The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MARVSELALLLVATSAISLHMQEAGAVKFDIKNQCRYTVWAAGLPGGGKRLDQGQTWTVN
LAAGTASARFWGRTGCTFDASGKGSCRSGDCGGQLSCTVSGAVPATLAEYTQSDQDYYDV
SLVDGFNIPLAINPTNTKCTAPACKADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAY
VDNCPATNYSKIFKNQCPQAYSYAKDDTATFACASGTDYSIVFCP
Sequence Info Allergen Name Length Opt Bits Score E Value
AAR21073 Cup s 3.0101 225 1564 313.2 4.3e-87
AAR21074 Cup s 3.0102 225 1541 308.7 9.6e-86
P81295 Jun a 3 225 1505 301.7 1.2e-83
CAC05258 Cup a 3 199 1389 279.2 6.6e-77
1Z3Q_A Mus a 4.0101 200 868 178.0 1.9e-46
P81370 Act c 2 225 844 173.3 5.6e-45
E3SU11 Ole e 13.0101 226 822 169.0 1.1e-43
CAC34055 Cap a 1w 246 814 167.5 3.5e-43
Q9ARG0 Cap a 1.0101 246 814 167.5 3.5e-43
P12670 Lyc e NP24 247 781 161.1 3e-41
AAF80165 Jun v 3.010102 97 652 136.0 4e-34
AAF80167 Jun v 3.010101 97 652 136.0 4e-34
AAG34078 Cap a 1 180 648 135.2 1.3e-33
ACE80957 Pru p 2.0201 246 382 83.5 6.4e-18
ACE80959 Pru p 2.0101 246 367 80.6 4.8e-17
CAC10270 Mal d 2 246 341 75.6 1.6e-15
P50694 Pru av 2 245 334 74.2 4.1e-15
ACE80955 Pru p 2.0301 242 307 69.0 1.5e-13
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cup s 3.0101 Sequence ID: AAR21073

 Score = 313.2 bits 1564,  Expect = 4e-87
 Identities = 225/225 100%, Positives = 225/225 100%, Gaps = 0/225 0%
Query  1    MARVSELALLLVATSAISLHMQEAGAVKFDIKNQCRYTVWAAGLPGGGKRLDQGQTWTVN 60
            MARVSELALLLVATSAISLHMQEAGAVKFDIKNQCRYTVWAAGLPGGGKRLDQGQTWTVN
Sbjct  1    MARVSELALLLVATSAISLHMQEAGAVKFDIKNQCRYTVWAAGLPGGGKRLDQGQTWTVN 60
Query  61   LAAGTASARFWGRTGCTFDASGKGSCRSGDCGGQLSCTVSGAVPATLAEYTQSDQDYYDV 120
            LAAGTASARFWGRTGCTFDASGKGSCRSGDCGGQLSCTVSGAVPATLAEYTQSDQDYYDV
Sbjct  61   LAAGTASARFWGRTGCTFDASGKGSCRSGDCGGQLSCTVSGAVPATLAEYTQSDQDYYDV 120
Query  121  SLVDGFNIPLAINPTNTKCTAPACKADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAY 180
            SLVDGFNIPLAINPTNTKCTAPACKADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAY
Sbjct  121  SLVDGFNIPLAINPTNTKCTAPACKADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAY 180
Query  181  VDNCPATNYSKIFKNQCPQAYSYAKDDTATFACASGTDYSIVFCP 225
            VDNCPATNYSKIFKNQCPQAYSYAKDDTATFACASGTDYSIVFCP
Sbjct  181  VDNCPATNYSKIFKNQCPQAYSYAKDDTATFACASGTDYSIVFCP 225

Sequence Alignment: 2. Allergen Name: Cup s 3.0102 Sequence ID: AAR21074

 Score = 308.7 bits 1541,  Expect = 1e-85
 Identities = 222/225 98%, Positives = 223/225 99%, Gaps = 0/225 0%
Query  1    MARVSELALLLVATSAISLHMQEAGAVKFDIKNQCRYTVWAAGLPGGGKRLDQGQTWTVN 60
            MARVSELALLLVAT AISLHMQEAGAVKFDIKNQC YTVWAAGLPGGGKRLDQGQTWTVN
Sbjct  1    MARVSELALLLVATLAISLHMQEAGAVKFDIKNQCGYTVWAAGLPGGGKRLDQGQTWTVN 60
Query  61   LAAGTASARFWGRTGCTFDASGKGSCRSGDCGGQLSCTVSGAVPATLAEYTQSDQDYYDV 120
            LAAGTASARFWGRTGCTFDASGKGSCRSGDCGGQLSCTVSGAVPATLAEYTQSD+DYYDV
Sbjct  61   LAAGTASARFWGRTGCTFDASGKGSCRSGDCGGQLSCTVSGAVPATLAEYTQSDKDYYDV 120
Query  121  SLVDGFNIPLAINPTNTKCTAPACKADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAY 180
            SLVDGFNIPLAINPTNTKCTAPACKADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAY
Sbjct  121  SLVDGFNIPLAINPTNTKCTAPACKADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAY 180
Query  181  VDNCPATNYSKIFKNQCPQAYSYAKDDTATFACASGTDYSIVFCP 225
            VDNCPATNYSKIFKNQCPQAYSYAKDDTATFACASGTDYSIVFCP
Sbjct  181  VDNCPATNYSKIFKNQCPQAYSYAKDDTATFACASGTDYSIVFCP 225

Sequence Alignment: 3. Allergen Name: Jun a 3 Sequence ID: P81295

 Score = 301.7 bits 1505,  Expect = 1e-83
 Identities = 214/225 95%, Positives = 220/225 97%, Gaps = 0/225 0%
Query  1    MARVSELALLLVATSAISLHMQEAGAVKFDIKNQCRYTVWAAGLPGGGKRLDQGQTWTVN 60
            MARVSELA+LL AT AISLHMQEAG VKFDIKNQC YTVWAAGLPGGGKRLDQGQTWTVN
Sbjct  1    MARVSELAFLLAATLAISLHMQEAGVVKFDIKNQCGYTVWAAGLPGGGKRLDQGQTWTVN 60
Query  61   LAAGTASARFWGRTGCTFDASGKGSCRSGDCGGQLSCTVSGAVPATLAEYTQSDQDYYDV 120
            LAAGTASARFWGRTGCTFDASGKGSC++GDCGGQLSCTVSGAVPATLAEYTQSDQDYYDV
Sbjct  61   LAAGTASARFWGRTGCTFDASGKGSCQTGDCGGQLSCTVSGAVPATLAEYTQSDQDYYDV 120
Query  121  SLVDGFNIPLAINPTNTKCTAPACKADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAY 180
            SLVDGFNIPLAINPTN +CTAPACKADINAVCPSELKVDGGCNSACNV++TDQYCCRNAY
Sbjct  121  SLVDGFNIPLAINPTNAQCTAPACKADINAVCPSELKVDGGCNSACNVFKTDQYCCRNAY 180
Query  181  VDNCPATNYSKIFKNQCPQAYSYAKDDTATFACASGTDYSIVFCP 225
            VDNCPATNYSKIFKNQCPQAYSYAKDDTATFACASGTDYSIVFCP
Sbjct  181  VDNCPATNYSKIFKNQCPQAYSYAKDDTATFACASGTDYSIVFCP 225

Sequence Alignment: 4. Allergen Name: Cup a 3 Sequence ID: CAC05258

 Score = 279.2 bits 1389,  Expect = 7e-77
 Identities = 195/199 97%, Positives = 197/199 98%, Gaps = 0/199 0%
Query  27   VKFDIKNQCRYTVWAAGLPGGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSC 86
            VKFDIKNQC YTVWAAGLPGGGK +DQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSC
Sbjct  1    VKFDIKNQCGYTVWAAGLPGGGKEFDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSC 60
Query  87   RSGDCGGQLSCTVSGAVPATLAEYTQSDQDYYDVSLVDGFNIPLAINPTNTKCTAPACKA 146
            RSGDCGGQLSCTVSGAVPATLAEYTQSDQDYYDVSLVDGFNIPLAINPTNTKCTAPACKA
Sbjct  61   RSGDCGGQLSCTVSGAVPATLAEYTQSDQDYYDVSLVDGFNIPLAINPTNTKCTAPACKA 120
Query  147  DINAVCPSELKVDGGCNSACNVLQTDQYCCRNAYVDNCPATNYSKIFKNQCPQAYSYAKD 206
            DINAVCPSELKVDGGCNSACNVLQTDQYCCRNAYV+NCPATNYSKIFKNQCPQAYSYAKD
Sbjct  121  DINAVCPSELKVDGGCNSACNVLQTDQYCCRNAYVNNCPATNYSKIFKNQCPQAYSYAKD 180
Query  207  DTATFACASGTDYSIVFCP 225
            DTATFACASGTDYSIVFCP
Sbjct  181  DTATFACASGTDYSIVFCP 199

Sequence Alignment: 5. Allergen Name: Mus a 4.0101 Sequence ID: 1Z3Q_A

 Score = 178.0 bits 868,  Expect = 2e-46
 Identities = 112/194 57%, Positives = 143/194 73%, Gaps = 7/194 3%
Query  29   FDIKNQCRYTVWAAGLPGGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSCRS 88
            F+I N+C YTVWAA +PGGG++L+QGQ+WT+N+ AGT   R WGRTGC+FD SG+G C++
Sbjct  3    FEIVNRCSYTVWAAAVPGGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGSGRGRCQT 62
Query  89   GDCGGQLSCTVSGAVPATLAEYTQS---DQDYYDVSLVDGFNIPLAINPTNTKCTAPACK 145
            GDCGG LSCT  G  P TLAE+  +   + D++D+SLVDGFN+P+  +PT+  C    C 
Sbjct  63   GDCGGVLSCTAYGNPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPTSGGCRGIRCA 122
Query  146  ADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAYVDNCPATNYSKIFKNQCPQAYSYAK 205
            ADIN  CP  LK  GGCN+ C V++TDQYCC +     C  T+YS+ FK  CP AYSY K
Sbjct  123  ADINGQCPGALKAPGGCNNPCTVFKTDQYCCNSG---ACSPTDYSQFFKRNCPDAYSYPK 179
Query  206  DD-TATFACASGTDYSIVFCP 225
            DD T TF C  GT+Y +VFCP
Sbjct  180  DDQTTTFTCPGGTNYRVVFCP 200

Sequence Alignment: 6. Allergen Name: Act c 2 Sequence ID: P81370

 Score = 173.3 bits 844,  Expect = 6e-45
 Identities = 116/215 53%, Positives = 150/215 69%, Gaps = 8/215 3%
Query  8    ALLLVATSAISLHMQEAGAVKFDIKNQCRYTVWAAGLPGGGKRLDQGQTWTVNLAAGTAS 67
            +L L A   I++    A    F+I N C +TVWAA +PGGGKRLD+GQ W +N  AGT  
Sbjct  6    SLSLSALLFIAFLFTCARGATFNIINNCPFTVWAAAVPGGGKRLDRGQNWIINPGAGTKG 65
Query  68   ARFWGRTGCTFDASGKGSCRSGDCGGQLSCTVSGAVPATLAEYTQS---DQDYYDVSLVD 124
            AR W RTGC FD +G+G C++GDC G L C   G  P TLAEY  +   + D++D+SLVD
Sbjct  66   ARVWPRTGCNFDGAGRGKCQTGDCNGLLQCQAFGQPPNTLAEYALNQFNNLDFFDISLVD 125
Query  125  GFNIPLAINPTNTKCT-APACKADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAYVDN 183
            GFN+ +  +PT+  CT    C ADIN  CP+EL+  GGCN+ C V++TDQYCC +    N
Sbjct  126  GFNVAMEFSPTSGGCTRGIKCTADINGQCPNELRAPGGCNNPCTVFKTDQYCCNSG---N 182
Query  184  CPATNYSKIFKNQCPQAYSYAKDD-TATFACASGTDYSIVFCP 225
            C  TN+SK FK++CP AYSY KDD T+TF C +GT+Y +VFCP
Sbjct  183  CGLTNFSKFFKDRCPDAYSYPKDDQTSTFTCPAGTNYKVVFCP 225

Sequence Alignment: 7. Allergen Name: Ole e 13.0101 Sequence ID: E3SU11

 Score = 169.0 bits 822,  Expect = 1e-43
 Identities = 114/214 53%, Positives = 143/214 66%, Gaps = 6/214 2%
Query  10   LLVATSAISLHMQEAGAVKFDIKNQCRYTVWAAGLPGGGKRLDQGQTWTVNLAAGTASAR 69
            LLV+  AI++      A  FDI NQC YTVWAA  PGGG+RLDQGQ+W +N+A GT  AR
Sbjct  9    LLVSLWAITFFAY-THAATFDIVNQCTYTVWAAASPGGGRRLDQGQSWNINVAPGTTQAR 67
Query  70   FWGRTGCTFDASGKGSCRSGDCGGQLSCTVSGAVPATLAEYT---QSDQDYYDVSLVDGF 126
             WGRT C FDA+G+G C +GDC G L C   G  P TLAE+     ++ D+ D+S VDGF
Sbjct  68   IWGRTNCNFDANGRGQCETGDCNGLLECQGYGRPPNTLAEFALNQPNNLDFVDISNVDGF 127
Query  127  NIPLAINPTNTKCTAPACKADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAYVDNCPA 186
            NIPL  +PT   C    C A I   CPSEL+  GGCN+ C V+ T++YCC N    +C  
Sbjct  128  NIPLEFSPTTNVCRRLVCNAPIVQQCPSELRTPGGCNNPCTVFNTNEYCCTNGP-GSCGP 186
Query  187  TNYSKIFKNQCPQAYSYAKDD-TATFACASGTDYSIVFCP 225
            T  S+ FK +CP AYSY +DD T+ F C +GT+Y +VFCP
Sbjct  187  TPLSRFFKERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 226

Sequence Alignment: 8. Allergen Name: Cap a 1w Sequence ID: CAC34055

 Score = 167.5 bits 814,  Expect = 3e-43
 Identities = 115/197 58%, Positives = 139/197 70%, Gaps = 12/197 6%
Query  26   AVKFDIKNQCRYTVWAAGLP-GGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKG 84
            A  F+++N C YTVWAA  P GGG+RLD+GQTWT+N   GTA AR WGRT C FD SG+G
Sbjct  21   AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPGTAMARIWGRTNCNFDGSGRG 80
Query  85   SCRSGDCGGQLSCTVSGAVPATLAEYTQS---DQDYYDVSLVDGFNIPLAINPTNT---K 138
            SC++GDCGG L CT  G  P TLAEY  +   + D++D+SLVDGFNIP+   PTN    K
Sbjct  81   SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDISLVDGFNIPMTFAPTNPSGGK 140
Query  139  CTAPACKADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAYVDNCPATNYSKIFKNQCP 198
            C A  C A+IN  CP  L+V GGCN+ C  +   QYCC       C  T  SK FK +CP
Sbjct  141  CHAIQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQG---PCGPTELSKFFKKRCP 197
Query  199  QAYSYAKDD-TATFACASG-TDYSIVFCP 225
             AYSY +DD T+TF C SG T+Y +VFCP
Sbjct  198  DAYSYPQDDATSTFTCPSGSTNYRVVFCP 226

Sequence Alignment: 9. Allergen Name: Cap a 1.0101 Sequence ID: Q9ARG0

 Score = 167.5 bits 814,  Expect = 3e-43
 Identities = 115/197 58%, Positives = 139/197 70%, Gaps = 12/197 6%
Query  26   AVKFDIKNQCRYTVWAAGLP-GGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKG 84
            A  F+++N C YTVWAA  P GGG+RLD+GQTWT+N   GTA AR WGRT C FD SG+G
Sbjct  21   AATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPGTAMARIWGRTNCNFDGSGRG 80
Query  85   SCRSGDCGGQLSCTVSGAVPATLAEYTQS---DQDYYDVSLVDGFNIPLAINPTNT---K 138
            SC++GDCGG L CT  G  P TLAEY  +   + D++D+SLVDGFNIP+   PTN    K
Sbjct  81   SCQTGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDISLVDGFNIPMTFAPTNPSGGK 140
Query  139  CTAPACKADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAYVDNCPATNYSKIFKNQCP 198
            C A  C A+IN  CP  L+V GGCN+ C  +   QYCC       C  T  SK FK +CP
Sbjct  141  CHAIQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQG---PCGPTELSKFFKKRCP 197
Query  199  QAYSYAKDD-TATFACASG-TDYSIVFCP 225
             AYSY +DD T+TF C SG T+Y +VFCP
Sbjct  198  DAYSYPQDDATSTFTCPSGSTNYRVVFCP 226

Sequence Alignment: 10. Allergen Name: Lyc e NP24 Sequence ID: P12670

 Score = 161.1 bits 781,  Expect = 3e-41
 Identities = 110/197 55%, Positives = 136/197 69%, Gaps = 12/197 6%
Query  26   AVKFDIKNQCRYTVWAAGLP-GGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKG 84
            A   +++N C YTVWAA  P GGG+RL++GQTW +N   GT  AR WGRTGC F+A+G+G
Sbjct  21   AATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRGTKMARIWGRTGCNFNAAGRG 80
Query  85   SCRSGDCGGQLSCTVSGAVPATLAEYTQ---SDQDYYDVSLVDGFNIPLAINPTNT---K 138
            +C++GDCGG L CT  G  P TLAEY     S+ D++D+SLVDGFNIP+   PT     K
Sbjct  81   TCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKPSGGK 140
Query  139  CTAPACKADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAYVDNCPATNYSKIFKNQCP 198
            C A  C A+IN  CP  LKV GGCN+ C  +   QYCC       C  T  SK FK +CP
Sbjct  141  CHAIHCTANINGECPRALKVPGGCNNPCTTFGGQQYCCTQG---PCGPTELSKFFKKRCP 197
Query  199  QAYSYAKDD-TATFACASG-TDYSIVFCP 225
             AYSY +DD T+TF C  G T+Y +VFCP
Sbjct  198  DAYSYPQDDPTSTFTCPGGSTNYRVVFCP 226

Sequence Alignment: 11. Allergen Name: Jun v 3.010102 Sequence ID: AAF80165

 Score = 136.0 bits 652,  Expect = 4e-34
 Identities = 93/97 95%, Positives = 95/97 97%, Gaps = 0/97 0%
Query  21   MQEAGAVKFDIKNQCRYTVWAAGLPGGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDA 80
            MQEAGAVKFDIKNQC YTVWAAGLPGGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDA
Sbjct  1    MQEAGAVKFDIKNQCGYTVWAAGLPGGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDA 60
Query  81   SGKGSCRSGDCGGQLSCTVSGAVPATLAEYTQSDQDY 117
            SGKGSC++GDCG QLSCTVSGAVPATLAEYTQSDQDY
Sbjct  61   SGKGSCQTGDCGRQLSCTVSGAVPATLAEYTQSDQDY 97

Sequence Alignment: 12. Allergen Name: Jun v 3.010101 Sequence ID: AAF80167

 Score = 136.0 bits 652,  Expect = 4e-34
 Identities = 93/97 95%, Positives = 95/97 97%, Gaps = 0/97 0%
Query  21   MQEAGAVKFDIKNQCRYTVWAAGLPGGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDA 80
            MQEAGAVKFDIKNQC YTVWAAGLPGGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDA
Sbjct  1    MQEAGAVKFDIKNQCGYTVWAAGLPGGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDA 60
Query  81   SGKGSCRSGDCGGQLSCTVSGAVPATLAEYTQSDQDY 117
            SGKGSC++GDCG QLSCTVSGAVPATLAEYTQSDQDY
Sbjct  61   SGKGSCQTGDCGRQLSCTVSGAVPATLAEYTQSDQDY 97

Sequence Alignment: 13. Allergen Name: Cap a 1 Sequence ID: AAG34078

 Score = 135.2 bits 648,  Expect = 1e-33
 Identities = 90/172 52%, Positives = 113/172 65%, Gaps = 10/172 5%
Query  33   NQCRYTVWAAGLP-GGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSCRSGDC 91
            N C YTVWAA  P GGGKRL++GQ+W      GT  AR WGRT C FD +G+G C++GDC
Sbjct  1    NNCPYTVWAAATPVGGGKRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDC 60
Query  92   GGQLSCTVSGAVPATLAEYTQ---SDQDYYDVSLVDGFNIPLAINPTNT---KCTAPACK 145
            GG L C   G  P TLAEY     S+ D++D+S++DGFNIP++  PT     KC    C 
Sbjct  61   GGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGKCHPIQCV 120
Query  146  ADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAYVDNCPATNYSKIFKNQCPQAYSYAK 205
            A+IN  CP  L+V GGCN+ C  +   QYCC       C  T+ S+ FK +CP AYSY +
Sbjct  121  ANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQG---PCGPTDLSRFFKQRCPDAYSYPQ 177
Query  206  DD 207
            DD
Sbjct  178  DD 179

Sequence Alignment: 14. Allergen Name: Pru p 2.0201 Sequence ID: ACE80957

 Score = 83.5 bits 382,  Expect = 6e-18
 Identities = 119/219 54%, Positives = 147/219 67%, Gaps = 26/219 11%
Query  5    SELALLLVATSAISLHMQEAGAVKFDIKNQCRYTVWAAGLPGGGK--------RLDQGQT 56
            S+ ALL + T AI L    A A K    N+C YTVW   L G  K         L  G +
Sbjct  4    SQAALLGLTTLAI-LFFSGAHAAKITFTNKCSYTVWPGTLTGDQKPQLSLTGFELATGIS 62
Query  57   WTVNLAAGTASARFWGRTGCTFDASGKGSCRSGDCG-GQLSCTVSGAVP-ATLAEYTQSD 114
             +V+ A    S RF+GRT C+ DASGK +C + DCG GQ+SC  +GAVP ATL E T ++
Sbjct  63   NSVD-APSPWSGRFFGRTRCSTDASGKFTCATADCGSGQVSCNGNGAVPPATLVEITIAE 121
Query  115  ---QDYYDVSLVDGFNIPLAINPTNT--KCTAPACKADINAVCPSELKVDGG------CN 163
               QD+YDVSLVDGFN+P+++ P     +C A  C ADIN VCP+EL+V G       C 
Sbjct  122  NGGQDFYDVSLVDGFNLPMSVAPQGGTGECKASTCPADINKVCPAELQVKGSDGSVIACK 181
Query  164  SACNVLQTDQYCCR--NAYVDNCPATNYSKIFKNQCPQAYSYAKDD-TATFACASGTDYS 220
            SAC  L   QYCC   N   + CP T+YSK+FK QCPQAYSYA DD ++TF C+   DY 
Sbjct  182  SACLALNQPQYCCTPPNDKPETCPPTDYSKLFKTQCPQAYSYAYDDKSSTFTCSGRPDYL 241
Query  221  IVFCP 225
            I FCP
Sbjct  242  ITFCP 246

Sequence Alignment: 15. Allergen Name: Pru p 2.0101 Sequence ID: ACE80959

 Score = 80.6 bits 367,  Expect = 5e-17
 Identities = 116/219 52%, Positives = 144/219 65%, Gaps = 26/219 11%
Query  5    SELALLLVATSAISLHMQEAGAVKFDIKNQCRYTVWAAGLPGGGK--------RLDQGQT 56
            S+ ALL + T AI L    A A K    N+C YTVW   L G  K        +L  G +
Sbjct  4    SQAALLGLTTLAI-LFFSGAHAAKITFTNKCSYTVWPGTLTGDQKPQLSLTGFKLATGIS 62
Query  57   WTVNLAAGTASARFWGRTGCTFDASGKGSCRSGDCG-GQLSCTVSGAVP-ATLAEYT--- 111
             +V+ A    S RF+GRT C+ DASGK +C + DCG GQ+SC  +GA P ATL E T   
Sbjct  63   RSVD-APSPWSGRFFGRTRCSTDASGKFTCATADCGSGQVSCNGNGAAPPATLVEITIAS 121
Query  112  QSDQDYYDVSLVDGFNIPLAINPTNT--KCTAPACKADINAVCPSELKVDGG------CN 163
               QD+YDVSLVDGFN+P+++ P     KC A  C ADIN VCP+ L+V G       C 
Sbjct  122  NGGQDFYDVSLVDGFNLPMSVAPQGGTGKCKASTCPADINKVCPAPLQVKGSDGSVIACK 181
Query  164  SACNVLQTDQYCCR--NAYVDNCPATNYSKIFKNQCPQAYSYAKDD-TATFACASGTDYS 220
            SAC  +   +YCC   N   + CP T+YSK+FK QCPQAYSYA DD ++TF C+   DY 
Sbjct  182  SACLAFNQPKYCCTPPNDKPETCPPTDYSKLFKTQCPQAYSYAYDDKSSTFTCSGRPDYL 241
Query  221  IVFCP 225
            I FCP
Sbjct  242  ITFCP 246

Sequence Alignment: 16. Allergen Name: Mal d 2 Sequence ID: CAC10270

 Score = 75.6 bits 341,  Expect = 2e-15
 Identities = 112/219 51%, Positives = 141/219 64%, Gaps = 26/219 11%
Query  5    SELALLLVATSAISLHMQEAGAVKFDIKNQCRYTVWAAGLPGGGK--------RLDQGQT 56
            S++A LL  T AI L    A A K    N C  TVW   L G  K         L    +
Sbjct  4    SQVASLLGLTLAI-LFFSGAHAAKITFTNNCPNTVWPGTLTGDQKPQLSLTGFELASKAS 62
Query  57   WTVNLAAGTASARFWGRTGCTFDASGKGSCRSGDCG-GQLSCTVSGAVP-ATLAEYT--- 111
             +V+ A    S RFWGRT C+ DA+GK +C + DCG GQ++C  +GAVP ATL E T   
Sbjct  63   RSVD-APSPWSGRFWGRTRCSTDAAGKFTCETADCGSGQVACNGAGAVPPATLVEITIAA 121
Query  112  QSDQDYYDVSLVDGFNIPLAINPTNT--KCTAPACKADINAVCPSELKV---DGG---CN 163
               QDYYDVSLVDGFN+P+++ P     +C   +C A++N VCP+ L+V   DG    C 
Sbjct  122  NGGQDYYDVSLVDGFNLPMSVAPQGGTGECKPSSCPANVNKVCPAPLQVKAADGSVISCK 181
Query  164  SACNVLQTDQYCCR--NAYVDNCPATNYSKIFKNQCPQAYSYAKDD-TATFACASGTDYS 220
            SAC  +   +YCC   N   + CP T YS+IF+ QCPQAYSYA DD  +TF C+ G DY 
Sbjct  182  SACLAFGDSKYCCTPPNNTPETCPPTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGPDYV 241
Query  221  IVFCP 225
            I FCP
Sbjct  242  ITFCP 246

Sequence Alignment: 17. Allergen Name: Pru av 2 Sequence ID: P50694

 Score = 74.2 bits 334,  Expect = 4e-15
 Identities = 104/215 48%, Positives = 135/215 62%, Gaps = 29/215 13%
Query  7    LALLLVATSAISLHMQEAGAVKFDIKNQCRYTVWAAGLPGGGKRLDQGQTWTVNLAAGTA 66
            + +L ++ + +S+    A  + F  KN C Y VW   L    K   Q  T    LA+  +
Sbjct  6    VVVLSLSLTILSFGGAHAATISF--KNNCPYMVWPGTLTSDQK--PQLSTTGFELASQAS 61
Query  67   ---------SARFWGRTGCTFDASGKGSCRSGDCG-GQLSCTVSGAVP-ATLAEYT---Q 112
                     + RFW RTGC+ DASGK  C + DC  GQ+ C  +GA+P ATLAE+     
Sbjct  62   FQLDTPVPWNGRFWARTGCSTDASGKFVCATADCASGQVMCNGNGAIPPATLAEFNIPAG 121
Query  113  SDQDYYDVSLVDGFNIPLAINPTNTK--CTAPACKADINAVCPSELKVDGG------CNS 164
              QD+YDVSLVDGFN+P+++ P      C   +C A++NAVCPSEL+  G       C S
Sbjct  122  GGQDFYDVSLVDGFNLPMSVTPQGGTGDCKTASCPANVNAVCPSELQKKGSDGSVVACLS 181
Query  165  ACNVLQTDQYCCR--NAYVDNCPATNYSKIFKNQCPQAYSYAKDDT-ATFACASGTDYSI 221
            AC  + T QYCC       + CP TNYS+IF N CP AYSYA DD   TF C  G +Y+I
Sbjct  182  ACVKFGTPQYCCTPPQNTPETCPPTNYSEIFHNACPDAYSYAYDDKRGTFTCNGGPNYAI 241
Query  222  VFCP 225
             FCP
Sbjct  242  TFCP 245

Sequence Alignment: 18. Allergen Name: Pru p 2.0301 Sequence ID: ACE80955

 Score = 69.0 bits 307,  Expect = 2e-13
 Identities = 108/213 50%, Positives = 134/213 62%, Gaps = 27/213 12%
Query  11   LVATSAISLHMQEAG---AVKFDIKNQCRYTVWAA--GLPG---GGKRLDQGQTWTVNLA 62
            LVA  ++SL +   G   A     KN C YTVW A  G P     G  L    ++ ++  
Sbjct  5    LVAVLSLSLTLLSFGGAHAATMSFKNNCPYTVWPASFGNPQLSTTGFELASQASFQLDTP 64
Query  63   AGTASARFWGRTGCTFDASGKGSCRSGDC-GGQLSCT-VSGAVPATLAEYTQS---DQDY 117
                S RFW RT C+ DASGK  C + DC  GQL C   +G  PATLAE+T +    QD+
Sbjct  65   V-PWSGRFWARTRCSTDASGKFVCETADCDSGQLMCNGKTGIPPATLAEFTIAAGGGQDF 123
Query  118  YDVSLVDGFNIPLAINP---TNTKCTAPACKADINAVCPSELK---VDGG---CNSACNV 168
            YDVSLVDGFN+P+++ P   T T C   +C A++N VCPSEL+    DG    C SAC  
Sbjct  124  YDVSLVDGFNLPMSVTPQGGTGT-CKMGSCAANVNLVCPSELQKIGSDGSVVACLSACVK 182
Query  169  LQTDQYCCR--NAYVDNCPATNYSKIFKNQCPQAYSYAKDDT-ATFACASGTDYSIVFCP 225
            +   QYCC       + CP TNYS+IF  QCP AYSYA DD    F C+ G +Y I FCP
Sbjct  183  FGEPQYCCTPPQETKEKCPPTNYSQIFHEQCPDAYSYAFDDNKGLFTCSGGPNYLITFCP 242

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.