The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MASCTLLAVLVFLCAIVSCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGA
FYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEV
HIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVT
DVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAF
NQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEV
TRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLT
KNAGVLTCILSKPCS
Sequence Info Allergen Name Length Opt Bits Score E Value
Q96385 Cha o 1 375 2557 589.3 9.5e-170
AAD03609 Jun a 1.0102 367 2216 511.5 2.3e-146
P81294 Jun a 1.0101 367 2216 511.5 2.3e-146
Q9LLT1 Jun v 1.0101 367 2198 507.4 4e-145
AAF80164 Jun v 1.0102 367 2190 505.6 1.4e-144
CAC48400 Jun o 1 367 2182 503.8 5e-144
AAF72626 Cup s 1.0102 367 2175 502.2 1.5e-143
AAF72628 Cup s 1.0104 367 2166 500.1 6.2e-143
AAF72625 Cup s 1.0101 367 2165 499.9 7.3e-143
CAC37790 Cup a 1 367 2163 499.5 1e-142
AAF72627 Cup s 1.0103 367 2161 499.0 1.4e-142
AAF72629 Cup s 1.0105 367 2159 498.5 1.9e-142
Q9SCG9 Cup a 1 346 2065 477.1 4.9e-136
BAB86287 Cry j 1.0103 374 2061 476.2 1e-135
P18632 Cry j 1.0101 374 2058 475.5 1.6e-135
BAA05543 Cry j 1.0102 374 2043 472.1 1.8e-134
A0A251RNJ1 Hel a 6.0101 394 1119 261.5 4.7e-71
P27762 Amb a 2 397 1110 259.4 2e-70
AY904433 Art v 6.0101 396 1109 259.2 2.3e-70
P27761 Amb a 1 397 1109 259.2 2.3e-70
AAA32669 Amb a 1 397 1109 259.2 2.3e-70
P27759 Amb a 1 396 1079 252.3 2.6e-68
P27760 Amb a 1 398 1077 251.9 3.6e-68
P28744 Amb a 1 392 1018 238.4 4e-64
ABM60783 Pen c 32.0101 290 268 67.6 8e-13
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cha o 1 Sequence ID: Q96385

 Score = 589.3 bits 2557,  Expect = 9e-170
 Identities = 375/375 100%, Positives = 375/375 100%, Gaps = 0/375 0%
Query  1    MASCTLLAVLVFLCAIVSCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGA 60
            MASCTLLAVLVFLCAIVSCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGA
Sbjct  1    MASCTLLAVLVFLCAIVSCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGA 60
Query  61   FYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEV 120
            FYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEV
Sbjct  61   FYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEV 120
Query  121  HIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVT 180
            HIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVT
Sbjct  121  HIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVT 180
Query  181  DVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAF 240
            DVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAF
Sbjct  181  DVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEV 300
            NQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEV 300
Query  301  TRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLT 360
            TRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLT
Sbjct  301  TRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLT 360
Query  361  KNAGVLTCILSKPCS 375
            KNAGVLTCILSKPCS
Sbjct  361  KNAGVLTCILSKPCS 375

Sequence Alignment: 2. Allergen Name: Jun a 1.0102 Sequence ID: AAD03609

 Score = 511.5 bits 2216,  Expect = 2e-146
 Identities = 314/367 85%, Positives = 345/367 94%, Gaps = 0/367 0%
Query  1    MASCTLLAVLVFLCAIVSCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGA 60
            MAS  L+AVLVFLCAIVSC+SDNPIDSCWRGD+NWDQNRMKLADCAVGFGSS MGGKGG 
Sbjct  1    MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEV 120
            FYTVTS+DD+PVNP PGTLRYGATRE++LWIIFS+N+NIKL MPLY+AG+KTIDGRGA+V
Sbjct  61   FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVT 180
            H+GNGGPCLFMR VSHVILH L+IHGCNTSV G+VL+SE+ GV PVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  DVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAF 240
            + WIDHNSLSD SDGL+DVTL STG+TISNNHFFNHHKVMLLGH D Y DDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEV 300
            NQFGPNAGQRMPRARYGL+HVANNNYDPW+IYAIGGSSNPTILSEGNSFTAP++S KKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
Query  301  TRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLT 360
            T+R+GCESPS CANWVWRST+D+F NGAYFVSSGK E TNIYN+NEAFKVENG+AAPQLT
Sbjct  301  TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  KNAGVLT 367
            KNAGV+T
Sbjct  361  KNAGVVT 367

Sequence Alignment: 3. Allergen Name: Jun a 1.0101 Sequence ID: P81294

 Score = 511.5 bits 2216,  Expect = 2e-146
 Identities = 314/367 85%, Positives = 345/367 94%, Gaps = 0/367 0%
Query  1    MASCTLLAVLVFLCAIVSCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGA 60
            MAS  L+AVLVFLCAIVSC+SDNPIDSCWRGD+NWDQNRMKLADCAVGFGSS MGGKGG 
Sbjct  1    MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEV 120
            FYTVTS+DD+PVNP PGTLRYGATRE++LWIIFS+N+NIKL MPLY+AG+KTIDGRGA+V
Sbjct  61   FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVT 180
            H+GNGGPCLFMR VSHVILH L+IHGCNTSV G+VL+SE+ GV PVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  DVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAF 240
            + WIDHNSLSD SDGL+DVTL STG+TISNNHFFNHHKVMLLGH D Y DDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEV 300
            NQFGPNAGQRMPRARYGL+HVANNNYDPW+IYAIGGSSNPTILSEGNSFTAP++S KKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
Query  301  TRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLT 360
            T+R+GCESPS CANWVWRST+D+F NGAYFVSSGK E TNIYN+NEAFKVENG+AAPQLT
Sbjct  301  TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  KNAGVLT 367
            KNAGV+T
Sbjct  361  KNAGVVT 367

Sequence Alignment: 4. Allergen Name: Jun v 1.0101 Sequence ID: Q9LLT1

 Score = 507.4 bits 2198,  Expect = 4e-145
 Identities = 312/366 85%, Positives = 343/366 93%, Gaps = 0/366 0%
Query  1    MASCTLLAVLVFLCAIVSCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGA 60
            MAS  L+A LVFLCAIVSC SDNPIDSCWRGD+NW QNRMKLADCAVGFGSS MGGKGG 
Sbjct  1    MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEV 120
            FYTVTS+DD+PVNP PGTLRYGATRE++LWIIFS+N+NIKL MPLY+AG+KTIDGRGA+V
Sbjct  61   FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVT 180
            H+GNGGPCLFMR VSHVILHGL+IHGCNTSV G+VL+SE+ GVVPVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT 180
Query  181  DVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAF 240
            + WIDHNSLSD SDGL+DVTL STG+TISNNHFFNHHKVMLLGH D Y DDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEV 300
            NQFGPNAGQRMPRARYGL+HVANNNYDPW+IYAIGGSSNPTILSEGNSFTAPN++ KKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
Query  301  TRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLT 360
            T+R+GCES S CANWVWRST+D+F+NGAYFVSSGK E TNIYN+NEAFKVENG+AAPQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  KNAGVL 366
            KNAGV+
Sbjct  361  KNAGVV 366

Sequence Alignment: 5. Allergen Name: Jun v 1.0102 Sequence ID: AAF80164

 Score = 505.6 bits 2190,  Expect = 1e-144
 Identities = 311/366 84%, Positives = 342/366 93%, Gaps = 0/366 0%
Query  1    MASCTLLAVLVFLCAIVSCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGA 60
            MAS  L+A LVFLCAIVSC SDNPIDSCWRGD+NW QNRMKLADCAVGFGSS MGGKGG 
Sbjct  1    MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEV 120
            FYTVTS+DD+PVNP PGTLRYGATRE++LWIIFS+N+NIKL MPLY+AG+KTIDGRGA+V
Sbjct  61   FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVT 180
            H+GNGGPCLFMR VSHVILHGL+IHGCNTSV G+VL+SE+ GVVPVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT 180
Query  181  DVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAF 240
            + WIDHNSLSD SDGL+DVTL STG+TI NNHFFNHHKVMLLGH D Y DDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITIFNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEV 300
            NQFGPNAGQRMPRARYGL+HVANNNYDPW+IYAIGGSSNPTILSEGNSFTAPN++ KKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
Query  301  TRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLT 360
            T+R+GCES S CANWVWRST+D+F+NGAYFVSSGK E TNIYN+NEAFKVENG+AAPQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  KNAGVL 366
            KNAGV+
Sbjct  361  KNAGVV 366

Sequence Alignment: 6. Allergen Name: Jun o 1 Sequence ID: CAC48400

 Score = 503.8 bits 2182,  Expect = 5e-144
 Identities = 310/367 84%, Positives = 342/367 93%, Gaps = 0/367 0%
Query  1    MASCTLLAVLVFLCAIVSCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGA 60
            MAS  L AVLVFLCAIVSC+SDNPIDSCWRGD+NW QNRMKLADC VGFGSS MGGKGG 
Sbjct  1    MASPCLRAVLVFLCAIVSCYSDNPIDSCWRGDSNWGQNRMKLADCVVGFGSSTMGGKGGE 60
Query  61   FYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEV 120
            FYTVTS++D+PVNP PGTLRYGATRE++LWIIFS+N+NIKL MPLY+AG+KTIDGRGA+V
Sbjct  61   FYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVT 180
            H+GNGGPCLFMR VSHVILHGL+IHGCNTSV G+VL+SE+ GV PVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  DVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAF 240
            + WIDHNSLSD SDGL+DVTL STG+TISNNHFFNHHKVMLLGH D Y +DKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDNDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEV 300
            NQFGPNAGQRMPRARYGL+HVANNNYDPW+IYAIGGSSNPTILSEGNSFTAP++S KKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
Query  301  TRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLT 360
            T+R+GCES S CANWVWRST+D+F NGAYFVSSGK E TNIYN+NEAFKVENG+AAPQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFTNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  KNAGVLT 367
            KNAGV+T
Sbjct  361  KNAGVVT 367

Sequence Alignment: 7. Allergen Name: Cup s 1.0102 Sequence ID: AAF72626

 Score = 502.2 bits 2175,  Expect = 2e-143
 Identities = 308/366 84%, Positives = 342/366 93%, Gaps = 0/366 0%
Query  1    MASCTLLAVLVFLCAIVSCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGA 60
            M S  L+AVLVFLCAIVSC+SDNPIDSCWRGD+NWDQNRMKLADCAVGFGSS MGGKGG 
Sbjct  1    MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEV 120
             YTVTS++D+PVNP PGTLRYGATRE++LWIIFS+N+NIKL MPLY+AG+KTIDGRGA+V
Sbjct  61   IYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLEMPLYVAGHKTIDGRGADV 120
Query  121  HIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVT 180
            H+GNGGPCLFMR VSHVILHGL+IHGCNTSV G+VL+SE+ GV PVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  DVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAF 240
            + WIDHNSLSD SDGL+DVTL+STG+TISNNHFFNHHKVMLLGH D Y DDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEV 300
            NQFGPNAGQRMPRARYGL+HVANNNYD W+IYAIGGSSNPTILSEGNSFTAPN++ KKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
Query  301  TRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLT 360
            T+R+GCES S CANWVWRST+D+F+NGAYFVSSGK E TNIYN+NEAFKVENG+ APQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLT 360
Query  361  KNAGVL 366
            KNAGV+
Sbjct  361  KNAGVV 366

Sequence Alignment: 8. Allergen Name: Cup s 1.0104 Sequence ID: AAF72628

 Score = 500.1 bits 2166,  Expect = 6e-143
 Identities = 307/366 83%, Positives = 340/366 92%, Gaps = 0/366 0%
Query  1    MASCTLLAVLVFLCAIVSCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGA 60
            M S  L+AVLVFLCAIVSC+SDNPIDSCWRGD+NWDQNRMKLADCAVGFGSS MGGKGG 
Sbjct  1    MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEV 120
             YTVTS++D+PVNP PGTLRYGATRE++LWIIFS+N+NIKL MPLY+AG+KTIDGRGA+V
Sbjct  61   IYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVT 180
            H+GNGGPCLFMR VSHVILHGL+IHGCNTSV GNVL+SE+ GV PVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGNVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  DVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAF 240
            + WIDHNSLSD SDGL+DVTL+STG+TISNNHFFNHHKVMLLGH D Y DDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEV 300
            NQFGPNAGQRMPRARYGL+HVANNNYD W+IYAIGGSSNPTILSEGNSF APN++ KKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFAAPNENYKKEV 300
Query  301  TRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLT 360
            T+R+GC S S CANWVWRST+D+F+NGAYFVSSGK E TNIYN+NEAFKVENG+ APQLT
Sbjct  301  TKRIGCVSTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLT 360
Query  361  KNAGVL 366
            KNAGV+
Sbjct  361  KNAGVV 366

Sequence Alignment: 9. Allergen Name: Cup s 1.0101 Sequence ID: AAF72625

 Score = 499.9 bits 2165,  Expect = 7e-143
 Identities = 306/366 83%, Positives = 340/366 92%, Gaps = 0/366 0%
Query  1    MASCTLLAVLVFLCAIVSCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGA 60
            M S  L+AVLVFLCAIVSC+SDNPIDSCWRGD+NWDQNRMKLADCAVGFGSS MGGKGG 
Sbjct  1    MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEV 120
             YT TS++D+PVNP PGTLRYGATRE++LWIIFS+N+NIKL MPLY+AG+KTIDGRGA+V
Sbjct  61   IYTATSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVT 180
            H+GNGGPCLFMR VSHVILHGL+IHGCNTSV G+VL+SE+ GV PVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  DVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAF 240
            + WIDHNSLSD SDGL+DVTL+STG+TISNNHFFNHHKVMLLGH D Y DDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEV 300
            NQFGPNAGQRMPRARYGL+HVANNNYD W+IYAIGGSSNPTILSEGNSF APN++ KKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFAAPNENYKKEV 300
Query  301  TRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLT 360
            T+R+GCES S CANWVWRST+D+F+NGAYFVSSGK E TNIYN+NEAFKVENG+ APQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLT 360
Query  361  KNAGVL 366
            KNAGV+
Sbjct  361  KNAGVV 366

Sequence Alignment: 10. Allergen Name: Cup a 1 Sequence ID: CAC37790

 Score = 499.5 bits 2163,  Expect = 1e-142
 Identities = 308/367 83%, Positives = 338/367 92%, Gaps = 0/367 0%
Query  1    MASCTLLAVLVFLCAIVSCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGA 60
            MAS  L+AVLVFLCAIVSC+SDNPIDSCWRGD+NWDQNRMKLADC VGFGS  MGGKGG 
Sbjct  1    MASPCLVAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGE 60
Query  61   FYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEV 120
             YTVTSSDD+PVNP PGTLRYGATRE++LWIIFS+N+NIKL MPLY+AG KTIDGRGA+V
Sbjct  61   IYTVTSSDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADV 120
Query  121  HIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVT 180
            H+GNGGPCLFMRT SHVILHGL+IHGCNTSV G+VL+SE+ GV PVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRTASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  DVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAF 240
            + WIDHNSLSD SDGL+DVTL STG+TISNNHFFNHHKVMLLGH D Y DD SMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEV 300
            NQFGPNAGQRMPRARYGL+HVANNNYD W+IYAIGGSSNPTILSEGNSFTAP++S KKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
Query  301  TRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLT 360
            T+R+GCES S CANWVWR T+D+F NGAYFVSSGK E TNIYN+NEAFKVENG+AAPQLT
Sbjct  301  TKRIGCESTSACANWVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  KNAGVLT 367
            +NAGV+T
Sbjct  361  QNAGVVT 367

Sequence Alignment: 11. Allergen Name: Cup s 1.0103 Sequence ID: AAF72627

 Score = 499.0 bits 2161,  Expect = 1e-142
 Identities = 306/366 83%, Positives = 340/366 92%, Gaps = 0/366 0%
Query  1    MASCTLLAVLVFLCAIVSCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGA 60
            M S  L+AVLVFLCAIVSC+SDNPIDSCWRGD+NWDQNRMKLADCAVGFGSS MGGKGG 
Sbjct  1    MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEV 120
             YTVTS++D+PVNP PGTLRYGATRE++LWIIFS+N+NIKL MPLY+AG+KTIDGRGA+V
Sbjct  61   IYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVT 180
            H+GNGGPCLFMR VSHVILHGL+IH CNTSV G+VL+SE+ GV PVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHSCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  DVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAF 240
            + WIDHNSL D SDGL+DVTL+STG+TISNNHFFNHHKVMLLGH D Y DDKSMKVTVAF
Sbjct  181  NAWIDHNSLPDCSDGLIDVTLSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEV 300
            NQFGPNAGQRMPRARYGL+HVANNNYD W+IYAIGGSSNPTILSEGNSFTAPN++ KKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
Query  301  TRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLT 360
            T+R+GCES S CANWVWRST+D+F+NGAYFVSSGK E TNIYN+NEAFKVENG+ APQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLT 360
Query  361  KNAGVL 366
            KNAGV+
Sbjct  361  KNAGVV 366

Sequence Alignment: 12. Allergen Name: Cup s 1.0105 Sequence ID: AAF72629

 Score = 498.5 bits 2159,  Expect = 2e-142
 Identities = 306/366 83%, Positives = 339/366 92%, Gaps = 0/366 0%
Query  1    MASCTLLAVLVFLCAIVSCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGA 60
            M S  L+AVLVFLCAIVSC+SDNPIDSCWRGD+NWDQNRMKLADCAVGFGSS MGGKGG 
Sbjct  1    MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEV 120
             YTVTS++D+PVNP PGTLRYGATRE++LWIIFS+N+NIKL MPLY+AG+KTIDGRGA+V
Sbjct  61   IYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVT 180
            H+GNGGPCLFMR VSHVILHGL+IHGCNTSV GNVL+SE+ GV PVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGNVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  DVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAF 240
            + WIDHNSLSD SDGL+DVTL+STG+TISNNHFFNHHKVMLLGH D Y DDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEV 300
            NQFGPNAGQRMPRARYGL+HVANNNYD W+IYAIGGSSNPTILSEGNSF APN++ KKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFAAPNENYKKEV 300
Query  301  TRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLT 360
            T+R+GC S S CANWVWRST+D+F+NGAYFVSSGK E TNIY +NEAFKVENG+ APQLT
Sbjct  301  TKRIGCVSTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYTSNEAFKVENGNLAPQLT 360
Query  361  KNAGVL 366
            KNAGV+
Sbjct  361  KNAGVV 366

Sequence Alignment: 13. Allergen Name: Cup a 1 Sequence ID: Q9SCG9

 Score = 477.1 bits 2065,  Expect = 5e-136
 Identities = 291/345 84%, Positives = 319/345 92%, Gaps = 0/345 0%
Query  22   DNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSSDDDPVNPAPGTLRY 81
            DNPIDSCWRGD+NWDQNRMKLADC VGFGSS MGGKGG  YTVTSS+D+PVNP PGTLRY
Sbjct  1    DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRY 60
Query  82   GATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSHVILHG 141
            GATRE++LWIIFS+N+NIKL MPLY+AG KTIDGRGA VH+GNGGPCLFMR  SHVILHG
Sbjct  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
Query  142  LNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLSDSSDGLVDVTL 201
            L+IHGCNTSV G+VL+SE+ GV PVHAQDGDAITMRNVT+ WIDHNSLSD SDGL+DVTL
Sbjct  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
Query  202  ASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPRARYGLIHV 261
             STG+TISNNHFFNHHKVMLLGH D Y DDKSMKVTVAFNQFGPNAGQRMPRARYGL+HV
Sbjct  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
Query  262  ANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEVTRRVGCESPSTCANWVWRSTQ 321
            ANNNYD W+IYAIGGSSNPTILSEGNSFTAPN+S KKEVT+R+GCE+ S CANWVWRST+
Sbjct  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
Query  322  DSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLTKNAGVL 366
            D+F NGAYFVSSGK E TNIYN+NEAFKVENG+AAPQLT+NAGV+
Sbjct  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVV 345

Sequence Alignment: 14. Allergen Name: Cry j 1.0103 Sequence ID: BAB86287

 Score = 476.2 bits 2061,  Expect = 1e-135
 Identities = 295/374 78%, Positives = 332/374 88%, Gaps = 0/374 0%
Query  1    MASCTLLAVLVFLCAIVSCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGA 60
            M S  L+A+LVF   I SCFSDNPIDSCWRGD+NW QNRMKLADCAVGFGSS MGGKGG 
Sbjct  1    MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEV 120
            +YTVT+SDDDPVNPAPGTLRYGATR+R LWIIFS N+NIKL MP+YIAG KT DGRGA+V
Sbjct  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
Query  121  HIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVT 180
            +IGNGGPC+F++ VS+VI+HGL ++GC+TSV GNVLI+E+ GV PVH QDGDA+T+R  T
Sbjct  121  YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
Query  181  DVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAF 240
            ++WIDHNS+S+SSDGLVDVTL STGVTISNN FFNHHKVMLLGH D YSDDKSMKVTVAF
Sbjct  181  NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEV 300
            NQFGPN GQRMPRARYGL+HVANNNYDPW+IYAIGGSSNPTILSEGNSFTAPN+S KK+V
Sbjct  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
Query  301  TRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLT 360
            T R+GC++ S+C+NWVW+STQD F NGAYFVSSGK EG NIY   EAF VENG+A PQLT
Sbjct  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT 360
Query  361  KNAGVLTCILSKPC 374
            KNAGVLTC LSK C
Sbjct  361  KNAGVLTCSLSKRC 374

Sequence Alignment: 15. Allergen Name: Cry j 1.0101 Sequence ID: P18632

 Score = 475.5 bits 2058,  Expect = 2e-135
 Identities = 294/374 78%, Positives = 334/374 89%, Gaps = 0/374 0%
Query  1    MASCTLLAVLVFLCAIVSCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGA 60
            M S  L+A+LV+   I SCFSDNPIDSCWRGD+NW QNRMKLADCAVGFGSS MGGKGG 
Sbjct  1    MDSPCLVALLVLSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEV 120
            +YTVT+SDDDPVNPAPGTLRYGATR+R LWIIFS N+NIKL MP+YIAG KT DGRGA+V
Sbjct  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
Query  121  HIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVT 180
            +IGNGGPC+F++ VS+VI+HGL+++GC+TSV GNVLI+E+ GV PVH QDGDA+T+R  T
Sbjct  121  YIGNGGPCVFIKRVSNVIIHGLHLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
Query  181  DVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAF 240
            ++WIDHNS+S+SSDGLVDVTL+STGVTISNN FFNHHKVMLLGH D YSDDKSMKVTVAF
Sbjct  181  NIWIDHNSFSNSSDGLVDVTLSSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEV 300
            NQFGPN GQRMPRARYGL+HVANNNYDPW+IYAIGGSSNPTILSEGNSFTAPN+S KK+V
Sbjct  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
Query  301  TRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLT 360
            T R+GC++ S+C+NWVW+STQD F NGAYFVSSGK EG NIY   EAF VENG+A PQLT
Sbjct  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT 360
Query  361  KNAGVLTCILSKPC 374
            KNAGVLTC LSK C
Sbjct  361  KNAGVLTCSLSKRC 374

Sequence Alignment: 16. Allergen Name: Cry j 1.0102 Sequence ID: BAA05543

 Score = 472.1 bits 2043,  Expect = 2e-134
 Identities = 292/374 78%, Positives = 331/374 88%, Gaps = 0/374 0%
Query  1    MASCTLLAVLVFLCAIVSCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGA 60
            M S  L+A+LVF   I SCFSDNPIDSCWRGD+NW QNRMKLADCAVGFGSS MGGKGG 
Sbjct  1    MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEV 120
            +YTVT+SDDDPVNPAPGTLRYGATR+R LWIIFS N+NIKL MP+YIAG KT DGRGA+V
Sbjct  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
Query  121  HIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVT 180
            +IGNGGPC+F++ VS+VI+HGL ++GC+TSV GNVLI+E+ GV PVH QDGDA+T+R  T
Sbjct  121  YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
Query  181  DVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAF 240
            ++WIDHNS+S+SSDGLVDVTL STGVTISNN FFNHHKVM LGH D YSDDKSMKVTVAF
Sbjct  181  NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMSLGHDDAYSDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEV 300
            NQFGPN GQRMPRARYGL+HVANNNYDPW+IYAIGGSSNPTILSEGNSFTAPN+S KK+V
Sbjct  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
Query  301  TRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLT 360
            T R+GC++ S+C+NWVW+STQD F NGAYFVSSGK EG NIY   EAF VENG+A P+LT
Sbjct  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPHLT 360
Query  361  KNAGVLTCILSKPC 374
            +NAGVLTC LSK C
Sbjct  361  QNAGVLTCSLSKRC 374

Sequence Alignment: 17. Allergen Name: Hel a 6.0101 Sequence ID: A0A251RNJ1

 Score = 261.5 bits 1119,  Expect = 5e-71
 Identities = 174/352 49%, Positives = 220/352 62%, Gaps = 7/352 1%
Query  18   SCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTS-SDDDPVNPAP 76
            +C + N +D CWR  A+W  NR  +ADCA GF     GGKGG  Y VTS +DDDP NP  
Sbjct  41   ACEAVNIMDQCWRCKADWADNRQAMADCAQGFAKGTTGGKGGDVYVVTSEADDDPANPKE 100
Query  77   GTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSH 136
            GTLR+G T+ R LWI F K++ I L   L +A +KTIDGRGA+V I NGG  L +  V +
Sbjct  101  GTLRFGVTQGRPLWITFEKDMVISLTQELVVASDKTIDGRGAKVEITNGG--LTLMDVKN 158
Query  137  VILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLSDSSDGL 196
            +I+  +N+H     + G ++ S        +  DGD IT+     +WIDH S+S + DGL
Sbjct  159  IIISNINVHDV-VELPGGMIKSGDGPATQRQKSDGDCITVAGGKQIWIDHCSFSKAFDGL 217
Query  197  VDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPRARY 256
            VDVTL S+ VT+SN  F  H KVMLLG  D +  DK+M VTVAFN F  N  QRMPR R+
Sbjct  218  VDVTLGSSHVTVSNCKFTQHSKVMLLGADDGHHQDKNMVVTVAFNLFTDNCDQRMPRCRF 277
Query  257  GLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEVTRRVGCESP-STCANW 315
            G+ +V NNNYD W  YAIGGSS PTILS+GN F AP+D+ KK V  R   ++P S    W
Sbjct  278  GFFQVVNNNYDRWGTYAIGGSSAPTILSQGNRFLAPDDAAKKNVCVRA--DAPESESMTW 335
Query  316  VWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLTKNAGVLTCILSKPC 374
             WR+ +D + NGA FV SG +            + E G  AP+LT +AGVLTC    PC
Sbjct  336  NWRTEKDVLENGAVFVPSGSDPALTGEQQGGMIQAEPGENAPKLTASAGVLTCSPGSPC 394

Sequence Alignment: 18. Allergen Name: Amb a 2 Sequence ID: P27762

 Score = 259.4 bits 1110,  Expect = 2e-70
 Identities = 170/352 48%, Positives = 217/352 61%, Gaps = 5/352 1%
Query  19   CFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSS-DDDPVNPAPG 77
            C + N ID CWR   +W +NR  L +CA GFG +  GGK G  Y VTS  DDD VNP  G
Sbjct  45   CEAHNIIDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVNPKEG 104
Query  78   TLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSHV 137
            TLR+GAT++R LWIIF +++ I L   + +  +KTIDGRGA+V +  GG  + +  V +V
Sbjct  105  TLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELVYGG--ITLMNVKNV 162
Query  138  ILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLSDSSDGLV 197
            I+H ++IH     + G  + S     +P H  DGDAI +   +D+WIDH +LS S DGLV
Sbjct  163  IIHNIDIHDVRV-LPGGRIKSNGGPAIPRHQSDGDAIHVTGSSDIWIDHCTLSKSFDGLV 221
Query  198  DVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPRARYG 257
            DV   STGVTISN  F +H K +LLG SD +  D  M VT+A+N F     +RMPR R+G
Sbjct  222  DVNWGSTGVTISNCKFTHHEKAVLLGASDTHFQDLKMHVTLAYNIFTNTVHERMPRCRFG 281
Query  258  LIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEVTRRVGCESPSTCANWVW 317
            + ++ NN YD W  YAIGGSSNPTILS+GN F AP+   KK V  R G + P     W W
Sbjct  282  FFQIVNNFYDRWDKYAIGGSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEW-MTWNW 340
Query  318  RSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLTKNAGVLTCILSKPC 374
            R+  D + NGA FV+SG +       N    + E G   PQLT NAGVLTC    PC
Sbjct  341  RTQNDVLENGAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGAPC 397

Sequence Alignment: 19. Allergen Name: Art v 6.0101 Sequence ID: AY904433

 Score = 259.2 bits 1109,  Expect = 2e-70
 Identities = 174/350 49%, Positives = 221/350 63%, Gaps = 9/350 2%
Query  19   CFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTS-SDDDPVNPAPG 77
            C + N ID CWR  A+W++NR  LA CA GF     GG GG  Y VT  SDD+  NP PG
Sbjct  44   CAAHNIIDKCWRCKADWEKNRQALAKCAQGFAKGTTGGLGGEIYVVTDCSDDNAANPKPG 103
Query  78   TLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSHV 137
            TLR G T+++ LWIIF K++ IKL   L I  +KTIDGRGA V I  GG  L +  V +V
Sbjct  104  TLRCGVTQDKPLWIIFKKDMVIKLKHELVINKDKTIDGRGANVEITCGG--LTIHNVCNV 161
Query  138  ILHGLNIHGCNTSVSGNVLISEAS-GVVPVHAQDGDAITMRNVTDVWIDHNSLSDSSDGL 196
            I+H ++IH    +  G +  ++A  G    H  DGD I +   + +WIDH +LS   DGL
Sbjct  162  IIHNIHIHDIKVTEGGIIKATDAKPG--HRHKSDGDGICVAGSSKIWIDHCTLSHGPDGL 219
Query  197  VDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPRARY 256
            +DVTL ST VTISN  F +H+K++LLG  + + DDK M VTVAFN+F     QRMPR R+
Sbjct  220  IDVTLGSTAVTISNCKFSHHQKILLLGADNSHVDDKKMHVTVAFNRFAEACDQRMPRCRF 279
Query  257  GLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEVTRRVGCESPSTCA-NW 315
            G+ +V NN+Y  W  YAIGGS+NPTILS+GN F APND  KK V  R   ++P T +  W
Sbjct  280  GFFQVVNNDYTSWGTYAIGGSANPTILSQGNRFHAPNDPMKKNVLVRA--DAPHTESMKW 337
Query  316  VWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLTKNAGVLTCILSKPC 374
             WRS +D + NGA FV+SG +        +     E GSA  QLT  AG L C+  KPC
Sbjct  338  NWRSEKDLLENGAIFVASGCDPHLTPEQKSHLIPAEPGSAVLQLTSCAGTLKCVPGKPC 396

Sequence Alignment: 20. Allergen Name: Amb a 1 Sequence ID: P27761

 Score = 259.2 bits 1109,  Expect = 2e-70
 Identities = 174/353 49%, Positives = 218/353 61%, Gaps = 5/353 1%
Query  18   SCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSS-DDDPVNPAP 76
            +C + N ID CWRG A+W+ NR  LADCA GF     GGK G  YTVTS+ DDD  NP  
Sbjct  44   ACEALNIIDKCWRGKADWENNRQALADCAQGFAKGTYGGKWGDVYTVTSNLDDDVANPKE 103
Query  77   GTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSH 136
            GTLR+ A + R LWIIF  ++ I LN  L +  +KTIDGRG +V I NGG  L +  V +
Sbjct  104  GTLRFAAAQNRPLWIIFKNDMVINLNQELVVNSDKTIDGRGVKVEIINGG--LTLMNVKN 161
Query  137  VILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLSDSSDGL 196
            +I+H +NIH     + G ++ S     +  +A DGD I +   + +WIDH SLS S DGL
Sbjct  162  IIIHNINIHDVKV-LPGGMIKSNDGPPILRQASDGDTINVAGSSQIWIDHCSLSKSFDGL 220
Query  197  VDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPRARY 256
            VDVTL ST VTISN  F  + K +LLG  D +  DK M  TVAFN F  N  QRMPR R+
Sbjct  221  VDVTLGSTHVTISNCKFTQQSKAILLGADDTHVQDKGMLATVAFNMFTDNVDQRMPRCRF 280
Query  257  GLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEVTRRVGCESPSTCANWV 316
            G+ +V NNNYD W  YAIGGSS PTIL +GN F AP+D  KK V  R G  +  + A W 
Sbjct  281  GFFQVVNNNYDRWGTYAIGGSSAPTILCQGNRFLAPDDQIKKNVLARTGTGAAESMA-WN 339
Query  317  WRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLTKNAGVLTCILSKPC 374
            WRS +D + NGA FV+SG +       +      E G AA +LT +AGV++C    PC
Sbjct  340  WRSDKDLLENGAIFVTSGSDPVLTPVQSAGMIPAEPGEAAIKLTSSAGVFSCHPGAPC 397

Sequence Alignment: 21. Allergen Name: Amb a 1 Sequence ID: AAA32669

 Score = 259.2 bits 1109,  Expect = 2e-70
 Identities = 174/353 49%, Positives = 218/353 61%, Gaps = 5/353 1%
Query  18   SCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSS-DDDPVNPAP 76
            +C + N ID CWRG A+W+ NR  LADCA GF     GGK G  YTVTS+ DDD  NP  
Sbjct  44   ACEALNIIDKCWRGKADWENNRQALADCAQGFAKGTYGGKWGDVYTVTSNLDDDVANPKE 103
Query  77   GTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSH 136
            GTLR+ A + R LWIIF  ++ I LN  L +  +KTIDGRG +V I NGG  L +  V +
Sbjct  104  GTLRFAAAQNRPLWIIFKNDMVINLNQELVVNSDKTIDGRGVKVEIINGG--LTLMNVKN 161
Query  137  VILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLSDSSDGL 196
            +I+H +NIH     + G ++ S     +  +A DGD I +   + +WIDH SLS S DGL
Sbjct  162  IIIHNINIHDVKV-LPGGMIKSNDGPPILRQASDGDTINVAGSSQIWIDHCSLSKSFDGL 220
Query  197  VDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPRARY 256
            VDVTL ST VTISN  F  + K +LLG  D +  DK M  TVAFN F  N  QRMPR R+
Sbjct  221  VDVTLGSTHVTISNCKFTQQSKAILLGADDTHVQDKGMLATVAFNMFTDNVDQRMPRCRF 280
Query  257  GLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEVTRRVGCESPSTCANWV 316
            G+ +V NNNYD W  YAIGGSS PTIL +GN F AP+D  KK V  R G  +  + A W 
Sbjct  281  GFFQVVNNNYDRWGTYAIGGSSAPTILCQGNRFLAPDDQIKKNVLARTGTGAAESMA-WN 339
Query  317  WRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLTKNAGVLTCILSKPC 374
            WRS +D + NGA FV+SG +       +      E G AA +LT +AGV++C    PC
Sbjct  340  WRSDKDLLENGAIFVTSGSDPVLTPVQSAGMIPAEPGEAAIKLTSSAGVFSCRPGAPC 397

Sequence Alignment: 22. Allergen Name: Amb a 1 Sequence ID: P27759

 Score = 252.3 bits 1079,  Expect = 3e-68
 Identities = 165/348 47%, Positives = 220/348 63%, Gaps = 5/348 1%
Query  23   NPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSS-DDDPVNPAPGTLRY 81
            N ID CWRG A+W +NR  LADCA GFG   +GGK G  YTVTS  DDD  NP  GTLR+
Sbjct  48   NIIDGCWRGKADWAENRKALADCAQGFGKGTVGGKDGDIYTVTSELDDDVANPKEGTLRF 107
Query  82   GATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSHVILHG 141
            GA + R LWIIF +++ I+L+  + +  +KTIDGRGA+V I N G  + +  V +VI+H 
Sbjct  108  GAAQNRPLWIIFERDMVIRLDKEMVVNSDKTIDGRGAKVEIINAG--FTLNGVKNVIIHN 165
Query  142  LNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLSDSSDGLVDVTL 201
            +N+H    +  G ++ S      P    DGDAI++   + +WIDH SLS S DGLVD  L
Sbjct  166  INMHDVKVN-PGGLIKSNDGPAAPRAGSDGDAISISGSSQIWIDHCSLSKSVDGLVDAKL 224
Query  202  ASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPRARYGLIHV 261
             +T +T+SN+ F  H+ V+L+G  D   +D+ M  TVAFN F  N  QRMPR R+G+ +V
Sbjct  225  GTTRLTVSNSLFTQHQFVLLFGAGDENIEDRGMLATVAFNTFTDNVDQRMPRCRHGFFQV 284
Query  262  ANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEVTRRVGCESPSTCANWVWRSTQ 321
             NNNYD W  YAIGGS++PTILS+GN F AP++  KK V  R G E+ +    W WR+ +
Sbjct  285  VNNNYDKWGSYAIGGSASPTILSQGNRFCAPDERSKKNVLGRHG-EAAAESMKWNWRTNK 343
Query  322  DSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLTKNAGVLTCILSKPC 374
            D + NGA FV+SG +       +      E G +A  LT +AGVL+C    PC
Sbjct  344  DVLENGAIFVASGVDPVLTPEQSAGMIPAEPGESALSLTSSAGVLSCQPGAPC 396

Sequence Alignment: 23. Allergen Name: Amb a 1 Sequence ID: P27760

 Score = 251.9 bits 1077,  Expect = 4e-68
 Identities = 170/351 48%, Positives = 216/351 61%, Gaps = 9/351 2%
Query  18   SCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSS-DDDPVNPAP 76
            +C + N ID CWR  A+W  NR  LADCA GF     GGK G  YTVTS  DDD  NP  
Sbjct  45   ACEAHNIIDKCWRCKADWANNRQALADCAQGFAKGTYGGKHGDVYTVTSDKDDDVANPKE 104
Query  77   GTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSH 136
            GTLR+ A + R LWIIF +N+ I LN  L +  +KTIDGRG +V+I N G  L +  V +
Sbjct  105  GTLRFAAAQNRPLWIIFKRNMVIHLNQELVVNSDKTIDGRGVKVNIVNAG--LTLMNVKN 162
Query  137  VILHGLNIHGCNTSVSGNVLISEASGVVPVHAQ--DGDAITMRNVTDVWIDHNSLSDSSD 194
            +I+H +NIH       G  +I    G  P+  Q  DGDAI +   + +WIDH SLS +SD
Sbjct  163  IIIHNINIHDIKVCPGG--MIKSNDGP-PILRQQSDGDAINVAGSSQIWIDHCSLSKASD 219
Query  195  GLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPRA 254
            GL+D+TL S+ VT+SN  F  H+ V+LLG  D +  DK M  TVAFN F  +  QRMPR 
Sbjct  220  GLLDITLGSSHVTVSNCKFTQHQFVLLLGADDTHYQDKGMLATVAFNMFTDHVDQRMPRC 279
Query  255  RYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEVTRRVGCESPSTCAN 314
            R+G+ +V NNNYD W  YAIGGSS PTILS+GN F AP+D  KK V  R G  +  +  +
Sbjct  280  RFGFFQVVNNNYDRWGTYAIGGSSAPTILSQGNRFFAPDDIIKKNVLARTGTGNAES-MS 338
Query  315  WVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLTKNAGVLTCILSKPC 374
            W WR+ +D + NGA F+ SG +              E G A  +LT +AGVL+C    PC
Sbjct  339  WNWRTDRDLLENGAIFLPSGSDPVLTPEQKAGMIPAEPGEAVLRLTSSAGVLSCHQGAPC 398

Sequence Alignment: 24. Allergen Name: Amb a 1 Sequence ID: P28744

 Score = 238.4 bits 1018,  Expect = 4e-64
 Identities = 166/350 47%, Positives = 219/350 62%, Gaps = 12/350 3%
Query  15   AIVSCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSS-DDDPVN 73
            ++ +C + N ID CWRG A+W +NR  LADCA GF    +GGK G  YTVTS  DDD  N
Sbjct  41   SLTTCGTYNIIDGCWRGKADWAENRKALADCAQGFAKGTIGGKDGDIYTVTSELDDDVAN 100
Query  74   PAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRT 133
            P  GTLR+GA + R LWIIF++++ I+L+  L I  +KTIDGRGA+V I N G  ++   
Sbjct  101  PKEGTLRFGAAQNRPLWIIFARDMVIRLDRELAINNDKTIDGRGAKVEIINAGFAIY--N 158
Query  134  VSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLSDSS 193
            V ++I+H + +H    +  G ++ S     VP    DGDAI +   + +WIDH SLS + 
Sbjct  159  VKNIIIHNIIMHDIVVN-PGGLIKSHDGPPVPRKGSDGDAIGISGGSQIWIDHCSLSKAV 217
Query  194  DGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPR 253
            DGL+D    ST  T+SN  +F +H+ +LL   D   D++ M  TVAFN+F  N  QRMP 
Sbjct  218  DGLIDAKHGSTHFTVSNC-LFTQHQYLLL-FWDF--DERGMLCTVAFNKFTDNVDQRMPN 273
Query  254  ARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSD-KKEVTRRVGCESPSTC 312
             R+G+++V NNNY+ W  YA+GGS+ PTILS+GN F A   SD KKEV  R G  + S  
Sbjct  274  LRHGFVQVVNNNYERWGSYALGGSAGPTILSQGNRFLA---SDIKKEVVGRYGESAMSES 330
Query  313  ANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLTKNAGVLTCILSK 372
             NW WRS  D F NGA FV SG +       N      E G A  +LT +AGVL+C    
Sbjct  331  INWNWRSYMDVFENGAIFVPSGVDPVLTPEQNAGMIPAEPGEAVLRLTSSAGVLSCQPGA 390
Query  373  PC 374
            PC
Sbjct  391  PC 392

Sequence Alignment: 25. Allergen Name: Pen c 32.0101 Sequence ID: ABM60783

 Score = 67.6 bits 268,  Expect = 8e-13
 Identities = 65/200 32%, Positives = 100/200 50%, Gaps = 17/200 8%
Query  82   GATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSHVILHG 141
            G T   S +  F++ ++      ++++G  +     A V    G     +   S+ IL G
Sbjct  21   GTTTTVSSYAAFTEAVSGDDAKVVFVSGKISKTADQARV----GSNTSIIGKDSNAILSG 76
Query  142  LNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLS-------DSSD 194
            +   G     + NV+I    GV  V A +GDAI ++   +VW+DH  +S       D  D
Sbjct  77   F---GVLVKEASNVIIRNL-GVEKVLADNGDAIGIQKSNNVWVDHCDVSSDRDHDKDYYD 132
Query  195  GLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQ-FGPNAGQRMPR 253
            GL+D+T A+  VT+SN    +H K  L+GHSD   D+    + V +N  +  N   R P 
Sbjct  133  GLIDITHAADYVTVSNTSIHDHWKACLIGHSDSNGDEDKGHLHVTLNNNYWYNINSRGPS 192
Query  254  ARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFT 290
             R+G  HV N+ Y   S   I        L E N+F+
Sbjct  193  FRFGTGHVYNSYYLDMS-DGINTRQGAQHLVESNTFS 228

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.