAAAAPAPAPAPPPAPEPSKEPEFDPSKIKIEFTPEQIEEFKEAFTLFDR 67
            PKKD  K  A AA APAPAPAP PAP   KEP  D   IKIEF+ EQ ++FKEAF LFDR
Sbjct  3    PKKDVKKPAAAAAPAPAPAPAPAPAPAKPKEPAIDLKSIKIEFSKEQQDDFKEAFLLFDR 62
Query  68   TPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNSKMMDFDTFLPMLQHISK 127
            T   + KIT  Q GD++RALGQNPT AE+ ++LG P +EE+N+K + F+ FLPMLQ  + 
Sbjct  63   TG--DAKITLSQVGDIVRALGQNPTNAEINKILGNPSKEEMNAKKITFEEFLPMLQAAAN 120
Query  128  NKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKLTEDEVEKLMAGQEDSNGCI 187
            NKD GT+EDFVEGLRVFDKEGNGTVMGAELRHVLATLGEK+TE+EVE+LM GQEDSNGCI
Sbjct  121  NKDQGTFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMTEEEVEELMKGQEDSNGCI 180
Query  188  NYEAFVKHIMA 198
            NYEAFVKHIM+
Sbjct  181  NYEAFVKHIMS 191

Sequence Alignment: 4. Allergen Name: Der f 26.0101 Sequence ID: AIO08852

 Score = 62.8 bits 393,  Expect = 6e-12
 Identities = 65/146 44%, Positives = 99/146 67%, Gaps = 8/146 5%
Query  49   EFTPEQIEEFKEAFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEEL 108
            ++ P ++E+ +  F ++D   +   K+ Y   GD+LR+L   PTQ  V +  G  K++  
Sbjct  3    DLRPPEVEKARLHFDIYDFDGQS--KVDYHYLGDLLRSLDLRPTQDSVAKN-GWEKKK-- 57
Query  109  NSKMMDFDTFLPMLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKL 168
              K M F+ FLP+  ++ K+KD G +ED+VEGL+V+DK  NGT+M AEL HVL +LGEKL
Sbjct  58   GQKFMTFEEFLPIYSQVKKDKDCGAFEDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKL 117
Query  169  TEDEVEKLM---AGQEDSNGCINYEAFVKHIMAG 199
            T+ EVE+++    G  D  G + YE F+K++MAG
Sbjct  118  TDAEVEEIIKTCGGGCDDEGFMKYETFIKNVMAG 151

Sequence Alignment: 5. Allergen Name: Scy p 3.0101 Sequence ID: A0A514C9K9

 Score = 61.2 bits 381,  Expect = 2e-11
 Identities = 62/143 43%, Positives = 98/143 68%, Gaps = 8/143 5%
Query  49   EFTPEQIEEFKEAFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEEL 108
            +++   +E  K AF+++D   K  M   Y   GD LRAL  NPT A + +V GK K++E 
Sbjct  4    DLSARDVERAKFAFSIYDFEGKGTMDAFY--VGDCLRALNLNPTLAVIEKVGGKTKKKE- 60
Query  109  NSKMMDFDTFLPMLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKL 168
              KM+  D FLP++ ++ K+KD G++EDF+E L+++DK  NGT++ AEL H+L +LGE+L
Sbjct  61   --KMLKVDDFLPIFAQVKKDKDAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGERL 118
Query  169  TEDEVEKLMAG---QEDSNGCINYEAFVKHI 196
             + E+E ++     +ED +G I YE F+K +
Sbjct  119  EKSELEPVLKDCCDEEDEDGFIPYEPFLKKL 149

Sequence Alignment: 6. Allergen Name: Pro c 5.0101 Sequence ID: J7HCX7

 Score = 59.8 bits 370,  Expect = 5e-11
 Identities = 60/143 41%, Positives = 98/143 68%, Gaps = 8/143 5%
Query  49   EFTPEQIEEFKEAFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEEL 108
            +++   +E  K AF+++D      M   Y   GD LRAL  NPT A + +V GK K++E 
Sbjct  4    DLSARDVERVKFAFSIYDFEGNGTMDAFY--IGDCLRALNLNPTLAIIEKVGGKEKRKE- 60
Query  109  NSKMMDFDTFLPMLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKL 168
              K++ ++ F+P++ ++ K+KD G+YEDF+E L+++DK  NGT+M AEL H+L +LGE+L
Sbjct  61   --KIIKLEEFIPIFAQVKKDKDAGSYEDFMEVLKLYDKSENGTMMYAELEHILLSLGERL 118
Query  169  TEDEVEKLMA---GQEDSNGCINYEAFVKHI 196
             + E+E ++     +ED +G I YE F+K +
Sbjct  119  EKSELEPVLKECCNEEDEDGFIPYEPFLKKM 149

Sequence Alignment: 7. Allergen Name: Art fr 5.0101 Sequence ID: A7L499

 Score = 53.9 bits 325,  Expect = 3e-09
 Identities = 52/116 44%, Positives = 77/116 66%, Gaps = 6/116 5%
Query  81   GDVLRALGQNPTQAEVLRVLGKPKQEELNSKMMDFDTFLPMLQHISKNKDTGTYEDFVEG 140
            GD LRAL  NPT A++ ++ G  K+   N K +  + FLP++ ++ K KD GT EDF+E 
Sbjct  20   GDCLRALNLNPTLAQIEKLGGTKKK---NEKKLKVEEFLPIFSQVKKEKDHGTLEDFIEC 76
Query  141  LRVFDKEGNGTVMGAELRHVLATLGEKLTEDEVEKLMA---GQEDSNGCINYEAFVKHIM 197
            ++++DK  NGT+M AEL H+L  LGEKL + +V+ +       ED  G I Y  F+K ++
Sbjct  77   MKLYDKSENGTMMLAELNHILLALGEKLEDSQVDSIFKECMDPEDDEGNIPYTPFLKRLL 136
Query  198  AG 199
            AG
Sbjct  137  AG 138

Sequence Alignment: 8. Allergen Name: Der p 26.0101 Sequence ID: QAT18638

 Score = 50.2 bits 297,  Expect = 3e-08
 Identities = 50/113 44%, Positives = 76/113 67%, Gaps = 5/113 4%
Query  49   EFTPEQIEEFKEAFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEEL 108
            ++ P ++E+ +  F ++D   + + K+ Y   GD+LR+L   PTQ  V +  G  K++  
Sbjct  3    DLRPPEVEKARLHFDIYDF--EGQGKVDYHLLGDLLRSLDLRPTQEMVAKN-GWEKKK-- 57
Query  109  NSKMMDFDTFLPMLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGE 166
              K M F+ FLP+  ++ K+KD G YED+VEGL+V+DK  NGT+M AEL HVL +LGE
Sbjct  58   GQKYMTFEEFLPIYSQVKKDKDCGAYEDLVEGLKVYDKAENGTMMEAELAHVLLSLGE 115

Sequence Alignment: 9. Allergen Name: Tyr p 34.0101 Sequence ID: D2DGW3

 Score = 45.7 bits 263,  Expect = 8e-07
 Identities = 46/146 31%, Positives = 91/146 62%, Gaps = 7/146 4%
Query  49   EFTPEQIEEFKEAFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEEL 108
            E++ EQ++ +++AF +FDR  K  +         +LR LGQ   + ++ +++ +   +  
Sbjct  5    ELSKEQVQMLRKAFDMFDRDKKGYIHTNM--VSTILRTLGQTFEENDLQQLIIEIDAD-- 60
Query  109  NSKMMDFDTFLPMLQHISKNKDT-GTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEK 167
             S  ++FD FL +       +DT    E++ E +R++DKEGNG +  + LR +L  L +K
Sbjct  61   GSGELEFDEFLTLTARFLVEEDTEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDK 120
Query  168  LTEDEVEKLMAGQE-DSNGCINYEAFVKHIMAG 199
            LTEDE+++++A  + D +G ++++ F++ +M G
Sbjct  121  LTEDELDEMIAEIDTDGSGTVDFDEFME-MMTG 152

Sequence Alignment: 10. Allergen Name: Tyr p 24.0101 Sequence ID: ACL36923

 Score = 45.7 bits 263,  Expect = 8e-07
 Identities = 46/146 31%, Positives = 91/146 62%, Gaps = 7/146 4%
Query  49   EFTPEQIEEFKEAFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEEL 108
            E++ EQ++ +++AF +FDR  K  +         +LR LGQ   + ++ +++ +   +  
Sbjct  5    ELSKEQVQMLRKAFDMFDRDKKGYIHTNM--VSTILRTLGQTFEENDLQQLIIEIDAD-- 60
Query  109  NSKMMDFDTFLPMLQHISKNKDT-GTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEK 167
             S  ++FD FL +       +DT    E++ E +R++DKEGNG +  + LR +L  L +K
Sbjct  61   GSGELEFDEFLTLTARFLVEEDTEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDK 120
Query  168  LTEDEVEKLMAGQE-DSNGCINYEAFVKHIMAG 199
            LTEDE+++++A  + D +G ++++ F++ +M G
Sbjct  121  LTEDELDEMIAEIDTDGSGTVDFDEFME-MMTG 152

Sequence Alignment: 11. Allergen Name: Der f 39.0101 Sequence ID: QBF67841

 Score = 45.2 bits 259,  Expect = 1e-06
 Identities = 45/146 30%, Positives = 89/146 60%, Gaps = 7/146 4%
Query  49   EFTPEQIEEFKEAFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEEL 108
            E+T EQ++ +++AF +FDR  K  +         +LR LGQ   + ++ +++ +   +  
Sbjct  5    ELTKEQVQMLRKAFDMFDREKKGHIHTNM--VSTILRTLGQTFEEKDLQQLITEIDAD-- 60
Query  109  NSKMMDFDTFLPMLQHISKNKDT-GTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEK 167
             S  ++FD FL +       +D     E++ E +R++DKEGNG +  + LR +L  L +K
Sbjct  61   GSGELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDK 120
Query  168  LTEDEVEKLMAGQE-DSNGCINYEAFVKHIMAG 199
            LT DE+++++A  + D +G ++++ F++ +M G
Sbjct  121  LTNDELDEMIAEIDTDGSGTVDFDEFME-MMTG 152

Sequence Alignment: 12. Allergen Name: Der p 39.0101 Sequence ID: QXY82447

 Score = 45.0 bits 257,  Expect = 1e-06
 Identities = 45/146 30%, Positives = 88/146 60%, Gaps = 7/146 4%
Query  49   EFTPEQIEEFKEAFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEEL 108
            E+T EQ++ +++AF +FDR  K  +         +LR LGQ   + ++  ++ +   +  
Sbjct  5    ELTKEQVQMLRKAFDMFDREKKGHIHTNM--VSTILRTLGQTFEEKDLQTLITEIDAD-- 60
Query  109  NSKMMDFDTFLPMLQHISKNKDT-GTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEK 167
             S  ++FD FL +       +D     E++ E +R++DKEGNG +  + LR +L  L +K
Sbjct  61   GSGELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDK 120
Query  168  LTEDEVEKLMAGQE-DSNGCINYEAFVKHIMAG 199
            LT DE+++++A  + D +G ++++ F++ +M G
Sbjct  121  LTNDELDEMIAEIDTDGSGTVDFDEFME-MMTG 152

Sequence Alignment: 13. Allergen Name: Bla g 6.0301 Sequence ID: ABB89298

 Score = 41.5 bits 231,  Expect = 2e-05
 Identities = 44/148 29%, Positives = 86/148 58%, Gaps = 7/148 4%
Query  47   KIEFTPEQIEEFKEAFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQE 106
            ++++ PEQI  +++AF  FDR       I+     ++LR +GQ P     L  L      
Sbjct  5    QLQLPPEQISVLRKAFDAFDREKSG--SISTNMVEEILRLMGQ-PFNRRTLEELIDEVDA 61
Query  107  ELNSKMMDFDTFLPMLQHISKNKDTGTYE-DFVEGLRVFDKEGNGTVMGAELRHVLATLG 165
            + + ++ +FD F+ +       +D+   E ++ E +R++DKEGNG +  + LR +L  L 
Sbjct  62   DKSGRL-EFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELD 120
Query  166  EKLTEDEVEKLMAGQE-DSNGCINYEAFVKHIMAG 199
            E+LT DE++ ++   + D +G ++++ F++ +M G
Sbjct  121  EQLTSDELDMMIEEIDADGSGTVDFDEFME-MMTG 154

Sequence Alignment: 14. Allergen Name: Bla g 6.0101 Sequence ID: ABB89296

 Score = 39.8 bits 218,  Expect = 5e-05
 Identities = 41/145 28%, Positives = 84/145 57%, Gaps = 9/145 6%
Query  49   EFTPEQIEEFKEAFTLFDRTPK-CEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEE 107
            E+ PEQI+ +K+AF  FDR  K C   I+    G +L  LG+      +  ++ +   + 
Sbjct  3    ELPPEQIQLLKKAFDAFDREKKGC---ISTEMVGTILEMLGHRLDDDMLQEIIAEVDAD- 58
Query  108  LNSKMMDFDTFLPMLQHISKNKDT-GTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGE 166
              S  ++F+ F+ +       +D     +++ E +R++DKEGNG +    LR +L  L +
Sbjct  59   -GSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGNGYITTNVLREILKELDD 117
Query  167  KLTEDEVEKLMAGQE-DSNGCINYEAFVKHIMAG 199
            K+T ++++ ++   + D +G ++++ F++ +M G
Sbjct  118  KITAEDLDMMIEEIDSDGSGTVDFDEFME-VMTG 150

Sequence Alignment: 15. Allergen Name: Per a 8.0101 Sequence ID: H6WP59

 Score = 39.4 bits 214,  Expect = 0.0001
 Identities = 60/181 33%, Positives = 96/181 53%, Gaps = 31/181 17%
Query  1    MAPKKPDPKKDEAKAGAKAAAAPAPAPAPPPAPEPSKEPEFDPSKIKIE-------FTPE 53
            MA K+   KK   +    AAA  APA AP PA EP+++      K K         F+ +
Sbjct  1    MADKEKKKKKKAKEEAPAAAAEAAPAAAPAPAAEPNRQSSRGSRKAKRAGSNVFSMFSQK 60
Query  54   QIEEFKEAFTLFDRTP-----KCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEEL 108
            Q+ EFKEAF L D+       K +++ T+ Q G     L  +    E++     P     
Sbjct  61   QVAEFKEAFQLMDQDKDGIISKNDLRATFDQLGR----LAVDKELDEMVNEAPGP----- 111
Query  109  NSKMMDFDTFLPMLQ-HISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEK 167
                ++F  +L ++   +S   D    E  +  ++ FD EG   +   +LRH L T G+K
Sbjct  112  ----INFTQLLTLFAGRMSGGSDDD--EVVIAAFKSFDDEGK--IDSEKLRHALMTWGDK 163
Query  168  LTEDEVEKLMAGQE-DSNGCINYEAFVKHIMA 198
            ++ +EV+      E D  G IN   +++ + A
Sbjct  164  FSGEEVDDAYDNFEIDDKGFINTAKLIQLLTA 195

Sequence Alignment: 16. Allergen Name: Bla g 6.0201 Sequence ID: ABB89297

 Score = 38.1 bits 205,  Expect = 0.0002
 Identities = 41/145 28%, Positives = 81/145 55%, Gaps = 9/145 6%
Query  49   EFTPEQIEEFKEAFTLFDRTPK-CEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEE 107
            E   EQ+  +K+AF  FDR  K C   I+    G +L  LG    Q  +  ++ +   + 
Sbjct  3    EIPAEQVVLLKKAFDAFDREKKGC---ISTEMVGTILEMLGTRLDQDMLDEIIAEVDAD- 58
Query  108  LNSKMMDFDTFLPMLQHISKNKDTGTYE-DFVEGLRVFDKEGNGTVMGAELRHVLATLGE 166
              S  ++F+ F  +       +D    + ++ E +R++DKEGNG +  A LR +L  L +
Sbjct  59   -GSGELEFEEFCTLASRFLVEEDAEAMQHELREAFRLYDKEGNGYITTAVLREILKELDD 117
Query  167  KLTEDEVEKLMAGQE-DSNGCINYEAFVKHIMAG 199
            K+T ++++ ++   + D +G ++++ F++ +M G
Sbjct  118  KITAEDLDMMIEEIDSDGSGTVDFDEFME-VMTG 150

Sequence Alignment: 17. Allergen Name: Per a 6.0101 Sequence ID: Q1M0Y3

 Score = 38.0 bits 204,  Expect = 0.0002
 Identities = 41/146 28%, Positives = 81/146 55%, Gaps = 7/146 4%
Query  49   EFTPEQIEEFKEAFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEEL 108
            E+  EQI+ +K+AF  FDR       I+    G +L  LG+ P   ++L  +      + 
Sbjct  3    ELPDEQIQLLKKAFDAFDREKNGF--ISTDMVGTILEMLGH-PLDDDMLEEIIAEVDAD- 58
Query  109  NSKMMDFDTFLPMLQHISKNKDT-GTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEK 167
             S  ++F  F+ +       +D     +++ E +R++DKEGNG +    LR +L  L +K
Sbjct  59   GSGELEFQEFVTLAARFLVEEDAEAMQQELKEAFRLYDKEGNGYITTTVLREILKELDDK 118
Query  168  LTEDEVEKLMAGQE-DSNGCINYEAFVKHIMAG 199
            LT ++++ ++   + D +G ++++ F++ +M G
Sbjct  119  LTNEDLDAMIEEIDSDGSGTVDFDEFME-VMTG 150

Sequence Alignment: 18. Allergen Name: Hom a 6.0101 Sequence ID: P29291

 Score = 35.4 bits 184,  Expect = 0.001
 Identities = 38/142 26%, Positives = 79/142 55%, Gaps = 7/142 4%
Query  53   EQIEEFKEAFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNSKM 112
            EQ+  +++AF  FD   K    IT    G +LR +G   ++  +  V+ +   +E  S  
Sbjct  7    EQLSALQKAFDSFDTDSKGF--ITPETVGVILRMMGVKISEKNLQEVISET--DEDGSGE 62
Query  113  MDFDTFLPMLQHISKNKDTGTYE-DFVEGLRVFDKEGNGTVMGAELRHVLATLGEKLTED 171
            ++F+ F+ +       +D    + ++ E +RV+D+ GNG +    L+ +L  L  +LTE+
Sbjct  63   LEFEEFVELAAKFLIEEDEEALKAELREAFRVYDRGGNGYITTDVLKEILRELDNRLTEE 122
Query  172  EVEKLMAG-QEDSNGCINYEAFVKHIMAG 199
            +++ ++    ED +G +++  F++ +M G
Sbjct  123  DLDSIIEEVDEDGSGTLDFNEFMQ-MMNG 150

Sequence Alignment: 19. Allergen Name: Pen m 6.0101 Sequence ID: ADV17344

 Score = 35.0 bits 181,  Expect = 0.001
 Identities = 38/142 26%, Positives = 78/142 54%, Gaps = 7/142 4%
Query  53   EQIEEFKEAFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNSKM 112
            EQIE +++AF  FD   +    I     G +LR +G   ++  +  V+ +   +E  S M
Sbjct  7    EQIETLRKAFNSFDT--EGAGSINAETVGVILRMMGVKISEKNLQEVIAET--DEDGSGM 62
Query  113  MDFDTFLPMLQHISKNKDTGTYE-DFVEGLRVFDKEGNGTVMGAELRHVLATLGEKLTED 171
            ++F+ F  +       +D    + ++ E +R++DK+  G +    L+ +L  L  KLT  
Sbjct  63   LEFEEFAELAAKFLIEEDEEALKAELREAFRIYDKDCQGYITTDILKEILVELDPKLTPT 122
Query  172  EVEKLMAG-QEDSNGCINYEAFVKHIMAG 199
            ++E ++    ED +G ++++ F++ +M+G
Sbjct  123  DLEGIIEEVDEDGSGTLDFDEFME-MMSG 150

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.