The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRALV
KRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEV
FRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY
Sequence Info Allergen Name Length Opt Bits Score E Value
BAA07713 Ory s TAI 160 1132 172.6 4.5e-45
BAA01996 Ory s TAI 157 1048 160.6 1.8e-41
BAA02000 Ory s TAI 166 897 139.0 6.2e-35
BAA01998 Ory s TAI 165 871 135.3 8.1e-34
BAA07710 Ory s TAI 166 871 135.3 8.2e-34
BAA07712 Ory s TAI 157 850 132.3 6.3e-33
BAA07711 Ory s TAI 160 832 129.7 3.8e-32
BAA01997 Ory s TAI 162 827 129.0 6.3e-32
AAB99797 Ory s TAI 157 806 125.9 5e-31
BAA07773 Ory s TAI 109 582 93.7 1.7e-21
BAA07774 Ory s TAI 113 569 91.9 6.5e-21
BAA07772 Ory s TAI 111 562 90.9 1.3e-20
P16968 Hor v 1 146 480 79.2 5.3e-17
P16968 Hor v 15.0101 146 480 79.2 5.3e-17
BAA01999 Ory s TAI 95 460 76.2 2.9e-16
CAA08836 Hor v 1 152 372 63.8 2.5e-12
CBA13560 Tri a 15.0101 121 369 63.3 2.8e-12
P01083 Tri a TAI 123 357 61.6 9.5e-12
P01085 Tri a TAI 124 287 51.5 9.9e-09
CAI84642 Tri a 28.0101 119 284 51.1 1.3e-08
P01084 Tri a TAI 124 270 49.1 5.3e-08
CAA31794 Hor v 1 147 200 39.1 6.3e-05
CAA39099 Tri a TAI 145 185 37.0 0.00028
CAZ76052 Tri a 29.0101 120 182 36.5 0.00032
P01086 Hor v 1 144 183 36.7 0.00033
CAA46705 Hor v 1 148 183 36.7 0.00034
CBA13559 Tri a 29.0201 120 179 36.1 0.00044
CAA35188 Hor v 1 144 180 36.3 0.00045
CAA49556 Hor v 1 149 172 35.1 0.001
CAA35598 Tri a TAI 145 171 35.0 0.0011
CAA34709 Tri a TAI 143 168 34.6 0.0015
CAA42453 Tri a TAI 143 153 32.4 0.0065
Q41540 Tri a 40.0101 143 153 32.4 0.0065
CAA49555 Hor v 1 145 150 32.0 0.0089
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s TAI Sequence ID: BAA07713

 Score = 172.6 bits 1132,  Expect = 4e-45
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRALV 60
            MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRALV
Sbjct  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRALV 60
Query  61   KRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEV 120
            KRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEV
Sbjct  61   KRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEV 120
Query  121  FRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY 160
            FRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY
Sbjct  121  FRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY 160

Sequence Alignment: 2. Allergen Name: Ory s TAI Sequence ID: BAA01996

 Score = 160.6 bits 1048,  Expect = 2e-41
 Identities = 153/157 97%, Positives = 154/157 98%, Gaps = 3/157 1%
Query  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRALV 60
            MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYT A  CQPGMGYPMY LPRCRALV
Sbjct  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTRAR-CQPGMGYPMYSLPRCRALV 59
Query  61   KRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEV 120
            KRQC  RG+AAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEV
Sbjct  60   KRQC--RGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEV 117
Query  121  FRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY 160
            FRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY
Sbjct  118  FRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY 157

Sequence Alignment: 3. Allergen Name: Ory s TAI Sequence ID: BAA02000

 Score = 139.0 bits 897,  Expect = 6e-35
 Identities = 127/154 82%, Positives = 138/154 89%, Gaps = 3/154 1%
Query  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRALV 60
            MASNKVVFS LLL +VSVLAATATMA+ HH+DQVVY+    CQPGMGYPMY LPRCRA+V
Sbjct  1    MASNKVVFSALLLIIVSVLAATATMAD-HHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
Query  61   KRQCVGRGTAAAA--EQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMS 118
            KRQCVG G    A  EQ+R+DCCRQLAAVDDSWCRC A++HM+GGIYRELGA DVGHPM+
Sbjct  60   KRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 119
Query  119  EVFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 155
            EVF GCRRGDLERAAASLPAFCNVDIPNG GGVCYWL
Sbjct  120  EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWL 156

Sequence Alignment: 4. Allergen Name: Ory s TAI Sequence ID: BAA01998

 Score = 135.3 bits 871,  Expect = 8e-34
 Identities = 123/154 79%, Positives = 135/154 87%, Gaps = 2/154 1%
Query  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRALV 60
            MASNKVVFS LLL +VSVLAAT  MA+ HH+DQVVY+    CQPGMGYPMY LPRCRA+V
Sbjct  1    MASNKVVFSALLLIIVSVLAATTRMAD-HHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
Query  61   KRQCVG-RGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSE 119
            KRQCVG R   A  EQ+ +DCCR+LAAVDDSWCRC A++HM+GGIYRELGA DVGHPM+E
Sbjct  60   KRQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 119
Query  120  VFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 155
            VF GCRRGDLERAAASLPAFCNVDIPNG GGVCYWL
Sbjct  120  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWL 155

Sequence Alignment: 5. Allergen Name: Ory s TAI Sequence ID: BAA07710

 Score = 135.3 bits 871,  Expect = 8e-34
 Identities = 124/154 80%, Positives = 135/154 87%, Gaps = 3/154 1%
Query  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRALV 60
            MASNKVVFS LLL +VSVLAAT  MA+ HH+DQVVY+    CQPGMGYPMY LPRCRA+V
Sbjct  1    MASNKVVFSALLLIIVSVLAATGPMAD-HHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
Query  61   KRQCVGRGTAAA--AEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMS 118
            KRQCV     AA   EQ+R+DCCRQLAAVDDSWCRC A++HM+GGIYRELGA DVGHPM+
Sbjct  60   KRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 119
Query  119  EVFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 155
            EVF GCRRGDLERAAASLPAFCNVDIPNG GGVCYWL
Sbjct  120  EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWL 156

Sequence Alignment: 6. Allergen Name: Ory s TAI Sequence ID: BAA07712

 Score = 132.3 bits 850,  Expect = 6e-33
 Identities = 121/157 77%, Positives = 133/157 84%, Gaps = 3/157 1%
Query  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRALV 60
            MASNKVV   LL+ VVSVLAAT TMA+ HHQ+QVVYTP  LCQPG+GYP YPLPRCRA+V
Sbjct  1    MASNKVVIPALLVVVVSVLAATTTMAD-HHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFV 59
Query  61   KRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEV 120
            KRQCV  GT    EQVRR CCRQLA +D SWCRC+A++HML  IYRE  A D GHPM+EV
Sbjct  60   KRQCVAPGTL--DEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHPMAEV 117
Query  121  FRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY 160
            FRGCRRGD+ERAAASLPAFCNVDIPNG GGVCYWL  +GY
Sbjct  118  FRGCRRGDIERAAASLPAFCNVDIPNGVGGVCYWLPGTGY 157

Sequence Alignment: 7. Allergen Name: Ory s TAI Sequence ID: BAA07711

 Score = 129.7 bits 832,  Expect = 4e-32
 Identities = 116/147 78%, Positives = 128/147 87%, Gaps = 3/147 2%
Query  11   LLLAVVSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRALVKRQCVGRGTA 70
            LLL +VSVLAAT  MA+ HH+DQVVY+    CQPGMGYPMY LPRCRA+VKRQCVG G  
Sbjct  4    LLLIIVSVLAATRRMAD-HHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAP 62
Query  71   AAA--EQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFRGCRRGD 128
              A  EQ+R+DCCRQLAAVDDSWCRC A++HM+GGIYRELGA DVGHPM+EVF GCRRGD
Sbjct  63   GGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGD 122
Query  129  LERAAASLPAFCNVDIPNGGGGVCYWLARS 158
            LERAAASLPAFCNVDIPNG GGVCYWL  +
Sbjct  123  LERAAASLPAFCNVDIPNGTGGVCYWLGYT 152

Sequence Alignment: 8. Allergen Name: Ory s TAI Sequence ID: BAA01997

 Score = 129.0 bits 827,  Expect = 6e-32
 Identities = 119/151 78%, Positives = 131/151 86%, Gaps = 5/151 3%
Query  1    MASNKVVFSVLLLAVVSVLAAT-ATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRAL 59
            MASNKVVFSVLLL V+SVLAA  ATMA+ HHQ   VY+P   C+PG+ YP Y LP+CR L
Sbjct  1    MASNKVVFSVLLLVVLSVLAAAMATMAD-HHQ---VYSPGEQCRPGISYPTYSLPQCRTL 56
Query  60   VKRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSE 119
            V+RQCVGRG +AA EQV +DCCRQLAAVDD WCRC A+ HML GIYRELGA + GHPM+E
Sbjct  57   VRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAE 116
Query  120  VFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 155
            VF GCRRGDLERAAASLPAFCNVDIPNG GGVCYWL
Sbjct  117  VFPGCRRGDLERAAASLPAFCNVDIPNGPGGVCYWL 152

Sequence Alignment: 9. Allergen Name: Ory s TAI Sequence ID: AAB99797

 Score = 125.9 bits 806,  Expect = 5e-31
 Identities = 122/157 77%, Positives = 126/157 80%, Gaps = 3/157 1%
Query  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRALV 60
            MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTP PLCQPGMGYPMYPL R   + 
Sbjct  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPMYPL-RVAGVG 59
Query  61   KRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEV 120
            +   +GR        V  DCCRQ+  VD SWCRCEAISHMLGGIYRELGAPDVGHPMSEV
Sbjct  60   EAPLLGRARPRR-RAVPGDCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMSEV 118
Query  121  FRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY 160
            FRGCRRG    A    P    VDIPNGGGGVCYWLARSGY
Sbjct  119  FRGCRRGTWS-ARRRAPGVLQVDIPNGGGGVCYWLARSGY 157

Sequence Alignment: 10. Allergen Name: Ory s TAI Sequence ID: BAA07773

 Score = 93.7 bits 582,  Expect = 2e-21
 Identities = 79/97 81%, Positives = 87/97 89%, Gaps = 1/97 1%
Query  59   LVKRQCVG-RGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPM 117
            +VKRQCV  R T  A EQ+R+DCCRQLAAVDDSWCRC A++HM+GGIYRELGA DVGHPM
Sbjct  2    VVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM 61
Query  118  SEVFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 155
            +EVF GCRRGDLERA A+LPAFCNVDIPNG GGVCYWL
Sbjct  62   AEVFPGCRRGDLERARATLPAFCNVDIPNGTGGVCYWL 99

Sequence Alignment: 11. Allergen Name: Ory s TAI Sequence ID: BAA07774

 Score = 91.9 bits 569,  Expect = 6e-21
 Identities = 77/95 81%, Positives = 85/95 89%, Gaps = 2/95 2%
Query  61   KRQCVG--RGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMS 118
            +RQCVG  R      +Q+R+DCCRQLAAVDDSWCRC A++HM+GGIYRELGA DVGHPM+
Sbjct  7    QRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 66
Query  119  EVFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 155
            EVF GCRRGDLERAAASLPAFCNVDIPNG GGVCYWL
Sbjct  67   EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWL 103

Sequence Alignment: 12. Allergen Name: Ory s TAI Sequence ID: BAA07772

 Score = 90.9 bits 562,  Expect = 1e-20
 Identities = 78/99 78%, Positives = 84/99 84%, Gaps = 2/99 2%
Query  57   RALVKRQCVGRGTAAA--AEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVG 114
            R  VKRQCV     AA   EQ+R+DCCRQLAAVDDSWCRC A++HM+GGIYRELGA DVG
Sbjct  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 60
Query  115  HPMSEVFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 155
            HPM+EVF GCRRGDLER   SLPAFCNVDIPNG GGVCYWL
Sbjct  61   HPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVCYWL 101

Sequence Alignment: 13. Allergen Name: Hor v 1 Sequence ID: P16968

 Score = 79.2 bits 480,  Expect = 5e-17
 Identities = 67/120 55%, Positives = 83/120 69%, Gaps = 7/120 5%
Query  34   VVYTPAPLCQPGMGYPMYPLPRCRALVKRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCR 93
            V  +P   C PGMGYP+YP+PRCRALVK QC G       E +++DCCRQ+AA+ D WC 
Sbjct  12   VSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAG---GQVVESIQKDCCRQIAAIGDEWCI 68
Query  94   CEAISHMLGGIYRELGAP--DVGHPMSEVFRGCRRGDLERAAASLPAFCNVDIPNGGG-- 149
            C A+  M G +Y+ELG    D    ++EVF GCR   ++RA ASLPA CN  IPN  G  
Sbjct  69   CGALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNGTD 128
Query  150  GVCYWLA 156
            GVCYWL+
Sbjct  129  GVCYWLS 135

Sequence Alignment: 14. Allergen Name: Hor v 15.0101 Sequence ID: P16968

 Score = 79.2 bits 480,  Expect = 5e-17
 Identities = 67/120 55%, Positives = 83/120 69%, Gaps = 7/120 5%
Query  34   VVYTPAPLCQPGMGYPMYPLPRCRALVKRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCR 93
            V  +P   C PGMGYP+YP+PRCRALVK QC G       E +++DCCRQ+AA+ D WC 
Sbjct  12   VSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAG---GQVVESIQKDCCRQIAAIGDEWCI 68
Query  94   CEAISHMLGGIYRELGAP--DVGHPMSEVFRGCRRGDLERAAASLPAFCNVDIPNGGG-- 149
            C A+  M G +Y+ELG    D    ++EVF GCR   ++RA ASLPA CN  IPN  G  
Sbjct  69   CGALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNGTD 128
Query  150  GVCYWLA 156
            GVCYWL+
Sbjct  129  GVCYWLS 135

Sequence Alignment: 15. Allergen Name: Ory s TAI Sequence ID: BAA01999

 Score = 76.2 bits 460,  Expect = 3e-16
 Identities = 69/93 74%, Positives = 79/93 84%, Gaps = 5/93 5%
Query  1    MASNKVVFSVLLLAVVSVLAAT-ATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRAL 59
            MASNKVVFSVLLL V+SVLAA  ATMA+ HHQ   VY+P   C+PG+ YP Y LP+CR L
Sbjct  1    MASNKVVFSVLLLVVLSVLAAAMATMAD-HHQ---VYSPGEQCRPGISYPTYSLPQCRTL 56
Query  60   VKRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAI 97
            V+RQCVGRG +AA EQV +DCCRQLAAVDD WCRC A+
Sbjct  57   VRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGAL 94

Sequence Alignment: 16. Allergen Name: Hor v 1 Sequence ID: CAA08836

 Score = 63.8 bits 372,  Expect = 2e-12
 Identities = 63/141 44%, Positives = 86/141 60%, Gaps = 16/141 11%
Query  5    KVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRALVKRQC 64
            K ++ VLLL ++ V   T   ++          P   C P MG+ + PL RCRALVK +C
Sbjct  7    KSMLLVLLLCMLMVTPMTGARSDNSG-------PWMWCDPEMGHKVSPLTRCRALVKLEC 59
Query  65   VGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFRGC 124
            VG       E V RDCC+++A + + WCRC  +  ML  +Y  LG   VG    EVF GC
Sbjct  60   VGN---RVPEDVLRDCCQEVANISNEWCRCGDLGSMLRSVYAALG---VGGGPEEVFPGC 113
Query  125  RRGDLERAAASLPAFCNVDIPN---GGGGVCYWLARS 158
            ++  ++   A +PA+CNV IPN   G  GVCYW A +
Sbjct  114  QKDVMKLLVAGVPALCNVPIPNEAAGTRGVCYWSAST 150

Sequence Alignment: 17. Allergen Name: Tri a 15.0101 Sequence ID: CBA13560

 Score = 63.3 bits 369,  Expect = 3e-12
 Identities = 59/112 52%, Positives = 74/112 66%, Gaps = 10/112 8%
Query  38   PAPLCQPGMGYPMYPLPRCRALVKRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAI 97
            P   C P  GY +  L  CRA+VK QCVG   +   E V RDCC+QLA V++ WCRCE +
Sbjct  3    PWSWCDPATGYKVSALTGCRAMVKLQCVG---SQVPEAVLRDCCQQLADVNNEWCRCEDL 59
Query  98   SHMLGGIYRELGAPDVGHPMSEVFRGCRRGDLERAAASLPAFCNVDIPNGGG---GVCYW 154
            S ML  +Y+ELGA + G    EV+ GCR+  ++  AAS+P    V IPN  G   GVCYW
Sbjct  60   SSMLRSVYQELGARE-GK---EVLPGCRKEVMKLTAASVPEVRKVPIPNPSGDRAGVCYW 115
Query  155  LA 156
             A
Sbjct  116  AA 117

Sequence Alignment: 18. Allergen Name: Tri a TAI Sequence ID: P01083

 Score = 61.6 bits 357,  Expect = 9e-12
 Identities = 57/112 50%, Positives = 73/112 65%, Gaps = 12/112 10%
Query  38   PAPLCQPGMGYPMYPLPRCRALVKRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAI 97
            P   C P  GY +  L  CRA+VK QCVG   +   E V RDCC+QLA +++ WCRC  +
Sbjct  3    PWSWCNPATGYKVSALTGCRAMVKLQCVG---SQVPEAVLRDCCQQLADINNEWCRCGDL 59
Query  98   SHMLGGIYRELGAPDVGHPMSEVFRGCRRGDLERAAASLPAFCNVDIPNGGG---GVCY- 153
            S ML  +Y+ELG  + G    EV+ GCR+  ++  AAS+P  C V IPN  G   GVCY 
Sbjct  60   SSMLRSVYQELGVRE-GK---EVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYG 115
Query  154  -WLA 156
             W A
Sbjct  116  DWAA 119

Sequence Alignment: 19. Allergen Name: Tri a TAI Sequence ID: P01085

 Score = 51.5 bits 287,  Expect = 1e-08
 Identities = 46/107 42%, Positives = 64/107 59%, Gaps = 9/107 8%
Query  41   LCQPGMGYPMYPLPRCRALVKRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHM 100
            +C PG  + +  LP CR L++ QC G   +   E V RDCC+QLA + + WCRC A+  M
Sbjct  5    MCYPGQAFQVPALPACRPLLRLQCNG---SQVPEAVLRDCCQQLAHISE-WCRCGALYSM 60
Query  101  LGGIYRELGAPDVGHPMSEVFRGCRRGDLERAAASLPAFCN----VDIPNGGGGVC 152
            L  +Y+E GA + G+  +  F  CRR  ++  AAS+ A C     VD    G  VC
Sbjct  61   LDSMYKEHGAQE-GQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115

Sequence Alignment: 20. Allergen Name: Tri a 28.0101 Sequence ID: CAI84642

 Score = 51.1 bits 284,  Expect = 1e-08
 Identities = 46/106 43%, Positives = 63/106 59%, Gaps = 9/106 8%
Query  42   CQPGMGYPMYPLPRCRALVKRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHML 101
            C PG  + +  LP CR L++ QC G   +   E V RDCC+QLA + + WCRC A+  ML
Sbjct  1    CYPGQAFQVPALPACRPLLRLQCNG---SQVPEAVLRDCCQQLAHISE-WCRCGALYSML 56
Query  102  GGIYRELGAPDVGHPMSEVFRGCRRGDLERAAASLPAFCN----VDIPNGGGGVC 152
              +Y+E GA + G+  +  F  CRR  ++  AAS+ A C     VD    G  VC
Sbjct  57   DSMYKEHGAQE-GQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 110

Sequence Alignment: 21. Allergen Name: Tri a TAI Sequence ID: P01084

 Score = 49.1 bits 270,  Expect = 5e-08
 Identities = 45/107 42%, Positives = 62/107 57%, Gaps = 9/107 8%
Query  41   LCQPGMGYPMYPLPRCRALVKRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHM 100
            +C PG  + +  LP CR L+K QC G   +   E V RDCC+QLA + + W RC A+  M
Sbjct  5    MCYPGQAFQVPALPGCRPLLKLQCNG---SQVPEAVLRDCCQQLADISE-WPRCGALYSM 60
Query  101  LGGIYRELGAPDVGHPMSEVFRGCRRGDLERAAASLPAFCN----VDIPNGGGGVC 152
            L  +Y+E G  + G+  +  F  CRR  ++  AAS+ A C     VD    G  VC
Sbjct  61   LDSMYKEHGVSE-GQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115

Sequence Alignment: 22. Allergen Name: Hor v 1 Sequence ID: CAA31794

 Score = 39.1 bits 200,  Expect = 6e-05
 Identities = 50/128 39%, Positives = 70/128 54%, Gaps = 17/128 13%
Query  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRA-L 59
            MAS+   F +    ++SVLA  A   E   +D+        CQ G+ +P  PL  C   +
Sbjct  1    MASDHRRFVLSGAVLLSVLAVAAATLE-SVKDE--------CQLGVDFPHNPLATCHTYV 51
Query  60   VKRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSE 119
            +KR C GRG +     V+  CCR+LAAV D  CRCEA+  ++ G+    G    G     
Sbjct  52   IKRVC-GRGPSRPM-LVKERCCRELAAVPDH-CRCEALRILMDGVRTPEGRVVEGRLGDR 108
Query  120  VFRGCRRGDLERAAASL--PAFCNV 142
              R C R +    AA+L   A CN+
Sbjct  109  --RDCPREEQRAFAATLVTAAECNL 131

Sequence Alignment: 23. Allergen Name: Tri a TAI Sequence ID: CAA39099

 Score = 37.0 bits 185,  Expect = 0.0003
 Identities = 52/121 42%, Positives = 66/121 54%, Gaps = 31/121 25%
Query  1    MASNKVVFSVLLLAV-VSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRAL 59
            MAS   +  +LL AV VSV+AA A                P C PGMG P  PL  CR  
Sbjct  1    MASKSSITHLLLAAVLVSVFAAAAATG-------------PYCYPGMGLPSNPLEGCREY 47
Query  60   VKRQCVGRGTAAAAEQVR-----RD-CCRQLAAVDDSW-CRCEAISHMLGGIYRELGAPD 112
            V +Q  G G   +          RD CC++L   D S  CRCEA+ + +G        P+
Sbjct  48   VAQQTCGVGIVGSPVSTEPGNTPRDRCCKEL--YDASQHCRCEAVRYFIG----RTSDPN 101
Query  113  VGHPMSEVFRGCRRGDLERAAASL--PAFCNV 142
             G  + + + GC R      A  L  P  CNV
Sbjct  102  SG--VLKDLPGCPREPQRDFAKVLVTPGHCNV 131

Sequence Alignment: 24. Allergen Name: Tri a 29.0101 Sequence ID: CAZ76052

 Score = 36.5 bits 182,  Expect = 0.0003
 Identities = 40/93 43%, Positives = 51/93 54%, Gaps = 21/93 22%
Query  40   PLCQPGMGYPMYPLPRCRALVKRQCVG---RGTAAAAE--QVRRD-CCRQLAAVDDSWCR 93
            P C  GMG P+ PL  CR  V +Q  G    G+A + E     RD CC++L       CR
Sbjct  3    PYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQH-CR 61
Query  94   CEAISHMLGGIYRELGAPDVGHPMSEVFR---GCRRGDLERAAASL--PAFCNV 142
            CEA+ + +G   R         P S V++   GC R      A  L  P  CNV
Sbjct  62   CEAVRYFIG---RR------SDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNV 106

Sequence Alignment: 25. Allergen Name: Hor v 1 Sequence ID: P01086

 Score = 36.7 bits 183,  Expect = 0.0003
 Identities = 38/114 33%, Positives = 56/114 49%, Gaps = 7/114 6%
Query  42   CQPGMGYPMYPLPRCRALVKRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHML 101
            C PG   P  PL  CR  V  Q   +G       ++R CC +L+A+  ++CRCEA+  ++
Sbjct  29   CAPGDALPHNPLRACRTYVVSQICHQGPRLLTSDMKRRCCDELSAIP-AYCRCEALRIIM 87
Query  102  GGIYRELGAPDVGHPMSEVFRGCRRGDLERAAASL--PAFCNVDIPNGGGGVCYWLARSG 159
             G+    GA + G    +    C R      AA+L  P  CN+   +G    C  L + G
Sbjct  88   QGVVTWQGAFE-GAYFKDS-PNCPRERQTSYAANLVTPQECNLGTIHGSA-YCPEL-QPG 143
Query  160  Y 160
            Y
Sbjct  144  Y 144

Sequence Alignment: 26. Allergen Name: Hor v 1 Sequence ID: CAA46705

 Score = 36.7 bits 183,  Expect = 0.0003
 Identities = 38/114 33%, Positives = 56/114 49%, Gaps = 7/114 6%
Query  42   CQPGMGYPMYPLPRCRALVKRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHML 101
            C PG   P  PL  CR  V  Q   +G       ++R CC +L+A+  ++CRCEA+  ++
Sbjct  29   CAPGDALPHNPLRACRTYVVSQICHQGPRLLTSDMKRRCCDELSAIP-AYCRCEALRIIM 87
Query  102  GGIYRELGAPDVGHPMSEVFRGCRRGDLERAAASL--PAFCNVDIPNGGGGVCYWLARSG 159
             G+    GA + G    +    C R      AA+L  P  CN+   +G    C  L + G
Sbjct  88   QGVVTWQGAFE-GAYFKDS-PNCPRERQTSYAANLVTPQECNLGTIHGSA-YCPEL-QPG 143
Query  160  Y 160
            Y
Sbjct  144  Y 144

Sequence Alignment: 27. Allergen Name: Tri a 29.0201 Sequence ID: CBA13559

 Score = 36.1 bits 179,  Expect = 0.0004
 Identities = 36/96 37%, Positives = 48/96 50%, Gaps = 15/96 15%
Query  40   PLCQPGMGYPMYPLPRCRALVKRQCVGRGTAAAAEQVR-----RD-CCRQLAAVDDSWCR 93
            P C PGMG P  PL  CR  V +Q  G G   +          RD CC++L       C 
Sbjct  3    PYCYPGMGLPSNPLEGCREYVAQQTCGVGIVGSPVSTEPGNTPRDRCCKELYDASQH-CW 61
Query  94   CEAISHMLGGIYRELGAPDVGHPMSEVFRGCRRGDLERAAASL--PAFCNV 142
            CEA+ + +G        P+ G  + + + GC R     +A  L  P  CNV
Sbjct  62   CEAVRYFIG----RTSDPNSG--VLKDLPGCPREPQRDSAKVLVTPGHCNV 106

Sequence Alignment: 28. Allergen Name: Hor v 1 Sequence ID: CAA35188

 Score = 36.3 bits 180,  Expect = 0.0005
 Identities = 34/103 33%, Positives = 51/103 49%, Gaps = 5/103 4%
Query  42   CQPGMGYPMYPLPRCRALVKRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHML 101
            C PG   P  PL  CR  V  Q   +G       ++R CC +L+A+  ++CRCEA+  ++
Sbjct  29   CAPGDALPHNPLRACRTYVVSQICHQGPRLLTSDMKRRCCDELSAIP-AYCRCEALRIIM 87
Query  102  GGIYRELGAPDVGHPMSEVFRGCRRGDLERAAASL--PAFCNVDIPNG 147
             G+    GA + G    +    C R      AA+L  P  CN+   +G
Sbjct  88   QGVVTWQGAFE-GAYFKDS-PNCPRERQTSYAANLVTPQECNLGTIHG 133

Sequence Alignment: 29. Allergen Name: Hor v 1 Sequence ID: CAA49556

 Score = 35.1 bits 172,  Expect = 0.001
 Identities = 47/121 38%, Positives = 66/121 54%, Gaps = 25/121 20%
Query  1    MASNKVVFSVLLLAV-VSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRAL 59
            MAS K    +LL AV VS++AA A +     +D         C P    P+ PLP CR  
Sbjct  1    MAS-KSSCDLLLAAVLVSIFAAVAAVG---SED---------CTPWTATPITPLPSCRDY 47
Query  60   VKRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSE 119
            V++Q     T       ++ CC +LA +    CRC+A+   +G   R    PD    M  
Sbjct  48   VEQQACRIETPGPPYLAKQQCCGELANIPQQ-CRCQALRFFMGRKSR----PDQSGLME- 101
Query  120  VFRGCRRG---DLERAAASLPAFCNV 142
             + GC R    D+ R   + P FCN+
Sbjct  102  -LPGCPREVQMDFVRILVT-PGFCNL 125

Sequence Alignment: 30. Allergen Name: Tri a TAI Sequence ID: CAA35598

 Score = 35.0 bits 171,  Expect = 0.001
 Identities = 55/117 47%, Positives = 69/117 58%, Gaps = 39/117 33%
Query  1    MASNKVVFSVLLLAV-VSVLAA-TATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRA 58
            MAS   +  +LL  V VSV+AA TAT               P C  GMG P+ PL  CR 
Sbjct  1    MASKSSISPLLLATVLVSVFAAATAT--------------GPYCYAGMGLPINPLEGCRE 46
Query  59   LVKRQCVG---RGTAAAAE--QVRRD-CCRQLAAVDDSW-CRCEAISHMLGGIYRELGAP 111
             V +Q  G    G+A + E     RD CC++L   D S  CRCEA+ + +G   R     
Sbjct  47   YVAQQTCGISISGSAVSTEPGNTPRDRCCKEL--YDASQHCRCEAVRYFIG---RR---- 97
Query  112  DVGHPMSEVFR---GCRRGDLERAAASL--PAFCNV 142
                P S V++   GC R      A  L     CNV
Sbjct  98   --SDPNSSVLKDLPGCPREPQRDFAKVLVTSGHCNV 131

Sequence Alignment: 31. Allergen Name: Tri a TAI Sequence ID: CAA34709

 Score = 34.6 bits 168,  Expect = 0.001
 Identities = 43/113 38%, Positives = 66/113 58%, Gaps = 25/113 22%
Query  10   VLLLA--VVSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRALVKRQCVGR 67
            VLLLA  +VS++AA A +    ++D         C P M   + PLP CR  V++Q    
Sbjct  8    VLLLAAVLVSIFAAVAAIG---NED---------CTPWMSTLITPLPSCRDYVEQQACRI 55
Query  68   GTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFRGCRRG 127
             T  +    ++ CC +LA +    CRC+A+ + +G   R    PD    M   + GC R 
Sbjct  56   ETPGSPYLAKQQCCGELANIPQQ-CRCQALRYFMGPKSR----PDQSGLME--LPGCPRE 108
Query  128  ---DLERAAASLPAFCNV 142
               D+ R   + P +CN+
Sbjct  109  VQMDFVRILVT-PGYCNL 125

Sequence Alignment: 32. Allergen Name: Tri a TAI Sequence ID: CAA42453

 Score = 32.4 bits 153,  Expect = 0.007
 Identities = 40/121 33%, Positives = 67/121 55%, Gaps = 25/121 20%
Query  1    MASNKVVFSVLLLAV-VSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRAL 59
            MAS K  +++L+ A+ V ++AA A +    ++D         C P     + PLP CR  
Sbjct  1    MAS-KSNYNLLFTALLVFIFAAVAAVG---NED---------CTPWTSTLITPLPSCRNY 47
Query  60   VKRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSE 119
            V+ Q             +++CC QLA +    CRC+A+ + +G   R    PD    M  
Sbjct  48   VEEQACRIEMPGPPYLAKQECCEQLANIPQQ-CRCQALRYFMGPKSR----PDQSGLME- 101
Query  120  VFRGCRRGDLERAAASL---PAFCNV 142
             + GC R +++     +   P +CN+
Sbjct  102  -LPGCPR-EVQMNFVPILVTPGYCNL 125

Sequence Alignment: 33. Allergen Name: Tri a 40.0101 Sequence ID: Q41540

 Score = 32.4 bits 153,  Expect = 0.007
 Identities = 40/121 33%, Positives = 67/121 55%, Gaps = 25/121 20%
Query  1    MASNKVVFSVLLLAV-VSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRAL 59
            MAS K  +++L+ A+ V ++AA A +    ++D         C P     + PLP CR  
Sbjct  1    MAS-KSNYNLLFTALLVFIFAAVAAVG---NED---------CTPWTSTLITPLPSCRNY 47
Query  60   VKRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSE 119
            V+ Q             +++CC QLA +    CRC+A+ + +G   R    PD    M  
Sbjct  48   VEEQACRIEMPGPPYLAKQECCEQLANIPQQ-CRCQALRYFMGPKSR----PDQSGLME- 101
Query  120  VFRGCRRGDLERAAASL---PAFCNV 142
             + GC R +++     +   P +CN+
Sbjct  102  -LPGCPR-EVQMNFVPILVTPGYCNL 125

Sequence Alignment: 34. Allergen Name: Hor v 1 Sequence ID: CAA49555

 Score = 32.0 bits 150,  Expect = 0.009
 Identities = 48/119 40%, Positives = 66/119 55%, Gaps = 35/119 29%
Query  1    MASNKVVFSVLLLAVV-SVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRAL 59
            MAS   +  +LL AV+ SV+AA     +Y             C  GMG P  PL  CR  
Sbjct  1    MASKSSITPLLLAAVLASVFAAATATGQY-------------CYAGMGLPSNPLEGCREY 47
Query  60   VKRQCVG---RGTAAAAE--QVRRD-CCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDV 113
            V +Q  G    G+  ++E     +D CC++L       CRCEA+ + +G   R       
Sbjct  48   VAQQTCGVTIAGSPVSSEPGDTPKDRCCQELDEAPQH-CRCEAVRYFIG---RR------ 97
Query  114  GHPMSEVFR---GCRRGDLERAAASL--PAFCNV 142
             HP   V++   GC +      A  L  P  CNV
Sbjct  98   SHPDWSVLKDLPGCPKEPQRDFAKVLVTPGQCNV 131

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.