The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPMYPLRVAGVGE
APLLGRARPRRRAVPGDCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFR
GCRRGTWSARRRAPGVLQVDIPNGGGGVCYWLARSGY
Sequence Info Allergen Name Length Opt Bits Score E Value
AAB99797 Ory s TAI 157 1130 219.0 4.6e-59
BAA07713 Ory s TAI 160 806 158.8 6.6e-41
BAA01996 Ory s TAI 157 748 148.0 1.1e-37
BAA02000 Ory s TAI 166 639 127.7 1.6e-31
BAA07710 Ory s TAI 166 635 126.9 2.6e-31
BAA01998 Ory s TAI 165 625 125.1 9.5e-31
BAA07712 Ory s TAI 157 597 119.9 3.3e-29
BAA07711 Ory s TAI 160 574 115.6 6.5e-28
BAA01997 Ory s TAI 162 556 112.2 6.8e-27
BAA07772 Ory s TAI 111 420 87.1 1.7e-19
BAA07774 Ory s TAI 113 404 84.1 1.4e-18
BAA07773 Ory s TAI 109 403 84.0 1.5e-18
BAA01999 Ory s TAI 95 294 63.7 1.6e-12
P16968 Hor v 1 146 288 62.4 6e-12
P16968 Hor v 15.0101 146 288 62.4 6e-12
CBA13560 Tri a 15.0101 121 250 55.4 6.3e-10
P01083 Tri a TAI 123 222 50.2 2.4e-08
CAA08836 Hor v 1 152 222 50.1 3.2e-08
P01085 Tri a TAI 124 174 41.3 1.2e-05
CAI84642 Tri a 28.0101 119 165 39.6 3.6e-05
P01084 Tri a TAI 124 164 39.4 4.3e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s TAI Sequence ID: AAB99797

 Score = 219.0 bits 1130,  Expect = 5e-59
 Identities = 157/157 100%, Positives = 157/157 100%, Gaps = 0/157 0%
Query  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPMYPLRVAGVGE 60
            MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPMYPLRVAGVGE
Sbjct  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPMYPLRVAGVGE 60
Query  61   APLLGRARPRRRAVPGDCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFR 120
            APLLGRARPRRRAVPGDCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFR
Sbjct  61   APLLGRARPRRRAVPGDCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFR 120
Query  121  GCRRGTWSARRRAPGVLQVDIPNGGGGVCYWLARSGY 157
            GCRRGTWSARRRAPGVLQVDIPNGGGGVCYWLARSGY
Sbjct  121  GCRRGTWSARRRAPGVLQVDIPNGGGGVCYWLARSGY 157

Sequence Alignment: 2. Allergen Name: Ory s TAI Sequence ID: BAA07713

 Score = 158.8 bits 806,  Expect = 7e-41
 Identities = 122/157 77%, Positives = 126/157 80%, Gaps = 3/157 1%
Query  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPMYPL-RVAGVG 59
            MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTP PLCQPGMGYPMYPL R   + 
Sbjct  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRALV 60
Query  60   EAPLLGRARPRR-RAVPGDCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMSEV 118
            +   +GR        V  DCCRQ+  VD SWCRCEAISHMLGGIYRELGAPDVGHPMSEV
Sbjct  61   KRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEV 120
Query  119  FRGCRRGTWS-ARRRAPGVLQVDIPNGGGGVCYWLARSGY 157
            FRGCRRG    A    P    VDIPNGGGGVCYWLARSGY
Sbjct  121  FRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY 160

Sequence Alignment: 3. Allergen Name: Ory s TAI Sequence ID: BAA01996

 Score = 148.0 bits 748,  Expect = 1e-37
 Identities = 118/155 76%, Positives = 122/155 78%, Gaps = 4/155 2%
Query  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPMYPL-RVAGVG 59
            MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYT    CQPGMGYPMY L R   + 
Sbjct  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTRAR-CQPGMGYPMYSLPRCRALV 59
Query  60   EAPLLGRARPRRRAVPGDCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMSEVF 119
            +    G A    + V  DCCRQ+  VD SWCRCEAISHMLGGIYRELGAPDVGHPMSEVF
Sbjct  60   KRQCRGSAAAAEQ-VRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEVF 118
Query  120  RGCRRGTWS-ARRRAPGVLQVDIPNGGGGVCYWLARSGY 157
            RGCRRG    A    P    VDIPNGGGGVCYWLARSGY
Sbjct  119  RGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY 157

Sequence Alignment: 4. Allergen Name: Ory s TAI Sequence ID: BAA02000

 Score = 127.7 bits 639,  Expect = 2e-31
 Identities = 99/151 65%, Positives = 111/151 73%, Gaps = 6/151 3%
Query  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPMYPL-RVAGVG 59
            MASNKVVFS LLL +VSVLAATATMA+ HH+DQVVY+ G  CQPGMGYPMY L R   V 
Sbjct  1    MASNKVVFSALLLIIVSVLAATATMAD-HHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
Query  60   EAPLLGRARPR---RRAVPGDCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMS 116
            +   +G   P       +  DCCRQ+  VD SWCRC A++HM+GGIYRELGA DVGHPM+
Sbjct  60   KRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 119
Query  117  EVFRGCRRGTWS-ARRRAPGVLQVDIPNGGGGVCYWL 152
            EVF GCRRG    A    P    VDIPNG GGVCYWL
Sbjct  120  EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWL 156

Sequence Alignment: 5. Allergen Name: Ory s TAI Sequence ID: BAA07710

 Score = 126.9 bits 635,  Expect = 3e-31
 Identities = 98/151 64%, Positives = 110/151 72%, Gaps = 6/151 3%
Query  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPMYPL-RVAGVG 59
            MASNKVVFS LLL +VSVLAAT  MA+ HH+DQVVY+ G  CQPGMGYPMY L R   V 
Sbjct  1    MASNKVVFSALLLIIVSVLAATGPMAD-HHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
Query  60   EAPLLGRARPRRRA---VPGDCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMS 116
            +   +  A P  R    +  DCCRQ+  VD SWCRC A++HM+GGIYRELGA DVGHPM+
Sbjct  60   KRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 119
Query  117  EVFRGCRRGTWS-ARRRAPGVLQVDIPNGGGGVCYWL 152
            EVF GCRRG    A    P    VDIPNG GGVCYWL
Sbjct  120  EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWL 156

Sequence Alignment: 6. Allergen Name: Ory s TAI Sequence ID: BAA01998

 Score = 125.1 bits 625,  Expect = 9e-31
 Identities = 96/151 63%, Positives = 109/151 72%, Gaps = 5/151 3%
Query  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPMYPL-RVAGVG 59
            MASNKVVFS LLL +VSVLAAT  MA+ HH+DQVVY+ G  CQPGMGYPMY L R   V 
Sbjct  1    MASNKVVFSALLLIIVSVLAATTRMAD-HHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
Query  60   EAPLLGRARPRR--RAVPGDCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMSE 117
            +   +G   P      +  DCCR++  VD SWCRC A++HM+GGIYRELGA DVGHPM+E
Sbjct  60   KRQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 119
Query  118  VFRGCRRGTWS-ARRRAPGVLQVDIPNGGGGVCYWL 152
            VF GCRRG    A    P    VDIPNG GGVCYWL
Sbjct  120  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWL 155

Sequence Alignment: 7. Allergen Name: Ory s TAI Sequence ID: BAA07712

 Score = 119.9 bits 597,  Expect = 3e-29
 Identities = 98/147 66%, Positives = 111/147 75%, Gaps = 20/147 13%
Query  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPMYPLRVAGVGE 60
            MASNKVV   LL+ VVSVLAAT TMA+ HHQ+QVVYTPG LCQPG+GYP YPL       
Sbjct  1    MASNKVVIPALLVVVVSVLAATTTMAD-HHQEQVVYTPGQLCQPGIGYPTYPL------- 52
Query  61   APLLGRARPRRRAV-PGD--------CCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDV 111
             P   RA  +R+ V PG         CCRQ+  +D SWCRC+A++HML  IYRE  A D 
Sbjct  53   -PRC-RAFVKRQCVAPGTLDEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADA 110
Query  112  GHPMSEVFRGCRRGTWS-ARRRAPGVLQVDIPNGGGGVCYWLARSGY 157
            GHPM+EVFRGCRRG    A    P    VDIPNG GGVCYWL  +GY
Sbjct  111  GHPMAEVFRGCRRGDIERAAASLPAFCNVDIPNGVGGVCYWLPGTGY 157

Sequence Alignment: 8. Allergen Name: Ory s TAI Sequence ID: BAA07711

 Score = 115.6 bits 574,  Expect = 7e-28
 Identities = 88/144 61%, Positives = 101/144 70%, Gaps = 6/144 4%
Query  11   LLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPMYPL-RVAGVGEAPLLGRARP 69
            LLL +VSVLAAT  MA+ HH+DQVVY+ G  CQPGMGYPMY L R   V +   +G   P
Sbjct  4    LLLIIVSVLAATRRMAD-HHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAP 62
Query  70   R---RRAVPGDCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFRGCRRGT 126
                   +  DCCRQ+  VD SWCRC A++HM+GGIYRELGA DVGHPM+EVF GCRRG 
Sbjct  63   GGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGD 122
Query  127  WS-ARRRAPGVLQVDIPNGGGGVCYWLARS 155
               A    P    VDIPNG GGVCYWL  +
Sbjct  123  LERAAASLPAFCNVDIPNGTGGVCYWLGYT 152

Sequence Alignment: 9. Allergen Name: Ory s TAI Sequence ID: BAA01997

 Score = 112.2 bits 556,  Expect = 7e-27
 Identities = 91/148 61%, Positives = 103/148 69%, Gaps = 8/148 5%
Query  1    MASNKVVFSVLLLAVVSVLAAT-ATMAEYHHQDQVVYTPGPLCQPGMGYPMYPL-RVAGV 58
            MASNKVVFSVLLL V+SVLAA  ATMA+ HHQ   VY+PG  C+PG+ YP Y L +   +
Sbjct  1    MASNKVVFSVLLLVVLSVLAAAMATMAD-HHQ---VYSPGEQCRPGISYPTYSLPQCRTL 56
Query  59   GEAPLLGR-ARPRRRAVPGDCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMSE 117
                 +GR A      V  DCCRQ+  VD  WCRC A+ HML GIYRELGA + GHPM+E
Sbjct  57   VRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAE 116
Query  118  VFRGCRRGTWS-ARRRAPGVLQVDIPNGGGGVCYWL 152
            VF GCRRG    A    P    VDIPNG GGVCYWL
Sbjct  117  VFPGCRRGDLERAAASLPAFCNVDIPNGPGGVCYWL 152

Sequence Alignment: 10. Allergen Name: Ory s TAI Sequence ID: BAA07772

 Score = 87.1 bits 420,  Expect = 2e-19
 Identities = 57/86 66%, Positives = 64/86 74%, Gaps = 1/86 1%
Query  67   ARPRRRAVPGDCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFRGCRRGT 126
            A P    +  DCCRQ+  VD SWCRC A++HM+GGIYRELGA DVGHPM+EVF GCRRG 
Sbjct  15   AAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGD 74
Query  127  WSARRRA-PGVLQVDIPNGGGGVCYWL 152
               RRR+ P    VDIPNG GGVCYWL
Sbjct  75   LERRRRSLPAFCNVDIPNGTGGVCYWL 101

Sequence Alignment: 11. Allergen Name: Ory s TAI Sequence ID: BAA07774

 Score = 84.1 bits 404,  Expect = 1e-18
 Identities = 58/89 65%, Positives = 65/89 73%, Gaps = 4/89 4%
Query  64   LGRARPRRR---AVPGDCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFR 120
            +G  R RRR    +  DCCRQ+  VD SWCRC A++HM+GGIYRELGA DVGHPM+EVF 
Sbjct  11   VGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFP 70
Query  121  GCRRGTWS-ARRRAPGVLQVDIPNGGGGVCYWL 152
            GCRRG    A    P    VDIPNG GGVCYWL
Sbjct  71   GCRRGDLERAAASLPAFCNVDIPNGTGGVCYWL 103

Sequence Alignment: 12. Allergen Name: Ory s TAI Sequence ID: BAA07773

 Score = 84.0 bits 403,  Expect = 1e-18
 Identities = 54/76 71%, Positives = 59/76 77%, Gaps = 1/76 1%
Query  77   DCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFRGCRRGTWS-ARRRAPG 135
            DCCRQ+  VD SWCRC A++HM+GGIYRELGA DVGHPM+EVF GCRRG    AR   P 
Sbjct  23   DCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERARATLPA 82
Query  136  VLQVDIPNGGGGVCYWL 152
               VDIPNG GGVCYWL
Sbjct  83   FCNVDIPNGTGGVCYWL 99

Sequence Alignment: 13. Allergen Name: Ory s TAI Sequence ID: BAA01999

 Score = 63.7 bits 294,  Expect = 2e-12
 Identities = 53/91 58%, Positives = 63/91 69%, Gaps = 7/91 7%
Query  1    MASNKVVFSVLLLAVVSVLAAT-ATMAEYHHQDQVVYTPGPLCQPGMGYPMYPL-RVAGV 58
            MASNKVVFSVLLL V+SVLAA  ATMA+ HHQ   VY+PG  C+PG+ YP Y L +   +
Sbjct  1    MASNKVVFSVLLLVVLSVLAAAMATMAD-HHQ---VYSPGEQCRPGISYPTYSLPQCRTL 56
Query  59   GEAPLLGR-ARPRRRAVPGDCCRQFPPVDYSWCRCEAI 95
                 +GR A      V  DCCRQ+  VD  WCRC A+
Sbjct  57   VRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGAL 94

Sequence Alignment: 14. Allergen Name: Hor v 1 Sequence ID: P16968

 Score = 62.4 bits 288,  Expect = 6e-12
 Identities = 49/118 41%, Positives = 64/118 54%, Gaps = 8/118 6%
Query  34   VVYTPGPLCQPGMGYPMYPL-RVAGVGEAPLLGRARPRRRAVPGDCCRQFPPVDYSWCRC 92
            V  +PG  C PGMGYP+YP+ R   + ++   G       ++  DCCRQ   +   WC C
Sbjct  12   VSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAGGQVVE--SIQKDCCRQIAAIGDEWCIC 69
Query  93   EAISHMLGGIYRELGAP--DVGHPMSEVFRGCRRGTWS-ARRRAPGVLQVDIPNGGG--G 147
             A+  M G +Y+ELG    D    ++EVF GCR      A    P V    IPN  G  G
Sbjct  70   GALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNGTDG 129
Query  148  VCYWLA 153
            VCYWL+
Sbjct  130  VCYWLS 135

Sequence Alignment: 15. Allergen Name: Hor v 15.0101 Sequence ID: P16968

 Score = 62.4 bits 288,  Expect = 6e-12
 Identities = 49/118 41%, Positives = 64/118 54%, Gaps = 8/118 6%
Query  34   VVYTPGPLCQPGMGYPMYPL-RVAGVGEAPLLGRARPRRRAVPGDCCRQFPPVDYSWCRC 92
            V  +PG  C PGMGYP+YP+ R   + ++   G       ++  DCCRQ   +   WC C
Sbjct  12   VSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAGGQVVE--SIQKDCCRQIAAIGDEWCIC 69
Query  93   EAISHMLGGIYRELGAP--DVGHPMSEVFRGCRRGTWS-ARRRAPGVLQVDIPNGGG--G 147
             A+  M G +Y+ELG    D    ++EVF GCR      A    P V    IPN  G  G
Sbjct  70   GALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNGTDG 129
Query  148  VCYWLA 153
            VCYWL+
Sbjct  130  VCYWLS 135

Sequence Alignment: 16. Allergen Name: Tri a 15.0101 Sequence ID: CBA13560

 Score = 55.4 bits 250,  Expect = 6e-10
 Identities = 47/110 42%, Positives = 61/110 55%, Gaps = 11/110 10%
Query  38   PGPLCQPGMGYPMYPLR-VAGVGEAPLLGRARPRRRAVPGDCCRQFPPVDYSWCRCEAIS 96
            P   C P  GY +  L     + +   +G   P   AV  DCC+Q+  V+  WCRCE +S
Sbjct  3    PWSWCDPATGYKVSALTGCRAMVKLQCVGSQVP--EAVLRDCCQQLADVNNEWCRCEDLS 60
Query  97   HMLGGIYRELGAPDVGHPMSEVFRGCRRGTWS-ARRRAPGVLQVDIPNGGG---GVCYWL 152
             ML  +Y+ELGA + G    EV+ GCR+          P V +V IPN  G   GVCYW 
Sbjct  61   SMLRSVYQELGARE-GK---EVLPGCRKEVMKLTAASVPEVRKVPIPNPSGDRAGVCYWA 116
Query  153  A 153
            A
Sbjct  117  A 117

Sequence Alignment: 17. Allergen Name: Tri a TAI Sequence ID: P01083

 Score = 50.2 bits 222,  Expect = 2e-08
 Identities = 44/110 40%, Positives = 59/110 53%, Gaps = 13/110 11%
Query  38   PGPLCQPGMGYPMYPLR-VAGVGEAPLLGRARPRRRAVPGDCCRQFPPVDYSWCRCEAIS 96
            P   C P  GY +  L     + +   +G   P   AV  DCC+Q+  ++  WCRC  +S
Sbjct  3    PWSWCNPATGYKVSALTGCRAMVKLQCVGSQVP--EAVLRDCCQQLADINNEWCRCGDLS 60
Query  97   HMLGGIYRELGAPDVGHPMSEVFRGCRRGTWS-ARRRAPGVLQVDIPNGGG---GVCY-- 150
             ML  +Y+ELG  + G    EV+ GCR+          P V +V IPN  G   GVCY  
Sbjct  61   SMLRSVYQELGVRE-GK---EVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGD 116
Query  151  WLA 153
            W A
Sbjct  117  WAA 119

Sequence Alignment: 18. Allergen Name: Hor v 1 Sequence ID: CAA08836

 Score = 50.1 bits 222,  Expect = 3e-08
 Identities = 50/137 36%, Positives = 70/137 51%, Gaps = 21/137 15%
Query  5    KVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPL--CQPGMGYPMYPL-RVAGVGEA 61
            K ++ VLLL ++ V   T   ++           GP   C P MG+ + PL R   + + 
Sbjct  7    KSMLLVLLLCMLMVTPMTGARSD---------NSGPWMWCDPEMGHKVSPLTRCRALVKL 57
Query  62   PLLGRARPRRRAVPGDCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFRG 121
              +G   P    V  DCC++   +   WCRC  +  ML  +Y  LG   VG    EVF G
Sbjct  58   ECVGNRVPED--VLRDCCQEVANISNEWCRCGDLGSMLRSVYAALG---VGGGPEEVFPG 112
Query  122  CRRGTWSARRRA-PGVLQVDIPN---GGGGVCYWLARS 155
            C++          P +  V IPN   G  GVCYW A +
Sbjct  113  CQKDVMKLLVAGVPALCNVPIPNEAAGTRGVCYWSAST 150

Sequence Alignment: 19. Allergen Name: Tri a TAI Sequence ID: P01085

 Score = 41.3 bits 174,  Expect = 1e-05
 Identities = 42/101 41%, Positives = 56/101 55%, Gaps = 23/101 22%
Query  39   GP-LCQPGMGYPMYPLRVAGVGEAPLL-----GRARPRRRAVPGDCCRQFPPVDYSWCRC 92
            GP +C PG  + +  L        PLL     G   P   AV  DCC+Q+  +   WCRC
Sbjct  2    GPWMCYPGQAFQVPALPAC----RPLLRLQCNGSQVPE--AVLRDCCQQLAHIS-EWCRC 54
Query  93   EAISHMLGGIYRELGAPDVGHPMSEVFRGCRR-------GTWSARRRAPGVLQVDIPNGG 145
             A+  ML  +Y+E GA + G+  +  F  CRR        + +A  R P V  VD    G
Sbjct  55   GALYSMLDSMYKEHGAQE-GQAGTGAFPRCRREVVKLTAASITAVCRLPIV--VDASGDG 111
Query  146  GGVC 149
              VC
Sbjct  112  AYVC 115

Sequence Alignment: 20. Allergen Name: Tri a 28.0101 Sequence ID: CAI84642

 Score = 39.6 bits 165,  Expect = 4e-05
 Identities = 40/98 40%, Positives = 53/98 54%, Gaps = 22/98 22%
Query  42   CQPGMGYPMYPLRVAGVGEAPLL-----GRARPRRRAVPGDCCRQFPPVDYSWCRCEAIS 96
            C PG  + +  L        PLL     G   P   AV  DCC+Q+  +   WCRC A+ 
Sbjct  1    CYPGQAFQVPALPAC----RPLLRLQCNGSQVP--EAVLRDCCQQLAHIS-EWCRCGALY 53
Query  97   HMLGGIYRELGAPDVGHPMSEVFRGCRR-------GTWSARRRAPGVLQVDIPNGGGGVC 149
             ML  +Y+E GA + G+  +  F  CRR        + +A  R P V  VD    G  VC
Sbjct  54   SMLDSMYKEHGAQE-GQAGTGAFPRCRREVVKLTAASITAVCRLPIV--VDASGDGAYVC 110

Sequence Alignment: 21. Allergen Name: Tri a TAI Sequence ID: P01084

 Score = 39.4 bits 164,  Expect = 4e-05
 Identities = 42/99 42%, Positives = 55/99 55%, Gaps = 27/99 27%
Query  39   GP-LCQPGMGY--PMYPLRVAGVGEAPLL-----GRARPRRRAVPGDCCRQFPPVDYSWC 90
            GP +C PG  +  P  P      G  PLL     G   P   AV  DCC+Q+  +   W 
Sbjct  2    GPWMCYPGQAFQVPALP------GCRPLLKLQCNGSQVPE--AVLRDCCQQLADIS-EWP 52
Query  91   RCEAISHMLGGIYRELGAPDVGHPMSEVFRGCRR-------GTWSARRRAPGVLQVDIPN 143
            RC A+  ML  +Y+E G  + G+  +  F  CRR        + +A  R P V  VD   
Sbjct  53   RCGALYSMLDSMYKEHGVSE-GQAGTGAFPSCRREVVKLTAASITAVCRLPIV--VDASG 109
Query  144  GGGGVC 149
             G  VC
Sbjct  110  DGAYVC 115

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.