The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MASNKVVFSALLLIIVSVLAATTRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK
RQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEV
FPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sequence Info Allergen Name Length Opt Bits Score E Value
BAA01998 Ory s TAI 165 1169 170.9 1.5e-44
BAA02000 Ory s TAI 166 1112 163.2 3.4e-42
BAA07710 Ory s TAI 166 1084 159.3 4.9e-41
BAA07711 Ory s TAI 160 1049 154.5 1.3e-39
BAA01997 Ory s TAI 162 922 137.2 2.2e-34
BAA07713 Ory s TAI 160 871 130.2 2.7e-32
BAA01996 Ory s TAI 157 861 128.8 6.9e-32
BAA07712 Ory s TAI 157 829 124.5 1.4e-30
BAA07773 Ory s TAI 109 735 111.5 8e-27
BAA07772 Ory s TAI 111 697 106.3 3e-25
BAA07774 Ory s TAI 113 693 105.8 4.4e-25
AAB99797 Ory s TAI 157 625 96.6 3.5e-22
P16968 Hor v 1 146 520 82.2 7e-18
P16968 Hor v 15.0101 146 520 82.2 7e-18
BAA01999 Ory s TAI 95 457 73.5 2e-15
CAA08836 Hor v 1 152 390 64.5 1.6e-12
CBA13560 Tri a 15.0101 121 380 63.0 3.5e-12
P01083 Tri a TAI 123 378 62.8 4.2e-12
CAI84642 Tri a 28.0101 119 287 50.3 2.3e-08
P01085 Tri a TAI 124 287 50.3 2.4e-08
P01084 Tri a TAI 124 273 48.4 8.9e-08
P01086 Hor v 1 144 187 36.7 0.00034
CAA46705 Hor v 1 148 187 36.7 0.00035
CAA35188 Hor v 1 144 186 36.6 0.00038
CAA49556 Hor v 1 149 185 36.5 0.00042
CAA34709 Tri a TAI 143 181 35.9 0.0006
CAA31794 Hor v 1 147 179 35.6 0.00074
CAA39099 Tri a TAI 145 170 34.4 0.0017
CAZ76052 Tri a 29.0101 120 167 33.9 0.002
CBA13559 Tri a 29.0201 120 164 33.5 0.0026
CAA42453 Tri a TAI 143 158 32.8 0.0053
Q41540 Tri a 40.0101 143 158 32.8 0.0053
CAA35598 Tri a TAI 145 156 32.5 0.0065
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s TAI Sequence ID: BAA01998

 Score = 170.9 bits 1169,  Expect = 2e-44
 Identities = 165/165 100%, Positives = 165/165 100%, Gaps = 0/165 0%
Query  1    MASNKVVFSALLLIIVSVLAATTRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
            MASNKVVFSALLLIIVSVLAATTRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK
Sbjct  1    MASNKVVFSALLLIIVSVLAATTRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
Query  61   RQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEV 120
            RQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEV
Sbjct  61   RQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEV 120
Query  121  FPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 165
            FPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  121  FPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 165

Sequence Alignment: 2. Allergen Name: Ory s TAI Sequence ID: BAA02000

 Score = 163.2 bits 1112,  Expect = 3e-42
 Identities = 158/165 95%, Positives = 160/165 96%, Gaps = 1/165 0%
Query  1    MASNKVVFSALLLIIVSVLAATTRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
            MASNKVVFSALLLIIVSVLAAT  MADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK
Sbjct  1    MASNKVVFSALLLIIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
Query  61   RQCVGTRSPG-AVDEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 119
            RQCVG  +PG AVDEQL QDCCR+LAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE
Sbjct  61   RQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 120
Query  120  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 165
            VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  121  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166

Sequence Alignment: 3. Allergen Name: Ory s TAI Sequence ID: BAA07710

 Score = 159.3 bits 1084,  Expect = 5e-41
 Identities = 155/165 93%, Positives = 157/165 95%, Gaps = 1/165 0%
Query  1    MASNKVVFSALLLIIVSVLAATTRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
            MASNKVVFSALLLIIVSVLAAT  MADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK
Sbjct  1    MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
Query  61   RQCVGTRSPGAV-DEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 119
            RQCV T  P A  +EQL QDCCR+LAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE
Sbjct  61   RQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 120
Query  120  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 165
            VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  121  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166

Sequence Alignment: 4. Allergen Name: Ory s TAI Sequence ID: BAA07711

 Score = 154.5 bits 1049,  Expect = 1e-39
 Identities = 149/155 96%, Positives = 151/155 97%, Gaps = 2/155 1%
Query  11   LLLIIVSVLAATTRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGTRSPG 70
            LLLIIVSVLAAT RMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVG  +PG
Sbjct  4    LLLIIVSVLAATRRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPG 63
Query  71   -AVDEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDL 129
             AVDEQL QDCCR+LAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDL
Sbjct  64   GAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDL 123
Query  130  ERAAASLPAFCNVDIPNGTGGVCYWLGY-PRTPRTGH 165
            ERAAASLPAFCNVDIPNGTGGVCYWLGY PRTPRTGH
Sbjct  124  ERAAASLPAFCNVDIPNGTGGVCYWLGYTPRTPRTGH 160

Sequence Alignment: 5. Allergen Name: Ory s TAI Sequence ID: BAA01997

 Score = 137.2 bits 922,  Expect = 2e-34
 Identities = 128/161 79%, Positives = 143/161 88%, Gaps = 5/161 3%
Query  1    MASNKVVFSALLLIIVSVLAAT-TRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
            MASNKVVFS LLL+++SVLAA    MADHH+   VYS GE+C+PG+ YP YSLP+CR +V
Sbjct  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQ---VYSPGEQCRPGISYPTYSLPQCRTLV 57
Query  60   KRQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 119
            +RQCVG R   A DEQ+ QDCCR+LAAVDD WCRC AL+HM+ GIYRELGAT+ GHPMAE
Sbjct  58   RRQCVG-RGASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAE 116
Query  120  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 165
            VFPGCRRGDLERAAASLPAFCNVDIPNG GGVCYWLGYPRTPRTGH
Sbjct  117  VFPGCRRGDLERAAASLPAFCNVDIPNGPGGVCYWLGYPRTPRTGH 162

Sequence Alignment: 6. Allergen Name: Ory s TAI Sequence ID: BAA07713

 Score = 130.2 bits 871,  Expect = 3e-32
 Identities = 123/154 79%, Positives = 135/154 87%, Gaps = 2/154 1%
Query  1    MASNKVVFSALLLIIVSVLAATTRMAD-HHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
            MASNKVVFS LLL +VSVLAAT  MA+ HH+DQVVY+    CQPGMGYPMY LPRCRA+V
Sbjct  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRALV 60
Query  60   KRQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 119
            KRQCVG R   A  EQ+ +DCCR+LAAVDDSWCRC A++HM+GGIYRELGA DVGHPM+E
Sbjct  61   KRQCVG-RGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSE 119
Query  120  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWL 155
            VF GCRRGDLERAAASLPAFCNVDIPNG GGVCYWL
Sbjct  120  VFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 155

Sequence Alignment: 7. Allergen Name: Ory s TAI Sequence ID: BAA01996

 Score = 128.8 bits 861,  Expect = 7e-32
 Identities = 123/151 81%, Positives = 136/151 90%, Gaps = 5/151 3%
Query  1    MASNKVVFSALLLIIVSVLAATTRMAD-HHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
            MASNKVVFS LLL +VSVLAAT  MA+ HH+DQVVY+   RCQPGMGYPMYSLPRCRA+V
Sbjct  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTRA-RCQPGMGYPMYSLPRCRALV 59
Query  60   KRQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 119
            KRQC G+    A  EQ+ +DCCR+LAAVDDSWCRC A++HM+GGIYRELGA DVGHPM+E
Sbjct  60   KRQCRGS---AAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSE 116
Query  120  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWL 155
            VF GCRRGDLERAAASLPAFCNVDIPNG GGVCYWL
Sbjct  117  VFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 152

Sequence Alignment: 8. Allergen Name: Ory s TAI Sequence ID: BAA07712

 Score = 124.5 bits 829,  Expect = 1e-30
 Identities = 117/157 74%, Positives = 134/157 85%, Gaps = 8/157 5%
Query  1    MASNKVVFSALLLIIVSVLAATTRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
            MASNKVV  ALL+++VSVLAATT MADHH++QVVY+ G+ CQPG+GYP Y LPRCRA VK
Sbjct  1    MASNKVVIPALLVVVVSVLAATTTMADHHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFVK 60
Query  61   RQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEV 120
            RQCV   +PG +DEQ+ + CCR+LA +D SWCRC ALNHM+  IYRE  A D GHPMAEV
Sbjct  61   RQCV---APGTLDEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHPMAEV 117
Query  121  FPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 165
            F GCRRGD+ERAAASLPAFCNVDIPNG GGVCYWL     P TG+
Sbjct  118  FRGCRRGDIERAAASLPAFCNVDIPNGVGGVCYWL-----PGTGY 157

Sequence Alignment: 9. Allergen Name: Ory s TAI Sequence ID: BAA07773

 Score = 111.5 bits 735,  Expect = 8e-27
 Identities = 99/108 91%, Positives = 101/108 93%, Gaps = 0/108 0%
Query  58   VVKRQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM 117
            VVKRQCV TR  G  DEQL QDCCR+LAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM
Sbjct  2    VVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM 61
Query  118  AEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 165
            AEVFPGCRRGDLERA A+LPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  62   AEVFPGCRRGDLERARATLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 109

Sequence Alignment: 10. Allergen Name: Ory s TAI Sequence ID: BAA07772

 Score = 106.3 bits 697,  Expect = 3e-25
 Identities = 97/110 88%, Positives = 98/110 89%, Gaps = 1/110 0%
Query  56   RAVVKRQCVGTRSPGAVD-EQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVG 114
            R  VKRQCV T  P A   EQL QDCCR+LAAVDDSWCRCSALNHMVGGIYRELGATDVG
Sbjct  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 60
Query  115  HPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 165
            HPMAEVFPGCRRGDLER   SLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  61   HPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 111

Sequence Alignment: 11. Allergen Name: Ory s TAI Sequence ID: BAA07774

 Score = 105.8 bits 693,  Expect = 4e-25
 Identities = 95/106 89%, Positives = 99/106 93%, Gaps = 1/106 0%
Query  60   KRQCVGTR-SPGAVDEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 118
            +RQCVG R +     +QL QDCCR+LAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA
Sbjct  7    QRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 66
Query  119  EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 165
            EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  67   EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 113

Sequence Alignment: 12. Allergen Name: Ory s TAI Sequence ID: AAB99797

 Score = 96.6 bits 625,  Expect = 4e-22
 Identities = 96/151 63%, Positives = 109/151 72%, Gaps = 5/151 3%
Query  1    MASNKVVFSALLLIIVSVLAATTRMAD-HHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
            MASNKVVFS LLL +VSVLAAT  MA+ HH+DQVVY+ G  CQPGMGYPMY L R   V 
Sbjct  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPMYPL-RVAGVG 59
Query  60   KRQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 119
            +   +G   P      +  DCCR++  VD SWCRC A++HM+GGIYRELGA DVGHPM+E
Sbjct  60   EAPLLGRARPR--RRAVPGDCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMSE 117
Query  120  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWL 155
            VF GCRRG    A    P    VDIPNG GGVCYWL
Sbjct  118  VFRGCRRGTWS-ARRRAPGVLQVDIPNGGGGVCYWL 152

Sequence Alignment: 13. Allergen Name: Hor v 1 Sequence ID: P16968

 Score = 82.2 bits 520,  Expect = 7e-18
 Identities = 77/136 56%, Positives = 93/136 68%, Gaps = 8/136 5%
Query  23   TRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGTRSPGAVDEQLAQDCCR 82
            T +A  +   V  S GE C PGMGYP+Y +PRCRA+VK QC G    G V E + +DCCR
Sbjct  2    TSVAVDQGSMVSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAG----GQVVESIQKDCCR 57
Query  83   ELAAVDDSWCRCSALNHMVGGIYRELGAT--DVGHPMAEVFPGCRRGDLERAAASLPAFC 140
            ++AA+ D WC C AL  M G +Y+ELG    D    +AEVFPGCR   ++RA ASLPA C
Sbjct  58   QIAAIGDEWCICGALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVC 117
Query  141  NVDIPN--GTGGVCYWLGYPRTPR 162
            N  IPN  GT GVCYWL Y + PR
Sbjct  118  NQYIPNTNGTDGVCYWLSYYQPPR 141

Sequence Alignment: 14. Allergen Name: Hor v 15.0101 Sequence ID: P16968

 Score = 82.2 bits 520,  Expect = 7e-18
 Identities = 77/136 56%, Positives = 93/136 68%, Gaps = 8/136 5%
Query  23   TRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGTRSPGAVDEQLAQDCCR 82
            T +A  +   V  S GE C PGMGYP+Y +PRCRA+VK QC G    G V E + +DCCR
Sbjct  2    TSVAVDQGSMVSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAG----GQVVESIQKDCCR 57
Query  83   ELAAVDDSWCRCSALNHMVGGIYRELGAT--DVGHPMAEVFPGCRRGDLERAAASLPAFC 140
            ++AA+ D WC C AL  M G +Y+ELG    D    +AEVFPGCR   ++RA ASLPA C
Sbjct  58   QIAAIGDEWCICGALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVC 117
Query  141  NVDIPN--GTGGVCYWLGYPRTPR 162
            N  IPN  GT GVCYWL Y + PR
Sbjct  118  NQYIPNTNGTDGVCYWLSYYQPPR 141

Sequence Alignment: 15. Allergen Name: Ory s TAI Sequence ID: BAA01999

 Score = 73.5 bits 457,  Expect = 2e-15
 Identities = 66/94 70%, Positives = 79/94 84%, Gaps = 5/94 5%
Query  1    MASNKVVFSALLLIIVSVLAAT-TRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
            MASNKVVFS LLL+++SVLAA    MADHH+   VYS GE+C+PG+ YP YSLP+CR +V
Sbjct  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQ---VYSPGEQCRPGISYPTYSLPQCRTLV 57
Query  60   KRQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALN 98
            +RQCVG R   A DEQ+ QDCCR+LAAVDD WCRC AL+
Sbjct  58   RRQCVG-RGASAADEQVWQDCCRQLAAVDDGWCRCGALD 95

Sequence Alignment: 16. Allergen Name: Hor v 1 Sequence ID: CAA08836

 Score = 64.5 bits 390,  Expect = 2e-12
 Identities = 60/136 44%, Positives = 85/136 62%, Gaps = 12/136 8%
Query  10   ALLLIIVSVLAATTRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGTRSP 69
            ++LL+++  +   T M     D     +   C P MG+ +  L RCRA+VK +CVG R P
Sbjct  8    SMLLVLLLCMLMVTPMTGARSDNSGPWMW--CDPEMGHKVSPLTRCRALVKLECVGNRVP 65
Query  70   GAVDEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDL 129
                E + +DCC+E+A + + WCRC  L  M+  +Y  LG   VG    EVFPGC++  +
Sbjct  66   ----EDVLRDCCQEVANISNEWCRCGDLGSMLRSVYAALG---VGGGPEEVFPGCQKDVM 118
Query  130  ERAAASLPAFCNVDIPN---GTGGVCYW 154
            +   A +PA+CNV IPN   GT GVCYW
Sbjct  119  KLLVAGVPALCNVPIPNEAAGTRGVCYW 146

Sequence Alignment: 17. Allergen Name: Tri a 15.0101 Sequence ID: CBA13560

 Score = 63.0 bits 380,  Expect = 3e-12
 Identities = 57/110 51%, Positives = 78/110 70%, Gaps = 11/110 10%
Query  41   CQPGMGYPMYSLPRCRAVVKRQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNHM 100
            C P  GY + +L  CRA+VK QCVG++ P AV     +DCC++LA V++ WCRC  L+ M
Sbjct  7    CDPATGYKVSALTGCRAMVKLQCVGSQVPEAV----LRDCCQQLADVNNEWCRCEDLSSM 62
Query  101  VGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG---GVCYWLGY 157
            +  +Y+ELGA + G    EV+PGCR+  ++  AAS+P    V IPN +G   GVCYW  Y
Sbjct  63   LRSVYQELGARE-GK---EVLPGCRKEVMKLTAASVPEVRKVPIPNPSGDRAGVCYWAAY 118
Query  158  P 158
            P
Sbjct  119  P 119

Sequence Alignment: 18. Allergen Name: Tri a TAI Sequence ID: P01083

 Score = 62.8 bits 378,  Expect = 4e-12
 Identities = 56/110 50%, Positives = 78/110 70%, Gaps = 13/110 11%
Query  41   CQPGMGYPMYSLPRCRAVVKRQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNHM 100
            C P  GY + +L  CRA+VK QCVG++ P AV     +DCC++LA +++ WCRC  L+ M
Sbjct  7    CNPATGYKVSALTGCRAMVKLQCVGSQVPEAV----LRDCCQQLADINNEWCRCGDLSSM 62
Query  101  VGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG---GVCY--WL 155
            +  +Y+ELG  + G    EV+PGCR+  ++  AAS+P  C V IPN +G   GVCY  W 
Sbjct  63   LRSVYQELGVRE-GK---EVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGDWA 118
Query  156  GYP 158
             YP
Sbjct  119  AYP 121

Sequence Alignment: 19. Allergen Name: Tri a 28.0101 Sequence ID: CAI84642

 Score = 50.3 bits 287,  Expect = 2e-08
 Identities = 45/106 42%, Positives = 68/106 64%, Gaps = 10/106 9%
Query  41   CQPGMGYPMYSLPRCRAVVKRQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNHM 100
            C PG  + + +LP CR +++ QC G++ P AV     +DCC++LA + + WCRC AL  M
Sbjct  1    CYPGQAFQVPALPACRPLLRLQCNGSQVPEAV----LRDCCQQLAHISE-WCRCGALYSM 55
Query  101  VGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDI---PNGTGG-VC 152
            +  +Y+E GA + G+     FP CRR  ++  AAS+ A C + I    +G G  VC
Sbjct  56   LDSMYKEHGAQE-GQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 110

Sequence Alignment: 20. Allergen Name: Tri a TAI Sequence ID: P01085

 Score = 50.3 bits 287,  Expect = 2e-08
 Identities = 45/106 42%, Positives = 68/106 64%, Gaps = 10/106 9%
Query  41   CQPGMGYPMYSLPRCRAVVKRQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNHM 100
            C PG  + + +LP CR +++ QC G++ P AV     +DCC++LA + + WCRC AL  M
Sbjct  6    CYPGQAFQVPALPACRPLLRLQCNGSQVPEAV----LRDCCQQLAHISE-WCRCGALYSM 60
Query  101  VGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDI---PNGTGG-VC 152
            +  +Y+E GA + G+     FP CRR  ++  AAS+ A C + I    +G G  VC
Sbjct  61   LDSMYKEHGAQE-GQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115

Sequence Alignment: 21. Allergen Name: Tri a TAI Sequence ID: P01084

 Score = 48.4 bits 273,  Expect = 9e-08
 Identities = 44/106 41%, Positives = 67/106 63%, Gaps = 10/106 9%
Query  41   CQPGMGYPMYSLPRCRAVVKRQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNHM 100
            C PG  + + +LP CR ++K QC G++ P AV     +DCC++LA + + W RC AL  M
Sbjct  6    CYPGQAFQVPALPGCRPLLKLQCNGSQVPEAV----LRDCCQQLADISE-WPRCGALYSM 60
Query  101  VGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDI---PNGTGG-VC 152
            +  +Y+E G ++ G+     FP CRR  ++  AAS+ A C + I    +G G  VC
Sbjct  61   LDSMYKEHGVSE-GQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115

Sequence Alignment: 22. Allergen Name: Hor v 1 Sequence ID: P01086

 Score = 36.7 bits 187,  Expect = 0.0003
 Identities = 40/117 34%, Positives = 60/117 51%, Gaps = 9/117 7%
Query  36   SLGERCQPGMGYPMYSLPRCRAVVKRQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCS 95
            S+G+ C PG   P   L  CR  V  Q +  + P  +   + + CC EL+A+  ++CRC 
Sbjct  24   SFGDSCAPGDALPHNPLRACRTYVVSQ-ICHQGPRLLTSDMKRRCCDELSAIP-AYCRCE 81
Query  96   ALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNVDIPNGTGGVCY 153
            AL  ++ G+    GA + G    +  P C R      AA+L  P  CN+   +G+   C 
Sbjct  82   ALRIIMQGVVTWQGAFE-GAYFKDS-PNCPRERQTSYAANLVTPQECNLGTIHGSA-YCP 138
Query  154  WL--GY 157
             L  GY
Sbjct  139  ELQPGY 144

Sequence Alignment: 23. Allergen Name: Hor v 1 Sequence ID: CAA46705

 Score = 36.7 bits 187,  Expect = 0.0003
 Identities = 40/117 34%, Positives = 60/117 51%, Gaps = 9/117 7%
Query  36   SLGERCQPGMGYPMYSLPRCRAVVKRQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCS 95
            S+G+ C PG   P   L  CR  V  Q +  + P  +   + + CC EL+A+  ++CRC 
Sbjct  24   SFGDSCAPGDALPHNPLRACRTYVVSQ-ICHQGPRLLTSDMKRRCCDELSAIP-AYCRCE 81
Query  96   ALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNVDIPNGTGGVCY 153
            AL  ++ G+    GA + G    +  P C R      AA+L  P  CN+   +G+   C 
Sbjct  82   ALRIIMQGVVTWQGAFE-GAYFKDS-PNCPRERQTSYAANLVTPQECNLGTIHGSA-YCP 138
Query  154  WL--GY 157
             L  GY
Sbjct  139  ELQPGY 144

Sequence Alignment: 24. Allergen Name: Hor v 1 Sequence ID: CAA35188

 Score = 36.6 bits 186,  Expect = 0.0004
 Identities = 36/109 33%, Positives = 56/109 51%, Gaps = 6/109 5%
Query  36   SLGERCQPGMGYPMYSLPRCRAVVKRQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCS 95
            S+G+ C PG   P   L  CR  V  Q +  + P  +   + + CC EL+A+  ++CRC 
Sbjct  24   SFGDSCAPGDALPHNPLRACRTYVVSQ-ICHQGPRLLTSDMKRRCCDELSAIP-AYCRCE 81
Query  96   ALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNVDIPNGT 148
            AL  ++ G+    GA + G    +  P C R      AA+L  P  CN+   +G+
Sbjct  82   ALRIIMQGVVTWQGAFE-GAYFKDS-PNCPRERQTSYAANLVTPQECNLGTIHGS 134

Sequence Alignment: 25. Allergen Name: Hor v 1 Sequence ID: CAA49556

 Score = 36.5 bits 185,  Expect = 0.0004
 Identities = 50/126 39%, Positives = 69/126 54%, Gaps = 27/126 21%
Query  1    MASNKVVFSALLLIIVSVLAATTRMADHHKDQVVYSLG-ERCQPGMGYPMYSLPRCRAVV 59
            MAS       L  ++VS++AA            V ++G E C P    P+  LP CR  V
Sbjct  1    MASKSSCDLLLAAVLVSIFAA------------VAAVGSEDCTPWTATPITPLPSCRDYV 48
Query  60   KRQCVGTRSPGAVDEQLA-QDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 118
            ++Q     +PG     LA Q CC ELA +    CRC AL   +G   R+      G  + 
Sbjct  49   EQQACRIETPGP--PYLAKQQCCGELANIPQQ-CRCQALRFFMG---RKSRPDQSG--LM 100
Query  119  EVFPGCRRG---DLERAAASLPAFCNVDIPNGT 148
            E+ PGC R    D+ R   + P FCN+   + T
Sbjct  101  EL-PGCPREVQMDFVRILVT-PGFCNLTTVHNT 131

Sequence Alignment: 26. Allergen Name: Tri a TAI Sequence ID: CAA34709

 Score = 35.9 bits 181,  Expect = 0.0006
 Identities = 47/127 37%, Positives = 67/127 52%, Gaps = 25/127 19%
Query  1    MASNKVVFSALLLIIVSVLAATTRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
            MAS       L  ++VS++AA   + +           E C P M   +  LP CR  V+
Sbjct  1    MASKSNCVLLLAAVLVSIFAAVAAIGN-----------EDCTPWMSTLITPLPSCRDYVE 49
Query  61   RQCVGTRSPGAVDEQLA-QDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 119
            +Q     +PG+    LA Q CC ELA +    CRC AL + +G   R     D    M  
Sbjct  50   QQACRIETPGS--PYLAKQQCCGELANIPQQ-CRCQALRYFMGPKSRP----DQSGLME- 101
Query  120  VFPGCRRG---DLERAAASLPAFCNVDIPNGT 148
             +PGC R    D+ R   + P +CN+   + T
Sbjct  102  -LPGCPREVQMDFVRILVT-PGYCNLTTVHNT 131

Sequence Alignment: 27. Allergen Name: Hor v 1 Sequence ID: CAA31794

 Score = 35.6 bits 179,  Expect = 0.0007
 Identities = 50/134 37%, Positives = 68/134 50%, Gaps = 19/134 14%
Query  1    MASNKVVFSALLLIIVSVLAATTRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRA-VV 59
            MAS+   F     +++SVLA      +  KD+        CQ G+ +P   L  C   V+
Sbjct  1    MASDHRRFVLSGAVLLSVLAVAAATLESVKDE--------CQLGVDFPHNPLATCHTYVI 52
Query  60   KRQC-VGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 118
            KR C  G   P  V E+    CCRELAAV D  CRC AL  ++ G+    G    G  + 
Sbjct  53   KRVCGRGPSRPMLVKER----CCRELAAVPDH-CRCEALRILMDGVRTPEGRVVEGR-LG 106
Query  119  EVFPGCRRGDLERAAASL--PAFCNVDIPNGTG 149
            +    C R +    AA+L   A CN+      G
Sbjct  107  DRRD-CPREEQRAFAATLVTAAECNLSSVQAPG 138

Sequence Alignment: 28. Allergen Name: Tri a TAI Sequence ID: CAA39099

 Score = 34.4 bits 170,  Expect = 0.002
 Identities = 49/122 40%, Positives = 66/122 54%, Gaps = 29/122 23%
Query  1    MASNKVVFSALLL-IIVSVLAATTRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
            MAS   +   LL  ++VSV+AA              + G  C PGMG P   L  CR  V
Sbjct  1    MASKSSITHLLLAAVLVSVFAAAA------------ATGPYCYPGMGLPSNPLEGCREYV 48
Query  60   KRQCVGTR---SPGAVDE-QLAQD-CCRELAAVDDSW-CRCSALNHMVGGIYRELGATDV 113
             +Q  G     SP + +     +D CC+EL   D S  CRC A+ + +G   R    +D 
Sbjct  49   AQQTCGVGIVGSPVSTEPGNTPRDRCCKEL--YDASQHCRCEAVRYFIG---R---TSDP 100
Query  114  GHPMAEVFPGCRRGDLERAAASL--PAFCNV 142
               + + +PGC R      A  L  P  CNV
Sbjct  101  NSGVLKDLPGCPREPQRDFAKVLVTPGHCNV 131

Sequence Alignment: 29. Allergen Name: Tri a 29.0101 Sequence ID: CAZ76052

 Score = 33.9 bits 167,  Expect = 0.002
 Identities = 39/97 40%, Positives = 51/97 52%, Gaps = 16/97 16%
Query  38   GERCQPGMGYPMYSLPRCRAVVKRQCVGTRSPG-AVDEQ---LAQD-CCRELAAVDDSW- 91
            G  C  GMG P+  L  CR  V +Q  G    G AV  +     +D CC+EL   D S  
Sbjct  2    GPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKEL--YDASQH 59
Query  92   CRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNV 142
            CRC A+ + +G   R    +D    + + +PGC R      A  L  P  CNV
Sbjct  60   CRCEAVRYFIG---RR---SDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNV 106

Sequence Alignment: 30. Allergen Name: Tri a 29.0201 Sequence ID: CBA13559

 Score = 33.5 bits 164,  Expect = 0.003
 Identities = 37/97 38%, Positives = 50/97 51%, Gaps = 16/97 16%
Query  38   GERCQPGMGYPMYSLPRCRAVVKRQCVGTR---SPGAVDE-QLAQD-CCRELAAVDDSW- 91
            G  C PGMG P   L  CR  V +Q  G     SP + +     +D CC+EL   D S  
Sbjct  2    GPYCYPGMGLPSNPLEGCREYVAQQTCGVGIVGSPVSTEPGNTPRDRCCKEL--YDASQH 59
Query  92   CRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNV 142
            C C A+ + +G        +D    + + +PGC R     +A  L  P  CNV
Sbjct  60   CWCEAVRYFIG------RTSDPNSGVLKDLPGCPREPQRDSAKVLVTPGHCNV 106

Sequence Alignment: 31. Allergen Name: Tri a TAI Sequence ID: CAA42453

 Score = 32.8 bits 158,  Expect = 0.005
 Identities = 45/124 36%, Positives = 66/124 53%, Gaps = 31/124 25%
Query  1    MASNK---VVFSALLLIIVSVLAATTRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRA 57
            MAS     ++F+ALL+ I + +AA                 E C P     +  LP CR 
Sbjct  1    MASKSNYNLLFTALLVFIFAAVAAVG--------------NEDCTPWTSTLITPLPSCRN 46
Query  58   VVKRQCVGTRSPGAVDEQLA-QDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHP 116
             V+ Q      PG     LA Q+CC +LA +    CRC AL + +G   R     D    
Sbjct  47   YVEEQACRIEMPGP--PYLAKQECCEQLANIPQQ-CRCQALRYFMGPKSRP----DQSGL 99
Query  117  MAEVFPGCRRGDLERAAASL---PAFCNVDIPNGT 148
            M   +PGC R +++     +   P +CN+   + T
Sbjct  100  ME--LPGCPR-EVQMNFVPILVTPGYCNLTTVHNT 131

Sequence Alignment: 32. Allergen Name: Tri a 40.0101 Sequence ID: Q41540

 Score = 32.8 bits 158,  Expect = 0.005
 Identities = 45/124 36%, Positives = 66/124 53%, Gaps = 31/124 25%
Query  1    MASNK---VVFSALLLIIVSVLAATTRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRA 57
            MAS     ++F+ALL+ I + +AA                 E C P     +  LP CR 
Sbjct  1    MASKSNYNLLFTALLVFIFAAVAAVG--------------NEDCTPWTSTLITPLPSCRN 46
Query  58   VVKRQCVGTRSPGAVDEQLA-QDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHP 116
             V+ Q      PG     LA Q+CC +LA +    CRC AL + +G   R     D    
Sbjct  47   YVEEQACRIEMPGP--PYLAKQECCEQLANIPQQ-CRCQALRYFMGPKSRP----DQSGL 99
Query  117  MAEVFPGCRRGDLERAAASL---PAFCNVDIPNGT 148
            M   +PGC R +++     +   P +CN+   + T
Sbjct  100  ME--LPGCPR-EVQMNFVPILVTPGYCNLTTVHNT 131

Sequence Alignment: 33. Allergen Name: Tri a TAI Sequence ID: CAA35598

 Score = 32.5 bits 156,  Expect = 0.006
 Identities = 52/121 42%, Positives = 68/121 56%, Gaps = 31/121 25%
Query  1    MASNKVVFSALLL--IIVSVLAATTRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAV 58
            MAS K   S LLL  ++VSV+AA T            + G  C  GMG P+  L  CR  
Sbjct  1    MAS-KSSISPLLLATVLVSVFAAAT------------ATGPYCYAGMGLPINPLEGCREY 47
Query  59   VKRQCVGTRSPG-AVDEQ---LAQD-CCRELAAVDDSW-CRCSALNHMVGGIYRELGATD 112
            V +Q  G    G AV  +     +D CC+EL   D S  CRC A+ + +G   R    +D
Sbjct  48   VAQQTCGISISGSAVSTEPGNTPRDRCCKEL--YDASQHCRCEAVRYFIG---RR---SD 99
Query  113  VGHPMAEVFPGCRRGDLERAAASL--PAFCNV 142
                + + +PGC R      A  L     CNV
Sbjct  100  PNSSVLKDLPGCPREPQRDFAKVLVTSGHCNV 131

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.