The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKL
LAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVKF
Sequence Info Allergen Name Length Opt Bits Score E Value
A0AT29 Len c 3.0101 118 799 129.1 3e-32
A0A161AT60 Pis s 3.0101 120 651 107.1 1.3e-25
ADC80503 Pha v 3.0201 118 510 86.1 2.8e-19
ABX56711 Ara h 9.0101 116 488 82.8 2.7e-18
XP_019446786 Lup an 3.0101 116 473 80.5 1.3e-17
ABY21307 Pla or 3.0101 118 466 79.5 2.7e-17
CAL07989 Pla a 3.0101 118 462 78.9 4e-17
AAB42069 Lyc e 3 114 461 78.7 4.3e-17
P93224 Sola l 3.0101 114 461 78.7 4.3e-17
AAL25839 Hev b 12 116 457 78.1 6.6e-17
Q4PLT9 Fra a 3.0102 117 454 77.7 9.1e-17
Q9M5X8 Pru av 3 117 453 77.6 1e-16
Q8VX12 Fra a 3.0101 117 452 77.4 1.1e-16
ABX75045 Ara h 9.0201 92 443 76.0 2.3e-16
ADC80502 Pha v 3.0101 115 440 75.6 3.8e-16
Q4PLT6 Fra a 3.0202 117 440 75.6 3.9e-16
AAK28533 Cor a 8 115 437 75.2 5.2e-16
Q0Z8V0 Rub i 3.0101 117 436 75.0 5.9e-16
Q9M5X7 Mal d 3 115 433 74.6 7.9e-16
Q9M5X6 Pyr c 3 115 431 74.3 9.7e-16
Q4PLU0 Fra a 3.0201 117 431 74.3 9.8e-16
ACN11576 Pru du 3.0101 123 429 74.0 1.3e-15
A0A059ST23 Pun g 1.0301 120 427 73.7 1.5e-15
ANC85023 Art gm 3.0102 117 425 73.4 1.8e-15
ANC85018 Art an 3.0102 117 425 73.4 1.8e-15
A0A059SSZ0 Pun g 1.0201 120 425 73.4 1.9e-15
QIN55516 Art ca 3.0102 117 423 73.1 2.2e-15
P19656-1 Zea m 14.0101 120 423 73.1 2.3e-15
ANC85022 Art gm 3.0101 117 420 72.6 3.1e-15
P19656-2 Zea m 14.0102 128 419 72.5 3.7e-15
P81651 Pru ar 3 91 415 71.8 4.2e-15
ANC85021 Art ca 3.0101 117 415 71.9 5.1e-15
ANC85017 Art an 3.0101 117 415 71.9 5.1e-15
A0A059STC4 Pun g 1.0101 120 413 71.6 6.4e-15
AAA32970 Hor v 1 117 411 71.3 7.8e-15
P82534 Pru d 3 91 409 70.9 7.8e-15
CAB96876 Pru p 3 91 409 70.9 7.8e-15
P81402 Pru p 3 91 407 70.6 9.6e-15
CAA42832 Hor v 1 134 408 70.9 1.2e-14
ANC85025 Art la 3.0102 115 402 69.9 1.9e-14
EU564847 Art v 3.0301 117 400 69.7 2.4e-14
ANC85027 Art si 3.0102 116 398 69.4 3e-14
ACE07187 Art v 3.0202 116 398 69.4 3e-14
ANC85020 Art ar 3.0102 116 398 69.4 3e-14
EU564845 Art v 3.0201 114 389 68.0 7.4e-14
ANC85024 Art la 3.0101 116 389 68.0 7.5e-14
ANC85019 Art ar 3.0101 116 389 68.0 7.5e-14
ACV04796 Api g 2 118 389 68.0 7.6e-14
ANC85026 Art si 3.0101 116 386 67.6 1e-13
P85894 Mor n 3.0101 91 382 66.9 1.3e-13
A0A510A9S3 Ara h 17.0101 93 374 65.7 3e-13
CAH69206 Tri tu 14.0101 115 369 65.0 5.9e-13
W0U0V5 Can s 3.0101 91 367 64.7 6e-13
19846220 Tri a 14.0101 90 365 64.4 7.3e-13
ABU95411 Sin a 3.0101 92 352 62.4 2.8e-12
NP_001316123 Sola l 7.0101 115 338 60.4 1.4e-11
P82007 Hel a 3.0101 116 335 60.0 2e-11
P55958 Par j 2 133 218 42.6 4e-06
O04403 Par j 2 133 215 42.1 5.4e-06
Q40905 Par j 1 138 209 41.2 1e-05
P43217 Par j 1 139 201 40.0 2.4e-05
CAI94601 Par j 1.0103 139 197 39.4 3.6e-05
O04404 Par j 1 176 192 38.8 7.3e-05
O04004 Amb a 6 118 187 37.9 8.8e-05
CAA54587 Par j 1.0101 133 180 36.9 0.0002
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Len c 3.0101 Sequence ID: A0AT29

 Score = 129.1 bits 799,  Expect = 3e-32
 Identities = 118/118 100%, Positives = 118/118 100%, Gaps = 0/118 0%
Query  1    MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKL 60
            MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKL
Sbjct  1    MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKL 60
Query  61   LAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVKF 118
            LAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVKF
Sbjct  61   LAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVKF 118

Sequence Alignment: 2. Allergen Name: Pis s 3.0101 Sequence ID: A0A161AT60

 Score = 107.1 bits 651,  Expect = 1e-25
 Identities = 95/118 80%, Positives = 104/118 88%, Gaps = 2/118 1%
Query  1    MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTG--GPGPSPQCCGGVK 58
            MAR MKLACV LVICMVVIAPMAE A+SCG V++D++PC+TYL       P P CC GVK
Sbjct  1    MARSMKLACVALVICMVVIAPMAEAALSCGTVSADMAPCVTYLQAPNNASPPPPCCAGVK 60
Query  59   KLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVKF 118
            KLLAAA TTPDRQAACNCLKSAAGSI KLNTNNAAALPGKCGV+IPYKIST+TNCNTV+F
Sbjct  61   KLLAAATTTPDRQAACNCLKSAAGSIPKLNTNNAAALPGKCGVSIPYKISTSTNCNTVRF 120

Sequence Alignment: 3. Allergen Name: Pha v 3.0201 Sequence ID: ADC80503

 Score = 86.1 bits 510,  Expect = 3e-19
 Identities = 76/110 69%, Positives = 89/110 80%, Gaps = 3/110 2%
Query  8    ACVVLVICMVVI-APMAEGAISCGAVTSDLSPCLTYLT-GGPGPSPQCCGGVKKLLAAAN 65
            ACVV V+C+VV+ AP A  AISCG VTS L+ C+ +LT GGP P+  CC GV+ L AAA 
Sbjct  7    ACVVAVLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGGPVPA-SCCSGVRSLNAAAK 65
Query  66   TTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVKF 118
            TTPDRQA CNCLKSAAG+I  +N NNA  LPGKCGV+IPYKIST+TNC T+KF
Sbjct  66   TTPDRQAVCNCLKSAAGAIPGFNANNAGILPGKCGVSIPYKISTSTNCATIKF 118

Sequence Alignment: 4. Allergen Name: Ara h 9.0101 Sequence ID: ABX56711

 Score = 82.8 bits 488,  Expect = 3e-18
 Identities = 73/112 65%, Positives = 88/112 78%, Gaps = 3/112 2%
Query  5    MKLACVVLVICMVVI-APMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAA 63
            +K+A V+LV CM ++ APM   AISCG V S L+PC+ +LT G  P P CC GV+ LL A
Sbjct  4    LKFAFVMLV-CMAMVGAPMVN-AISCGQVNSALAPCIPFLTKGGAPPPACCSGVRGLLGA 61
Query  64   ANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVKF 118
              TT DRQAACNCLK+AAGS+  LN  NAAALPG+CGV+IPYKIST+TNC T+KF
Sbjct  62   LRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGVSIPYKISTSTNCATIKF 116

Sequence Alignment: 5. Allergen Name: Lup an 3.0101 Sequence ID: XP_019446786

 Score = 80.5 bits 473,  Expect = 1e-17
 Identities = 72/114 63%, Positives = 92/114 80%, Gaps = 5/114 4%
Query  1    MARGMKLACVVLVICMVVI-APMAEGAISCGAVTSDLSPCLTYL-TGGPGPSPQCCGGVK 58
            MA  +KLAC VL ICMVV+ AP+ + AI+CG VT++L+ CL YL +GG  P+P CC G+K
Sbjct  1    MAGIVKLACAVL-ICMVVVSAPLTK-AITCGQVTANLAQCLNYLRSGGAVPAP-CCNGIK 57
Query  59   KLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
             +L  A TTPDR+ ACNCLK+AA +   LN +NA +LPGKCGVNIPYKIST+TNC ++K
Sbjct  58   NILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGVNIPYKISTSTNCASIK 116

Sequence Alignment: 6. Allergen Name: Pla or 3.0101 Sequence ID: ABY21307

 Score = 79.5 bits 466,  Expect = 3e-17
 Identities = 68/115 59%, Positives = 83/115 72%, Gaps = 1/115 0%
Query  2    ARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLL 61
            +R  KLAC++L  CMV  AP AE AI+CG V + L+PCLTYL  G   +P CC GVK L 
Sbjct  4    SRVAKLACLLLA-CMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALN 62
Query  62   AAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
              A TTPDRQAAC CLK+A+ SI+ +   NAA+L GKCGVN+PYKIS T +C+ VK
Sbjct  63   NDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118

Sequence Alignment: 7. Allergen Name: Pla a 3.0101 Sequence ID: CAL07989

 Score = 78.9 bits 462,  Expect = 4e-17
 Identities = 67/115 58%, Positives = 83/115 72%, Gaps = 1/115 0%
Query  2    ARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLL 61
            +R  KLAC++L  CMV  AP AE AI+CG V + L+PCLT+L  G   +P CC GVK L 
Sbjct  4    SRVAKLACLLLA-CMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAVAPACCNGVKALN 62
Query  62   AAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
              A TTPDRQAAC CLK+A+ SI+ +   NAA+L GKCGVN+PYKIS T +C+ VK
Sbjct  63   NDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118

Sequence Alignment: 8. Allergen Name: Lyc e 3 Sequence ID: AAB42069

 Score = 78.7 bits 461,  Expect = 4e-17
 Identities = 71/109 65%, Positives = 83/109 76%, Gaps = 3/109 2%
Query  6    KLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAAN 65
            K+AC V V CMVV+AP AE ++SCG VTS L+PCL YL G  GP   CCGGVK LL AA 
Sbjct  6    KIACFV-VFCMVVVAPHAE-SLSCGEVTSGLAPCLPYLEGR-GPLGGCCGGVKGLLGAAK 62
Query  66   TTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            T  DR+ AC CLKSAA SI  ++T  AA LPG CGVNIPYKIS +T+C+TV+
Sbjct  63   TPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114

Sequence Alignment: 9. Allergen Name: Sola l 3.0101 Sequence ID: P93224

 Score = 78.7 bits 461,  Expect = 4e-17
 Identities = 71/109 65%, Positives = 83/109 76%, Gaps = 3/109 2%
Query  6    KLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAAN 65
            K+AC V V CMVV+AP AE ++SCG VTS L+PCL YL G  GP   CCGGVK LL AA 
Sbjct  6    KIACFV-VFCMVVVAPHAE-SLSCGEVTSGLAPCLPYLEGR-GPLGGCCGGVKGLLGAAK 62
Query  66   TTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            T  DR+ AC CLKSAA SI  ++T  AA LPG CGVNIPYKIS +T+C+TV+
Sbjct  63   TPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114

Sequence Alignment: 10. Allergen Name: Hev b 12 Sequence ID: AAL25839

 Score = 78.1 bits 457,  Expect = 7e-17
 Identities = 67/106 63%, Positives = 76/106 71%, Gaps = 1/106 0%
Query  12   LVICMVVIAPMAEGAISCGAVTSDLSPCLTYL-TGGPGPSPQCCGGVKKLLAAANTTPDR 70
            LV+CM+V APM   AI+CG V S L PCL+YL T GP P   CC GV+ +  AA TT DR
Sbjct  10   LVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPATCCNGVRTINNAAKTTADR 69
Query  71   QAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            + AC CLKSAAGS+  LN    A LPGKCGVNIPYKIS +TNC TVK
Sbjct  70   RTACQCLKSAAGSVKGLNPTTVAGLPGKCGVNIPYKISLSTNCATVK 116

Sequence Alignment: 11. Allergen Name: Fra a 3.0102 Sequence ID: Q4PLT9

 Score = 77.7 bits 454,  Expect = 9e-17
 Identities = 69/110 62%, Positives = 85/110 77%, Gaps = 4/110 3%
Query  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYL-TGGPGPSPQCCGGVKKLLAA 63
            MKL+ V L +C+VV  P+A+ AI+CG V S++SPC+TY+ +GG  P+P CC G++ L   
Sbjct  7    MKLSLVAL-LCIVVALPIAQ-AITCGQVASNISPCVTYVKSGGAVPAP-CCSGIRNLNGM 63
Query  64   ANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            A TT DRQA CNCLK AAG I  LN N AA LPGKCGV++PYKISTTTNC  VK
Sbjct  64   AKTTADRQATCNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAVK 117

Sequence Alignment: 12. Allergen Name: Pru av 3 Sequence ID: Q9M5X8

 Score = 77.6 bits 453,  Expect = 1e-16
 Identities = 64/110 58%, Positives = 82/110 74%, Gaps = 2/110 1%
Query  6    KLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAAN 65
            KLA VV  +CMVV  P+A+ A++CG V+S+L+PC+ Y+ GG    P CC G++ +   A 
Sbjct  8    KLALVV-ALCMVVSVPIAQ-ALTCGQVSSNLAPCIAYVRGGGAVPPACCNGIRNINNLAK 65
Query  66   TTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            TT DRQ ACNCLK  + S+  +N NNAAALPGKCGVN+PYKIS +TNC TVK
Sbjct  66   TTADRQTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATVK 117

Sequence Alignment: 13. Allergen Name: Fra a 3.0101 Sequence ID: Q8VX12

 Score = 77.4 bits 452,  Expect = 1e-16
 Identities = 68/111 61%, Positives = 81/111 72%, Gaps = 2/111 1%
Query  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAA 64
            MKL+ V L +C+VV  P+A+ AI+CG V S++SPCLTY+  G      CC G++ L   A
Sbjct  7    MKLSLVAL-LCIVVALPIAQ-AITCGQVASNISPCLTYVKSGGAVPAACCSGIRNLNGMA 64
Query  65   NTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
             TT DRQAACNCLK AAG I  LN N AA LPGKCGV++PYKISTTTNC  VK
Sbjct  65   KTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAVK 117

Sequence Alignment: 14. Allergen Name: Ara h 9.0201 Sequence ID: ABX75045

 Score = 76.0 bits 443,  Expect = 2e-16
 Identities = 63/92 68%, Positives = 74/92 80%, Gaps = 0/92 0%
Query  27   ISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITK 86
            +SCG V S L+PC+T+LT G  PS  CC GV+ LL AA TT DRQAACNCLK+AAGS+  
Sbjct  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
Query  87   LNTNNAAALPGKCGVNIPYKISTTTNCNTVKF 118
            LN  NAAALPG+CGV+IPYKIST+TNC T+KF
Sbjct  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIKF 92

Sequence Alignment: 15. Allergen Name: Pha v 3.0101 Sequence ID: ADC80502

 Score = 75.6 bits 440,  Expect = 4e-16
 Identities = 62/110 56%, Positives = 83/110 75%, Gaps = 3/110 2%
Query  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQ-CCGGVKKLLAA 63
            +K+ACVV V+CMVV+       ++CG V S+L PC+T+L  G G  P  CC GV+ ++ +
Sbjct  4    VKFACVV-VLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNG-GFVPAGCCNGVRNIMNS 61
Query  64   ANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTV 116
            A +T DR+  CNCLK+AAG++  LN NNA ALPGKCGVNIPYKIST+TNC ++
Sbjct  62   ARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114

Sequence Alignment: 16. Allergen Name: Fra a 3.0202 Sequence ID: Q4PLT6

 Score = 75.6 bits 440,  Expect = 4e-16
 Identities = 66/114 57%, Positives = 86/114 75%, Gaps = 4/114 3%
Query  1    MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYL-TGGPGPSPQCCGGVKK 59
            ++  MKL+ V L +C+VV  P+A+ AI+CG V S +SPC+ Y+ +GG  P+  CC G++ 
Sbjct  3    ISTAMKLSLVAL-LCIVVALPIAQ-AITCGQVASSISPCVNYVKSGGAVPAA-CCNGIRS 59
Query  60   LLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            L +AA TT DRQ  CNCLK A+G+I  LN N AA LPGKCGVN+PYKIST+TNC  VK
Sbjct  60   LNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCGVNVPYKISTSTNCAAVK 117

Sequence Alignment: 17. Allergen Name: Cor a 8 Sequence ID: AAK28533

 Score = 75.2 bits 437,  Expect = 5e-16
 Identities = 62/112 55%, Positives = 78/112 69%, Gaps = 1/112 0%
Query  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAA 64
            +KL C VL +CM+V AP+A  +++C  +  +L+PC+ YL  G    P CC GV+ +  A+
Sbjct  4    LKLVCAVL-LCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDAS 62
Query  65   NTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
             TT DRQ+ACNCLK  A  I  LN N AA LPGKCGVNIPYKIS +TNCN VK
Sbjct  63   RTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115

Sequence Alignment: 18. Allergen Name: Rub i 3.0101 Sequence ID: Q0Z8V0

 Score = 75.0 bits 436,  Expect = 6e-16
 Identities = 65/111 58%, Positives = 82/111 73%, Gaps = 2/111 1%
Query  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAA 64
            MKLA V L +C+VV  P+A+ AI+CG VT +++PC+ Y+  G      CC GV+ L + A
Sbjct  7    MKLALVAL-LCIVVAVPVAQ-AITCGQVTQNVAPCFNYVKNGGAVPAACCNGVRNLNSQA 64
Query  65   NTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
             TT DRQ  CNCLK+AAGSI  LN + AA LPGKCGV++PYKIST+TNC TVK
Sbjct  65   KTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKCGVSVPYKISTSTNCATVK 117

Sequence Alignment: 19. Allergen Name: Mal d 3 Sequence ID: Q9M5X7

 Score = 74.6 bits 433,  Expect = 8e-16
 Identities = 65/108 60%, Positives = 78/108 72%, Gaps = 4/108 3%
Query  6    KLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAAN 65
            KLA VV  +CM V    A   I+CG VTS L+PC+ Y+  G    P CC G++ +   A 
Sbjct  8    KLALVV-ALCMAVSVAHA---ITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLAR 63
Query  66   TTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            TT DRQ ACNCLK+ AGSI+ +N NNAA LPGKCGVN+PYKIST+TNC TVK
Sbjct  64   TTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATVK 115

Sequence Alignment: 20. Allergen Name: Pyr c 3 Sequence ID: Q9M5X6

 Score = 74.3 bits 431,  Expect = 1e-15
 Identities = 62/109 56%, Positives = 80/109 73%, Gaps = 4/109 3%
Query  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAA 64
            +KLA VV  +CM V       AI+C  V+++L+PC+ Y+  G    P CC G+K +   A
Sbjct  7    IKLALVV-ALCMAV---SVAHAITCSQVSANLAPCINYVRSGGAVPPACCNGIKTINGLA 62
Query  65   NTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
             TTPDRQAACNCLK+ AGS++ +N  NA +LPGKCGVN+PYKIST+TNC TVK
Sbjct  63   KTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVNVPYKISTSTNCATVK 115

Sequence Alignment: 21. Allergen Name: Fra a 3.0201 Sequence ID: Q4PLU0

 Score = 74.3 bits 431,  Expect = 1e-15
 Identities = 63/111 56%, Positives = 81/111 72%, Gaps = 2/111 1%
Query  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAA 64
            MKL+ V L +C+VV  P+A+ AI+CG V S +SPC+ Y+  G      CC G++ L +AA
Sbjct  7    MKLSLVAL-LCIVVALPIAQ-AITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSAA 64
Query  65   NTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
             TT DRQA CNCLK A+G+I  LN + AA LPGKCGV++PYKIST+TNC  VK
Sbjct  65   KTTADRQATCNCLKQASGAIKGLNPSLAAGLPGKCGVSVPYKISTSTNCAAVK 117

Sequence Alignment: 22. Allergen Name: Pru du 3.0101 Sequence ID: ACN11576

 Score = 74.0 bits 429,  Expect = 1e-15
 Identities = 61/113 53%, Positives = 77/113 68%, Gaps = 3/113 2%
Query  5    MKLACVVLVIC-MVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAA 63
            +KL C+V V+C M V  P A  A+SCG V ++L+PC+ Y+  G   +P CC GV+ L + 
Sbjct  8    LKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANGGALNPSCCTGVRSLYSL 67
Query  64   ANTTPDRQAACNCLKSAAGSITKLNTNN--AAALPGKCGVNIPYKISTTTNCNTVK 117
            A TT DRQ+ CNCLK A   I   N N   AA LPGKCGVNIPYKIS +T+C T+K
Sbjct  68   AQTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTDCKTIK 123

Sequence Alignment: 23. Allergen Name: Pun g 1.0301 Sequence ID: A0A059ST23

 Score = 73.7 bits 427,  Expect = 2e-15
 Identities = 64/112 57%, Positives = 81/112 72%, Gaps = 3/112 2%
Query  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTG-GPGPSPQ-CCGGVKKLLA 62
            ++LA  VLV CM V + +AE  I+CG V+S L+ C+ Y  G G GP PQ CC G++ L +
Sbjct  7    LRLAGFVLV-CMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNS 65
Query  63   AANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            AA TTPDRQAAC CLKS A SI+ +N    A  PGKCGV+IPYKI+ +TNC+ VK
Sbjct  66   AAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120

Sequence Alignment: 24. Allergen Name: Art gm 3.0102 Sequence ID: ANC85023

 Score = 73.4 bits 425,  Expect = 2e-15
 Identities = 64/111 57%, Positives = 81/111 72%, Gaps = 3/111 2%
Query  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPGPSPQCCGGVKKLLAA 63
            MK+ CV +V+CMVV +  AE A++C  V++ +SPCL++L  GG  P+  CC GVK L  A
Sbjct  6    MKVFCV-MVVCMVVSSSYAEAALTCSDVSNKISPCLSFLKQGGEVPA-DCCTGVKGLNDA 63
Query  64   ANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            A TTPDRQ ACNCLK++  S   L ++NA  LP KCGVNIPYKIS  T+CN VK
Sbjct  64   AKTTPDRQTACNCLKTSFKSNKDLKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 25. Allergen Name: Art an 3.0102 Sequence ID: ANC85018

 Score = 73.4 bits 425,  Expect = 2e-15
 Identities = 65/111 58%, Positives = 78/111 70%, Gaps = 3/111 2%
Query  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSP-QCCGGVKKLLAA 63
            MK+ CV +V+CMVV +  AE A++C  VT  +SPC ++L  G G  P  CC GVK L  A
Sbjct  6    MKVFCV-MVVCMVVTSSYAEAALTCNDVTKKISPCTSFLEKG-GEVPVDCCTGVKGLNDA 63
Query  64   ANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            A TTPDRQAACNCLK++  S   +   NAA LP KCGVNIPYKIS  T+CN VK
Sbjct  64   AKTTPDRQAACNCLKTSFKSSNNFKEENAAVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 26. Allergen Name: Pun g 1.0201 Sequence ID: A0A059SSZ0

 Score = 73.4 bits 425,  Expect = 2e-15
 Identities = 62/106 58%, Positives = 74/106 69%, Gaps = 1/106 0%
Query  12   LVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGG-PGPSPQCCGGVKKLLAAANTTPDR 70
            L +CMVV A + E A++CG VTS L+PC+ Y  G    PS  CC GV+ L  AA TTPDR
Sbjct  14   LFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVAAPSAACCSGVRSLNNAAKTTPDR 73
Query  71   QAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            Q ACNCLK  A SIT +N     ALPGKCGV+IPYKIS +T+C+ VK
Sbjct  74   QTACNCLKVIARSITGINYGRVGALPGKCGVSIPYKISPSTDCSRVK 120

Sequence Alignment: 27. Allergen Name: Art ca 3.0102 Sequence ID: QIN55516

 Score = 73.1 bits 423,  Expect = 2e-15
 Identities = 62/111 55%, Positives = 81/111 72%, Gaps = 3/111 2%
Query  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPGPSPQCCGGVKKLLAA 63
            MK+ CV +++CMVV++  AE A++C  V++ ++PCL++L  GG  P+  CC GVK L  A
Sbjct  6    MKVFCV-MIVCMVVLSSYAEAALTCSDVSNKITPCLSFLKQGGEVPA-DCCTGVKGLNDA 63
Query  64   ANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            A T PDRQ ACNCLK+   S   L ++NA  LP KCGVNIPYKIS  T+CNTVK
Sbjct  64   AKTGPDRQKACNCLKTTFKSNKDLKSDNAVVLPSKCGVNIPYKISLETDCNTVK 117

Sequence Alignment: 28. Allergen Name: Zea m 14.0101 Sequence ID: P19656-1

 Score = 73.1 bits 423,  Expect = 2e-15
 Identities = 63/116 54%, Positives = 83/116 71%, Gaps = 3/116 2%
Query  1    MARGMKLACVVLVICMVVI--APMAEGAISCGAVTSDLSPCLTYLTG-GPGPSPQCCGGV 57
            MAR  +LA V   +  +V+  A  +E AISCG V S ++PC++Y  G G GPS  CC GV
Sbjct  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV 60
Query  58   KKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTV 116
            + L  AA TT DR+AACNCLK+AA  ++ LN  NAA++P KCGV+IPY IST+T+C+ V
Sbjct  61   RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119

Sequence Alignment: 29. Allergen Name: Art gm 3.0101 Sequence ID: ANC85022

 Score = 72.6 bits 420,  Expect = 3e-15
 Identities = 63/111 56%, Positives = 81/111 72%, Gaps = 3/111 2%
Query  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPGPSPQCCGGVKKLLAA 63
            MK+ CV +V+CMVV +  AE A++C  V++ +SPC ++L  GG  P+  CC GVK L  A
Sbjct  6    MKVFCV-MVVCMVVSSSYAEAALTCSDVSNKISPCTSFLKQGGEVPA-DCCTGVKGLNDA 63
Query  64   ANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            A TTPDRQ ACNCLK++  S   + ++NAA LP KCGVNIPYKIS  T+CN VK
Sbjct  64   AKTTPDRQTACNCLKTSFKSNKDFKSDNAAVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 30. Allergen Name: Zea m 14.0102 Sequence ID: P19656-2

 Score = 72.5 bits 419,  Expect = 4e-15
 Identities = 62/114 54%, Positives = 82/114 71%, Gaps = 3/114 2%
Query  1    MARGMKLACVVLVICMVVI--APMAEGAISCGAVTSDLSPCLTYLTG-GPGPSPQCCGGV 57
            MAR  +LA V   +  +V+  A  +E AISCG V S ++PC++Y  G G GPS  CC GV
Sbjct  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV 60
Query  58   KKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCN 114
            + L  AA TT DR+AACNCLK+AA  ++ LN  NAA++P KCGV+IPY IST+T+C+
Sbjct  61   RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCS 117

Sequence Alignment: 31. Allergen Name: Pru ar 3 Sequence ID: P81651

 Score = 71.8 bits 415,  Expect = 4e-15
 Identities = 56/91 61%, Positives = 69/91 75%, Gaps = 0/91 0%
Query  27   ISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITK 86
            I+CG V+S L+PC+ Y+ GG    P CC G++ +   A TTPDR+ ACNCLK  +GSI+ 
Sbjct  1    ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISG 60
Query  87   LNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            +N NNAAALPGKCGVNIPYKIS +TNC TVK
Sbjct  61   VNPNNAAALPGKCGVNIPYKISASTNCATVK 91

Sequence Alignment: 32. Allergen Name: Art ca 3.0101 Sequence ID: ANC85021

 Score = 71.9 bits 415,  Expect = 5e-15
 Identities = 61/112 54%, Positives = 77/112 68%, Gaps = 1/112 0%
Query  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAA 64
            MK+ CV +V+CMVV +  AE A++C  V++ + PC ++L  G   S  CC GVK L  AA
Sbjct  6    MKVFCV-MVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVSADCCTGVKGLNDAA 64
Query  65   NTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
             TTPDRQAACNCLK+   S   + ++NA  LP KCGVNIPYKIS  T+CN VK
Sbjct  65   KTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 33. Allergen Name: Art an 3.0101 Sequence ID: ANC85017

 Score = 71.9 bits 415,  Expect = 5e-15
 Identities = 61/112 54%, Positives = 77/112 68%, Gaps = 1/112 0%
Query  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAA 64
            MK+ CV +V+CMVV +  AE A++C  V++ + PC ++L  G   S  CC GVK L  AA
Sbjct  6    MKVFCV-MVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVSADCCTGVKGLNDAA 64
Query  65   NTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
             TTPDRQAACNCLK+   S   + ++NA  LP KCGVNIPYKIS  T+CN VK
Sbjct  65   KTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 34. Allergen Name: Pun g 1.0101 Sequence ID: A0A059STC4

 Score = 71.6 bits 413,  Expect = 6e-15
 Identities = 63/110 57%, Positives = 78/110 70%, Gaps = 5/110 4%
Query  6    KLACVVLVICMVVIAPMA-EGAISCGAVTSDLSPCLTYL--TGGPGPSPQCCGGVKKLLA 62
            KLAC V+ + +V  AP+A E A++CG V S L+PC+ Y    GG  P P CC G+K L  
Sbjct  8    KLACAVFAVALVA-APIATEAAVTCGQVASSLAPCIPYARSAGGAVP-PACCSGIKTLDG 65
Query  63   AANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
             A TTPDRQA C CLKSA+ SI+ +N    A+LP KCGVNIPYKIS +T+C  VK
Sbjct  66   MARTTPDRQATCKCLKSASTSISGINYGLVASLPAKCGVNIPYKISPSTDCARVK 120

Sequence Alignment: 35. Allergen Name: Hor v 1 Sequence ID: AAA32970

 Score = 71.3 bits 411,  Expect = 8e-15
 Identities = 56/116 48%, Positives = 73/116 62%, Gaps = 0/116 0%
Query  1    MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKL 60
            MAR   L     ++ M+  AP A  A++CG V S + PCLTY+ GGPGPS +CC GV+ L
Sbjct  1    MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDL 60
Query  61   LAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTV 116
               A ++ DRQ  CNCLK  A  I  LN NNAA++P KC VN+PY IS   +C+ +
Sbjct  61   HNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRI 116

Sequence Alignment: 36. Allergen Name: Pru d 3 Sequence ID: P82534

 Score = 70.9 bits 409,  Expect = 8e-15
 Identities = 55/91 60%, Positives = 69/91 75%, Gaps = 0/91 0%
Query  27   ISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITK 86
            I+CG V+S+L+PC+ Y+ GG    P CC G++ +   A TT DR+AACNCLK  +GSI  
Sbjct  1    ITCGQVSSNLAPCINYVKGGGAVPPACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPG 60
Query  87   LNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            +N NNAAALPGKCGVN+PYKIS +TNC TVK
Sbjct  61   VNPNNAAALPGKCGVNVPYKISASTNCATVK 91

Sequence Alignment: 37. Allergen Name: Pru p 3 Sequence ID: CAB96876

 Score = 70.9 bits 409,  Expect = 8e-15
 Identities = 55/91 60%, Positives = 68/91 74%, Gaps = 0/91 0%
Query  27   ISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITK 86
            I+CG V+S L+PC+ Y+ GG    P CC G++ +   A TTPDRQAACNCLK  + S+  
Sbjct  1    ITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  87   LNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            +N NNAAALPGKCGV+IPYKIS +TNC TVK
Sbjct  61   VNPNNAAALPGKCGVSIPYKISASTNCATVK 91

Sequence Alignment: 38. Allergen Name: Pru p 3 Sequence ID: P81402

 Score = 70.6 bits 407,  Expect = 1e-14
 Identities = 55/91 60%, Positives = 68/91 74%, Gaps = 0/91 0%
Query  27   ISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITK 86
            I+CG V+S L+PC+ Y+ GG    P CC G++ +   A TTPDRQAACNCLK  + S+  
Sbjct  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  87   LNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            +N NNAAALPGKCGV+IPYKIS +TNC TVK
Sbjct  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91

Sequence Alignment: 39. Allergen Name: Hor v 1 Sequence ID: CAA42832

 Score = 70.9 bits 408,  Expect = 1e-14
 Identities = 56/114 49%, Positives = 72/114 63%, Gaps = 0/114 0%
Query  1    MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKL 60
            MAR   L     ++ M+  AP A  A++CG V S + PCLTY+ GGPGPS +CC GV+ L
Sbjct  1    MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDL 60
Query  61   LAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCN 114
               A ++ DRQ  CNCLK  A  I  LN NNAA++P KC VN+PY IS   +C+
Sbjct  61   HNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCS 114

Sequence Alignment: 40. Allergen Name: Art la 3.0102 Sequence ID: ANC85025

 Score = 69.9 bits 402,  Expect = 2e-14
 Identities = 60/111 54%, Positives = 79/111 71%, Gaps = 3/111 2%
Query  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPGPSPQCCGGVKKLLAA 63
            MK+ CV +V+CMVV +  AE A++C  V++ +SPCL+YL  GG  P+  CC GVK L  A
Sbjct  4    MKVFCV-MVVCMVVKSSYAEAALTCSDVSTKISPCLSYLKKGGEVPA-DCCTGVKGLNDA 61
Query  64   ANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
              TTPDRQ ACNCLK++  S   L ++ A  LP KCG+N+PYK+S  T+CN VK
Sbjct  62   TKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 115

Sequence Alignment: 41. Allergen Name: Art v 3.0301 Sequence ID: EU564847

 Score = 69.7 bits 400,  Expect = 2e-14
 Identities = 59/111 53%, Positives = 78/111 70%, Gaps = 3/111 2%
Query  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPGPSPQCCGGVKKLLAA 63
            MK+ C+ +V+CMVV    AE A++C  V++ +SPCL+YL  GG  P+  CC GVK L  A
Sbjct  6    MKVFCI-MVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPA-DCCTGVKGLNDA 63
Query  64   ANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
              TTPDRQ ACNCLK++  S   L ++ A  LP KCG+N+PYK+S  T+CN VK
Sbjct  64   TKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117

Sequence Alignment: 42. Allergen Name: Art si 3.0102 Sequence ID: ANC85027

 Score = 69.4 bits 398,  Expect = 3e-14
 Identities = 62/110 56%, Positives = 80/110 72%, Gaps = 4/110 3%
Query  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPGPSPQCCGGVKKLLAA 63
            MK+ C  +V+CMV+ +  AE A++C  V++ ++PCL YL  GG  P+  CC GVK L  A
Sbjct  6    MKFFCA-MVVCMVLSSSYAE-ALTCSDVSNKITPCLNYLKQGGEVPA-DCCTGVKGLNDA 62
Query  64   ANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            A TTPDRQ ACNCLK++  S   L ++ AA+LP KCGVNIPYKIS  T+CN VK
Sbjct  63   AKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 43. Allergen Name: Art v 3.0202 Sequence ID: ACE07187

 Score = 69.4 bits 398,  Expect = 3e-14
 Identities = 62/110 56%, Positives = 80/110 72%, Gaps = 4/110 3%
Query  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPGPSPQCCGGVKKLLAA 63
            MK+ C  +V+CMV+ +  AE A++C  V++ ++PCL YL  GG  P+  CC GVK L  A
Sbjct  6    MKFFCA-MVVCMVLSSSYAE-ALTCSDVSNKITPCLNYLKQGGEVPA-DCCTGVKGLNDA 62
Query  64   ANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            A TTPDRQ ACNCLK++  S   L ++ AA+LP KCGVNIPYKIS  T+CN VK
Sbjct  63   AKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 44. Allergen Name: Art ar 3.0102 Sequence ID: ANC85020

 Score = 69.4 bits 398,  Expect = 3e-14
 Identities = 62/110 56%, Positives = 80/110 72%, Gaps = 4/110 3%
Query  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPGPSPQCCGGVKKLLAA 63
            MK+ C  +V+CMV+ +  AE A++C  V++ ++PCL YL  GG  P+  CC GVK L  A
Sbjct  6    MKFFCA-MVVCMVLSSSYAE-ALTCSDVSNKITPCLNYLKQGGEVPA-DCCTGVKGLNDA 62
Query  64   ANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            A TTPDRQ ACNCLK++  S   L ++ AA+LP KCGVNIPYKIS  T+CN VK
Sbjct  63   AKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 45. Allergen Name: Art v 3.0201 Sequence ID: EU564845

 Score = 68.0 bits 389,  Expect = 7e-14
 Identities = 62/110 56%, Positives = 78/110 70%, Gaps = 4/110 3%
Query  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPGPSPQCCGGVKKLLAA 63
            MK+ C  +V+CMVV +  AE A+ C  V++ +S CL+YL  GG  P+  CC GVK L  A
Sbjct  4    MKFFCA-MVVCMVVSSSYAE-ALKCSDVSNKISACLSYLKQGGEVPA-DCCTGVKGLNDA 60
Query  64   ANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            A TTPDRQ ACNCLK+   S   + ++ AA+LP KCGVNIPYKIS  T+CN VK
Sbjct  61   AKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKVK 114

Sequence Alignment: 46. Allergen Name: Art la 3.0101 Sequence ID: ANC85024

 Score = 68.0 bits 389,  Expect = 7e-14
 Identities = 62/110 56%, Positives = 78/110 70%, Gaps = 4/110 3%
Query  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPGPSPQCCGGVKKLLAA 63
            MK+ C  +V+CMVV +  AE A+ C  V++ +S CL+YL  GG  P+  CC GVK L  A
Sbjct  6    MKFFCA-MVVCMVVSSSYAE-ALKCSDVSNKISACLSYLKQGGEVPA-DCCTGVKGLNDA 62
Query  64   ANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            A TTPDRQ ACNCLK+   S   + ++ AA+LP KCGVNIPYKIS  T+CN VK
Sbjct  63   AKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 47. Allergen Name: Art ar 3.0101 Sequence ID: ANC85019

 Score = 68.0 bits 389,  Expect = 7e-14
 Identities = 62/110 56%, Positives = 78/110 70%, Gaps = 4/110 3%
Query  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPGPSPQCCGGVKKLLAA 63
            MK+ C  +V+CMVV +  AE A+ C  V++ +S CL+YL  GG  P+  CC GVK L  A
Sbjct  6    MKFFCA-MVVCMVVSSSYAE-ALKCSDVSNKISACLSYLKQGGEVPA-DCCTGVKGLNDA 62
Query  64   ANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            A TTPDRQ ACNCLK+   S   + ++ AA+LP KCGVNIPYKIS  T+CN VK
Sbjct  63   AKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 48. Allergen Name: Api g 2 Sequence ID: ACV04796

 Score = 68.0 bits 389,  Expect = 8e-14
 Identities = 58/111 52%, Positives = 73/111 65%, Gaps = 2/111 1%
Query  6    KLACVVLVICMVVIA--PMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAA 63
            K+A  V V+ MVV+   P     ++CG VT  L  CL YL GG  PSP CCGGVK L + 
Sbjct  5    KVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYPSPACCGGVKGLNSL 64
Query  64   ANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTV 116
            A T  DR+ AC CLK+ AGS+  +N   A+ALPGKCG+ IPY IS +T+C+ V
Sbjct  65   AKTPADRKQACACLKTLAGSVKGINYGAASALPGKCGIRIPYPISPSTDCSRV 117

Sequence Alignment: 49. Allergen Name: Art si 3.0101 Sequence ID: ANC85026

 Score = 67.6 bits 386,  Expect = 1e-13
 Identities = 60/110 54%, Positives = 77/110 70%, Gaps = 4/110 3%
Query  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPGPSPQCCGGVKKLLAA 63
            MK+ CV +V+CMVV +  AE A++C  V++ +SPCL YL  GG  P+  CC GVK L  A
Sbjct  6    MKVFCV-MVVCMVVSSSYAE-ALTCSDVSNKISPCLNYLKQGGEVPA-NCCAGVKGLNDA 62
Query  64   ANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            A TTPDRQ AC CLK++  +   L ++ A  LP KCGV IPYK+S  T+CN VK
Sbjct  63   AKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116

Sequence Alignment: 50. Allergen Name: Mor n 3.0101 Sequence ID: P85894

 Score = 66.9 bits 382,  Expect = 1e-13
 Identities = 57/90 63%, Positives = 67/90 74%, Gaps = 2/90 2%
Query  27   ISCGAVTSDLSPCLTYLTGGPGPSP-QCCGGVKKLLAAANTTPDRQAACNCLKSAAGSIT 85
            I+CG V+S L+PC+ YL  G G  P  CC GV+ L  AA TT DRQAACNCLKSA  SI 
Sbjct  1    ITCGQVSSSLAPCINYLRAG-GVVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIK 59
Query  86   KLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
             LN N AA LPGKCGV++PYKIS +T+C +VK
Sbjct  60   GLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK 91

Sequence Alignment: 51. Allergen Name: Ara h 17.0101 Sequence ID: A0A510A9S3

 Score = 65.7 bits 374,  Expect = 3e-13
 Identities = 52/92 56%, Positives = 68/92 73%, Gaps = 1/92 1%
Query  26   AISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSI- 84
            AI C  VT  ++PC+ YL  G   S  CC G++ +   A TT DRQA CNCLKSAA S+ 
Sbjct  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
Query  85   TKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            +++N NNAA+LPGKCGV+IPYKIST+ NC+++K
Sbjct  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93

Sequence Alignment: 52. Allergen Name: Tri tu 14.0101 Sequence ID: CAH69206

 Score = 65.0 bits 369,  Expect = 6e-13
 Identities = 51/114 44%, Positives = 76/114 66%, Gaps = 4/114 3%
Query  1    MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTG-GPGPSPQCCGGVKK 59
            MAR      V++ +   ++  + E A+SCG V+S LSPC++Y  G G  PS  CC GV+ 
Sbjct  1    MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASPSAACCSGVRS 60
Query  60   LLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
            L ++A +T D+QAAC C+KSAA     LN   AA +P KCGV++PY IS++ +C+ ++
Sbjct  61   LASSARSTADKQAACKCIKSAAAG---LNAGKAAGIPTKCGVSVPYAISSSVDCSKIR 115

Sequence Alignment: 53. Allergen Name: Can s 3.0101 Sequence ID: W0U0V5

 Score = 64.7 bits 367,  Expect = 6e-13
 Identities = 55/90 61%, Positives = 66/90 73%, Gaps = 2/90 2%
Query  27   ISCGAVTSDLSPCLTYL-TGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSIT 85
            I+CG V S L+PCL+YL  GG  P   CC  +K L  AA T  DRQAAC CLKSAA SI 
Sbjct  1    ITCGQVASSLAPCLSYLKVGGAVPDG-CCNDIKSLSGAAKTPADRQAACKCLKSAASSIK 59
Query  86   KLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
             +N N A+ LPGKCGV+IPYKIS +T+C++VK
Sbjct  60   GVNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91

Sequence Alignment: 54. Allergen Name: Tri a 14.0101 Sequence ID: 19846220

 Score = 64.4 bits 365,  Expect = 7e-13
 Identities = 50/90 55%, Positives = 61/90 67%, Gaps = 0/90 0%
Query  27   ISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITK 86
            I CG V S + PCL+Y+ GGPGPS QCC GVK L   A +  DRQ+ACNCLK  A  I  
Sbjct  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
Query  87   LNTNNAAALPGKCGVNIPYKISTTTNCNTV 116
            LN +NA ++P KCGVN+PY IS   +C+ V
Sbjct  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90

Sequence Alignment: 55. Allergen Name: Sin a 3.0101 Sequence ID: ABU95411

 Score = 62.4 bits 352,  Expect = 3e-12
 Identities = 54/91 59%, Positives = 62/91 68%, Gaps = 2/91 2%
Query  26   AISCGAVTSDLSPCLTYLTGGPGPSPQ-CCGGVKKLLAAANTTPDRQAACNCLKSAAGSI 84
            A+SCG V S+L+ C+ YLT    P P+ CC GV  L   A TTPDRQ AC CL  AA S 
Sbjct  1    ALSCGTVNSNLAACIGYLTQN-APLPKGCCTGVTNLNNMARTTPDRQQACRCLVGAANSF 59
Query  85   TKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117
              LN   AAALP  CGVNIPYKIS +TNCN+V+
Sbjct  60   PSLNAARAAALPKACGVNIPYKISKSTNCNSVR 92

Sequence Alignment: 56. Allergen Name: Sola l 7.0101 Sequence ID: NP_001316123

 Score = 60.4 bits 338,  Expect = 1e-11
 Identities = 49/112 43%, Positives = 73/112 65%, Gaps = 2/112 1%
Query  5    MK-LACVVLVICMVV-IAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLA 62
            MK +A +VLV+  V  +A +A GAI+CG V ++L+PC+ +LT G  P   CC GV+ L  
Sbjct  1    MKAIAILVLVVLAVFQLAMVARGAITCGQVDANLAPCVPFLTQGGEPGAACCSGVRTLNG 60
Query  63   AANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTV 116
               ++ DR+ ACNC+K+AA     L  + A +LP KCG+++   IS T NC+T+
Sbjct  61   NTQSSDDRRTACNCVKAAANRYPNLKDDAAQSLPSKCGISLTVPISRTVNCDTI 114

Sequence Alignment: 57. Allergen Name: Hel a 3.0101 Sequence ID: P82007

 Score = 60.0 bits 335,  Expect = 2e-11
 Identities = 48/105 45%, Positives = 68/105 64%, Gaps = 4/105 3%
Query  11   VLVICMVVIAPMAEG---AISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTT 67
            V ++ M+V+A +      AI+C  VT +L+PCL YL  G  P+P CC G KKLL A  T 
Sbjct  8    VAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPTPACCAGAKKLLGATRTQ 67
Query  68   PDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTV 116
             DR+ AC C K+AA  + K+  + A++LPGKCG++    I+   NCNT+
Sbjct  68   ADRRTACKCAKTAAPQL-KVRPDMASSLPGKCGISTSIPINPNVNCNTI 115

Sequence Alignment: 58. Allergen Name: Par j 2 Sequence ID: P55958

 Score = 42.6 bits 218,  Expect = 4e-06
 Identities = 34/96 35%, Positives = 52/96 54%, Gaps = 5/96 5%
Query  20   APMAEGAISCGAVTSDLSPCLTYLTGGPG-PSPQCCGGVKKLLAAANTTPDRQAACNCLK 78
            AP A G  +CG V  D+ PCL ++ G    PS +CC G KKL     TT  ++ AC C+ 
Sbjct  27   AP-APGEEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIV 85
Query  79   SAAGSITKLNTNNAAALPGKCGVN--IPYKISTTTNCNTVK 117
             A   I+ +     A +P KC +   +P  I+   +C+ ++
Sbjct  86   RATKGISGIKNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125

Sequence Alignment: 59. Allergen Name: Par j 2 Sequence ID: O04403

 Score = 42.1 bits 215,  Expect = 5e-06
 Identities = 34/96 35%, Positives = 51/96 53%, Gaps = 5/96 5%
Query  20   APMAEGAISCGAVTSDLSPCLTYLTGGPG-PSPQCCGGVKKLLAAANTTPDRQAACNCLK 78
            AP A G   CG V   + PCL ++ G    PS  CC G KKL     TT  ++ AC C+ 
Sbjct  27   AP-APGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIV 85
Query  79   SAAGSITKLNTNNAAALPGKCGVN--IPYKISTTTNCNTVK 117
            +A   I+ +     A +P KCG+   +P  I+   +C+ ++
Sbjct  86   AATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125

Sequence Alignment: 60. Allergen Name: Par j 1 Sequence ID: Q40905

 Score = 41.2 bits 209,  Expect = 1e-05
 Identities = 32/99 32%, Positives = 49/99 49%, Gaps = 5/99 5%
Query  17   VVIAPMAEGAISCGAVTSDLSPCLTYLTGGPG-PSPQCCGGVKKLLAAANTTPDRQAACN 75
            V  AP      +CG V   L PCL ++ G    PS  CC G K+L     T P R  AC 
Sbjct  28   VAPAPAPGSEETCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACE 87
Query  76   CLKSAAGSITKLNTNNAAALPGKCGV---NIPYKISTTTNCNTV 116
            C+++A  + + ++    + +P  CG+    +P  I    +C T+
Sbjct  88   CIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 130

Sequence Alignment: 61. Allergen Name: Par j 1 Sequence ID: P43217

 Score = 40.0 bits 201,  Expect = 2e-05
 Identities = 29/88 32%, Positives = 46/88 52%, Gaps = 5/88 5%
Query  28   SCGAVTSDLSPCLTYLTGGPG-PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITK 86
            +CG +   L PCL ++ G    PS  CC G K+L     T P R  AC C+++A  + + 
Sbjct  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
Query  87   LNTNNAAALPGKCGV---NIPYKISTTTNCNTV 116
            ++    + +P  CG+    +P  I    +C TV
Sbjct  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94

Sequence Alignment: 62. Allergen Name: Par j 1.0103 Sequence ID: CAI94601

 Score = 39.4 bits 197,  Expect = 4e-05
 Identities = 28/88 31%, Positives = 46/88 52%, Gaps = 5/88 5%
Query  28   SCGAVTSDLSPCLTYLTGGPG-PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITK 86
            +CG +   L PCL ++ G    PS  CC G K+L     T P R  AC C+++A  + + 
Sbjct  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
Query  87   LNTNNAAALPGKCGV---NIPYKISTTTNCNTV 116
            ++    + +P  CG+    +P  I    +C T+
Sbjct  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 94

Sequence Alignment: 63. Allergen Name: Par j 1 Sequence ID: O04404

 Score = 38.8 bits 192,  Expect = 7e-05
 Identities = 30/96 31%, Positives = 47/96 48%, Gaps = 5/96 5%
Query  20   APMAEGAISCGAVTSDLSPCLTYLTGGPG-PSPQCCGGVKKLLAAANTTPDRQAACNCLK 78
            AP      +CG V   L PCL ++ G    PS  CC G K+L     T   R  AC C++
Sbjct  32   APAPGSEETCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQ 91
Query  79   SAAGSITKLNTNNAAALPGKCGV---NIPYKISTTTNCNTV 116
            +A  + + ++    + +P  CG+    +P  I    +C T+
Sbjct  92   TAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 131

Sequence Alignment: 64. Allergen Name: Amb a 6 Sequence ID: O04004

 Score = 37.9 bits 187,  Expect = 9e-05
 Identities = 36/106 33%, Positives = 51/106 48%, Gaps = 4/106 3%
Query  7    LACVVLVICMVVIAP-MAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAAN 65
            L  V + + +V   P M   + +C  V + L+PC  +LTG   PS  CC GV  L  +  
Sbjct  7    LWSVAVGLLLVSWRPTMFAASPTCDTVQNILAPCAGFLTGQE-PSKACCTGVNNLNNSRK 65
Query  66   TTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYK-ISTTTNCN 114
            T  DR A CNC+K    SI   +      L  KCGV   +  +    +C+
Sbjct  66   TKADRVAVCNCIKELTKSIA-YDPKRMPLLSTKCGVKPDFPAVDKNLDCS 114

Sequence Alignment: 65. Allergen Name: Par j 1.0101 Sequence ID: CAA54587

 Score = 36.9 bits 180,  Expect = 0.0002
 Identities = 27/80 33%, Positives = 42/80 52%, Gaps = 5/80 6%
Query  36   LSPCLTYLTGGPG-PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAA 94
            L PCL ++ G    PS  CC G K+L     T P R  AC C+++A  + + ++    + 
Sbjct  5    LMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSE 64
Query  95   LPGKCGV---NIPYKISTTTNCNTV 116
            +P  CG+    +P  I    +C TV
Sbjct  65   VPKHCGIVDSKLP-PIDVNMDCKTV 88

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.