The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTRARCQPGMGYPMYSLPRCRALVK
RQCRGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFRG
CRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY
Sequence Info Allergen Name Length Opt Bits Score E Value
BAA01996 Ory s TAI 157 1103 165.4 6.7e-43
BAA07713 Ory s TAI 160 1048 157.6 1.4e-40
BAA02000 Ory s TAI 166 882 134.4 1.5e-33
BAA07710 Ory s TAI 166 869 132.6 5.3e-33
BAA01998 Ory s TAI 165 861 131.4 1.1e-32
BAA07711 Ory s TAI 160 817 125.2 8.1e-31
BAA07712 Ory s TAI 157 806 123.7 2.3e-30
BAA01997 Ory s TAI 162 787 121.0 1.5e-29
AAB99797 Ory s TAI 157 748 115.6 6.5e-28
BAA07773 Ory s TAI 109 570 90.4 1.7e-20
BAA07774 Ory s TAI 113 555 88.3 7.4e-20
BAA07772 Ory s TAI 111 552 87.9 9.8e-20
P16968 Hor v 1 146 461 75.3 8.2e-16
P16968 Hor v 15.0101 146 461 75.3 8.2e-16
BAA01999 Ory s TAI 95 420 69.3 3.3e-14
CBA13560 Tri a 15.0101 121 367 62.0 6.7e-12
CAA08836 Hor v 1 152 357 60.7 2.1e-11
P01083 Tri a TAI 123 355 60.3 2.2e-11
CAI84642 Tri a 28.0101 119 296 52.0 6.6e-09
P01085 Tri a TAI 124 296 52.0 6.8e-09
P01084 Tri a TAI 124 279 49.7 3.6e-08
CAA31794 Hor v 1 147 197 38.2 0.00012
CAA34709 Tri a TAI 143 170 34.4 0.0016
P01086 Hor v 1 144 166 33.9 0.0023
CAA46705 Hor v 1 148 166 33.9 0.0024
CAA49556 Hor v 1 149 166 33.9 0.0024
CAA35188 Hor v 1 144 163 33.5 0.0031
CAA39099 Tri a TAI 145 160 33.1 0.0042
CAA35598 Tri a TAI 145 159 32.9 0.0046
CAZ76052 Tri a 29.0101 120 155 32.3 0.006
CBA13559 Tri a 29.0201 120 154 32.1 0.0066
CAA49555 Hor v 1 145 153 32.1 0.0082
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s TAI Sequence ID: BAA01996

 Score = 165.4 bits 1103,  Expect = 7e-43
 Identities = 157/157 100%, Positives = 157/157 100%, Gaps = 0/157 0%
Query  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTRARCQPGMGYPMYSLPRCRALVK 60
            MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTRARCQPGMGYPMYSLPRCRALVK
Sbjct  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTRARCQPGMGYPMYSLPRCRALVK 60
Query  61   RQCRGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFRG 120
            RQCRGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFRG
Sbjct  61   RQCRGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFRG 120
Query  121  CRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY 157
            CRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY
Sbjct  121  CRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY 157

Sequence Alignment: 2. Allergen Name: Ory s TAI Sequence ID: BAA07713

 Score = 157.6 bits 1048,  Expect = 1e-40
 Identities = 153/157 97%, Positives = 154/157 98%, Gaps = 3/157 1%
Query  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTRAR-CQPGMGYPMYSLPRCRALV 59
            MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYT A  CQPGMGYPMY LPRCRALV
Sbjct  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRALV 60
Query  60   KRQC--RGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEV 117
            KRQC  RG+AAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEV
Sbjct  61   KRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEV 120
Query  118  FRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY 157
            FRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY
Sbjct  121  FRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY 160

Sequence Alignment: 3. Allergen Name: Ory s TAI Sequence ID: BAA02000

 Score = 134.4 bits 882,  Expect = 1e-33
 Identities = 127/151 84%, Positives = 138/151 91%, Gaps = 6/151 3%
Query  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTRA-RCQPGMGYPMYSLPRCRALV 59
            MASNKVVFS LLL +VSVLAATATMA+ HH+DQVVY+   RCQPGMGYPMYSLPRCRA+V
Sbjct  1    MASNKVVFSALLLIIVSVLAATATMAD-HHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
Query  60   KRQCRGSAAAA----EQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMS 115
            KRQC G  A      EQ+R+DCCRQLAAVDDSWCRC A++HM+GGIYRELGA DVGHPM+
Sbjct  60   KRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 119
Query  116  EVFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 152
            EVF GCRRGDLERAAASLPAFCNVDIPNG GGVCYWL
Sbjct  120  EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWL 156

Sequence Alignment: 4. Allergen Name: Ory s TAI Sequence ID: BAA07710

 Score = 132.6 bits 869,  Expect = 5e-33
 Identities = 125/151 82%, Positives = 137/151 90%, Gaps = 6/151 3%
Query  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTRA-RCQPGMGYPMYSLPRCRALV 59
            MASNKVVFS LLL +VSVLAAT  MA+ HH+DQVVY+   RCQPGMGYPMYSLPRCRA+V
Sbjct  1    MASNKVVFSALLLIIVSVLAATGPMAD-HHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
Query  60   KRQCRGSAAAA----EQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMS 115
            KRQC  +A  A    EQ+R+DCCRQLAAVDDSWCRC A++HM+GGIYRELGA DVGHPM+
Sbjct  60   KRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 119
Query  116  EVFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 152
            EVF GCRRGDLERAAASLPAFCNVDIPNG GGVCYWL
Sbjct  120  EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWL 156

Sequence Alignment: 5. Allergen Name: Ory s TAI Sequence ID: BAA01998

 Score = 131.4 bits 861,  Expect = 1e-32
 Identities = 123/151 81%, Positives = 136/151 90%, Gaps = 5/151 3%
Query  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTRA-RCQPGMGYPMYSLPRCRALV 59
            MASNKVVFS LLL +VSVLAAT  MA+ HH+DQVVY+   RCQPGMGYPMYSLPRCRA+V
Sbjct  1    MASNKVVFSALLLIIVSVLAATTRMAD-HHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
Query  60   KRQCRGS---AAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSE 116
            KRQC G+    A  EQ+ +DCCR+LAAVDDSWCRC A++HM+GGIYRELGA DVGHPM+E
Sbjct  60   KRQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 119
Query  117  VFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 152
            VF GCRRGDLERAAASLPAFCNVDIPNG GGVCYWL
Sbjct  120  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWL 155

Sequence Alignment: 6. Allergen Name: Ory s TAI Sequence ID: BAA07711

 Score = 125.2 bits 817,  Expect = 8e-31
 Identities = 116/144 80%, Positives = 128/144 88%, Gaps = 6/144 4%
Query  11   LLLAVVSVLAATATMAEYHHQDQVVYTRA-RCQPGMGYPMYSLPRCRALVKRQCRGSAAA 69
            LLL +VSVLAAT  MA+ HH+DQVVY+   RCQPGMGYPMYSLPRCRA+VKRQC G  A 
Sbjct  4    LLLIIVSVLAATRRMAD-HHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAP 62
Query  70   A----EQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFRGCRRGD 125
                 EQ+R+DCCRQLAAVDDSWCRC A++HM+GGIYRELGA DVGHPM+EVF GCRRGD
Sbjct  63   GGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGD 122
Query  126  LERAAASLPAFCNVDIPNGGGGVCYWLARS 155
            LERAAASLPAFCNVDIPNG GGVCYWL  +
Sbjct  123  LERAAASLPAFCNVDIPNGTGGVCYWLGYT 152

Sequence Alignment: 7. Allergen Name: Ory s TAI Sequence ID: BAA07712

 Score = 123.7 bits 806,  Expect = 2e-30
 Identities = 115/156 73%, Positives = 128/156 82%, Gaps = 2/156 1%
Query  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTRAR-CQPGMGYPMYSLPRCRALV 59
            MASNKVV   LL+ VVSVLAAT TMA+ HHQ+QVVYT  + CQPG+GYP Y LPRCRA+V
Sbjct  1    MASNKVVIPALLVVVVSVLAATTTMAD-HHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFV 59
Query  60   KRQCRGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFR 119
            KRQC       EQVRR CCRQLA +D SWCRC+A++HML  IYRE  A D GHPM+EVFR
Sbjct  60   KRQCVAPGTLDEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHPMAEVFR 119
Query  120  GCRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY 157
            GCRRGD+ERAAASLPAFCNVDIPNG GGVCYWL  +GY
Sbjct  120  GCRRGDIERAAASLPAFCNVDIPNGVGGVCYWLPGTGY 157

Sequence Alignment: 8. Allergen Name: Ory s TAI Sequence ID: BAA01997

 Score = 121.0 bits 787,  Expect = 2e-29
 Identities = 115/149 77%, Positives = 129/149 86%, Gaps = 6/149 4%
Query  1    MASNKVVFSVLLLAVVSVLAAT-ATMAEYHHQDQVVYTRARCQPGMGYPMYSLPRCRALV 59
            MASNKVVFSVLLL V+SVLAA  ATMA++H   QV     +C+PG+ YP YSLP+CR LV
Sbjct  1    MASNKVVFSVLLLVVLSVLAAAMATMADHH---QVYSPGEQCRPGISYPTYSLPQCRTLV 57
Query  60   KRQC--RGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEV 117
            +RQC  RG++AA EQV +DCCRQLAAVDD WCRC A+ HML GIYRELGA + GHPM+EV
Sbjct  58   RRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAEV 117
Query  118  FRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 152
            F GCRRGDLERAAASLPAFCNVDIPNG GGVCYWL
Sbjct  118  FPGCRRGDLERAAASLPAFCNVDIPNGPGGVCYWL 152

Sequence Alignment: 9. Allergen Name: Ory s TAI Sequence ID: AAB99797

 Score = 115.6 bits 748,  Expect = 7e-28
 Identities = 118/155 76%, Positives = 122/155 78%, Gaps = 4/155 2%
Query  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTRAR-CQPGMGYPMYSLPRCRALV 59
            MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYT    CQPGMGYPMY L R   + 
Sbjct  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPMYPL-RVAGVG 59
Query  60   KRQCRGSAAAAEQ-VRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEVF 118
            +    G A    + V  DCCRQ+  VD SWCRCEAISHMLGGIYRELGAPDVGHPMSEVF
Sbjct  60   EAPLLGRARPRRRAVPGDCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMSEVF 119
Query  119  RGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY 157
            RGCRRG    A    P    VDIPNGGGGVCYWLARSGY
Sbjct  120  RGCRRGTWS-ARRRAPGVLQVDIPNGGGGVCYWLARSGY 157

Sequence Alignment: 10. Allergen Name: Ory s TAI Sequence ID: BAA07773

 Score = 90.4 bits 570,  Expect = 2e-20
 Identities = 77/95 81%, Positives = 86/95 90%, Gaps = 3/95 3%
Query  58   LVKRQC---RGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPM 114
            +VKRQC   R +  A EQ+R+DCCRQLAAVDDSWCRC A++HM+GGIYRELGA DVGHPM
Sbjct  2    VVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM 61
Query  115  SEVFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 152
            +EVF GCRRGDLERA A+LPAFCNVDIPNG GGVCYWL
Sbjct  62   AEVFPGCRRGDLERARATLPAFCNVDIPNGTGGVCYWL 99

Sequence Alignment: 11. Allergen Name: Ory s TAI Sequence ID: BAA07774

 Score = 88.3 bits 555,  Expect = 7e-20
 Identities = 75/93 80%, Positives = 83/93 89%, Gaps = 4/93 4%
Query  60   KRQCRGSAAA----AEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMS 115
            +RQC G         +Q+R+DCCRQLAAVDDSWCRC A++HM+GGIYRELGA DVGHPM+
Sbjct  7    QRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 66
Query  116  EVFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 152
            EVF GCRRGDLERAAASLPAFCNVDIPNG GGVCYWL
Sbjct  67   EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWL 103

Sequence Alignment: 12. Allergen Name: Ory s TAI Sequence ID: BAA07772

 Score = 87.9 bits 552,  Expect = 1e-19
 Identities = 76/97 78%, Positives = 83/97 85%, Gaps = 4/97 4%
Query  56   RALVKRQCRGS----AAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVG 111
            R  VKRQC  +    A   EQ+R+DCCRQLAAVDDSWCRC A++HM+GGIYRELGA DVG
Sbjct  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 60
Query  112  HPMSEVFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 152
            HPM+EVF GCRRGDLER   SLPAFCNVDIPNG GGVCYWL
Sbjct  61   HPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVCYWL 101

Sequence Alignment: 13. Allergen Name: Hor v 1 Sequence ID: P16968

 Score = 75.3 bits 461,  Expect = 8e-16
 Identities = 64/112 57%, Positives = 79/112 70%, Gaps = 5/112 4%
Query  41   CQPGMGYPMYSLPRCRALVKRQCRGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGG 100
            C PGMGYP+Y +PRCRALVK QC G     E +++DCCRQ+AA+ D WC C A+  M G 
Sbjct  20   CWPGMGYPVYPFPRCRALVKSQCAGGQVV-ESIQKDCCRQIAAIGDEWCICGALGSMRGS 78
Query  101  IYRELGAP--DVGHPMSEVFRGCRRGDLERAAASLPAFCNVDIPNGGG--GVCYWLA 153
            +Y+ELG    D    ++EVF GCR   ++RA ASLPA CN  IPN  G  GVCYWL+
Sbjct  79   MYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNGTDGVCYWLS 135

Sequence Alignment: 14. Allergen Name: Hor v 15.0101 Sequence ID: P16968

 Score = 75.3 bits 461,  Expect = 8e-16
 Identities = 64/112 57%, Positives = 79/112 70%, Gaps = 5/112 4%
Query  41   CQPGMGYPMYSLPRCRALVKRQCRGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGG 100
            C PGMGYP+Y +PRCRALVK QC G     E +++DCCRQ+AA+ D WC C A+  M G 
Sbjct  20   CWPGMGYPVYPFPRCRALVKSQCAGGQVV-ESIQKDCCRQIAAIGDEWCICGALGSMRGS 78
Query  101  IYRELGAP--DVGHPMSEVFRGCRRGDLERAAASLPAFCNVDIPNGGG--GVCYWLA 153
            +Y+ELG    D    ++EVF GCR   ++RA ASLPA CN  IPN  G  GVCYWL+
Sbjct  79   MYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNGTDGVCYWLS 135

Sequence Alignment: 15. Allergen Name: Ory s TAI Sequence ID: BAA01999

 Score = 69.3 bits 420,  Expect = 3e-14
 Identities = 65/91 71%, Positives = 77/91 84%, Gaps = 6/91 6%
Query  1    MASNKVVFSVLLLAVVSVLAAT-ATMAEYHHQDQVVYTRARCQPGMGYPMYSLPRCRALV 59
            MASNKVVFSVLLL V+SVLAA  ATMA++H   QV     +C+PG+ YP YSLP+CR LV
Sbjct  1    MASNKVVFSVLLLVVLSVLAAAMATMADHH---QVYSPGEQCRPGISYPTYSLPQCRTLV 57
Query  60   KRQC--RGSAAAAEQVRRDCCRQLAAVDDSWCRCEAI 94
            +RQC  RG++AA EQV +DCCRQLAAVDD WCRC A+
Sbjct  58   RRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGAL 94

Sequence Alignment: 16. Allergen Name: Tri a 15.0101 Sequence ID: CBA13560

 Score = 62.0 bits 367,  Expect = 7e-12
 Identities = 58/108 53%, Positives = 73/108 67%, Gaps = 8/108 7%
Query  41   CQPGMGYPMYSLPRCRALVKRQCRGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGG 100
            C P  GY + +L  CRA+VK QC GS    E V RDCC+QLA V++ WCRCE +S ML  
Sbjct  7    CDPATGYKVSALTGCRAMVKLQCVGSQVP-EAVLRDCCQQLADVNNEWCRCEDLSSMLRS 65
Query  101  IYRELGAPDVGHPMSEVFRGCRRGDLERAAASLPAFCNVDIPNGGG---GVCYWLA 153
            +Y+ELGA + G    EV+ GCR+  ++  AAS+P    V IPN  G   GVCYW A
Sbjct  66   VYQELGARE-GK---EVLPGCRKEVMKLTAASVPEVRKVPIPNPSGDRAGVCYWAA 117

Sequence Alignment: 17. Allergen Name: Hor v 1 Sequence ID: CAA08836

 Score = 60.7 bits 357,  Expect = 2e-11
 Identities = 53/111 47%, Positives = 71/111 63%, Gaps = 7/111 6%
Query  41   CQPGMGYPMYSLPRCRALVKRQCRGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGG 100
            C P MG+ +  L RCRALVK +C G+    E V RDCC+++A + + WCRC  +  ML  
Sbjct  37   CDPEMGHKVSPLTRCRALVKLECVGNRVP-EDVLRDCCQEVANISNEWCRCGDLGSMLRS 95
Query  101  IYRELGAPDVGHPMSEVFRGCRRGDLERAAASLPAFCNVDIPN---GGGGVCYWLARS 155
            +Y  LG   VG    EVF GC++  ++   A +PA+CNV IPN   G  GVCYW A +
Sbjct  96   VYAALG---VGGGPEEVFPGCQKDVMKLLVAGVPALCNVPIPNEAAGTRGVCYWSAST 150

Sequence Alignment: 18. Allergen Name: Tri a TAI Sequence ID: P01083

 Score = 60.3 bits 355,  Expect = 2e-11
 Identities = 56/108 51%, Positives = 72/108 66%, Gaps = 10/108 9%
Query  41   CQPGMGYPMYSLPRCRALVKRQCRGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGG 100
            C P  GY + +L  CRA+VK QC GS    E V RDCC+QLA +++ WCRC  +S ML  
Sbjct  7    CNPATGYKVSALTGCRAMVKLQCVGSQVP-EAVLRDCCQQLADINNEWCRCGDLSSMLRS 65
Query  101  IYRELGAPDVGHPMSEVFRGCRRGDLERAAASLPAFCNVDIPNGGG---GVCY--WLA 153
            +Y+ELG  + G    EV+ GCR+  ++  AAS+P  C V IPN  G   GVCY  W A
Sbjct  66   VYQELGVRE-GK---EVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGDWAA 119

Sequence Alignment: 19. Allergen Name: Tri a 28.0101 Sequence ID: CAI84642

 Score = 52.0 bits 296,  Expect = 7e-09
 Identities = 47/106 44%, Positives = 64/106 60%, Gaps = 7/106 6%
Query  41   CQPGMGYPMYSLPRCRALVKRQCRGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGG 100
            C PG  + + +LP CR L++ QC GS    E V RDCC+QLA + + WCRC A+  ML  
Sbjct  1    CYPGQAFQVPALPACRPLLRLQCNGSQVP-EAVLRDCCQQLAHISE-WCRCGALYSMLDS 58
Query  101  IYRELGAPDVGHPMSEVFRGCRRGDLERAAASLPAFCN----VDIPNGGGGVC 149
            +Y+E GA + G+  +  F  CRR  ++  AAS+ A C     VD    G  VC
Sbjct  59   MYKEHGAQE-GQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 110

Sequence Alignment: 20. Allergen Name: Tri a TAI Sequence ID: P01085

 Score = 52.0 bits 296,  Expect = 7e-09
 Identities = 47/106 44%, Positives = 64/106 60%, Gaps = 7/106 6%
Query  41   CQPGMGYPMYSLPRCRALVKRQCRGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGG 100
            C PG  + + +LP CR L++ QC GS    E V RDCC+QLA + + WCRC A+  ML  
Sbjct  6    CYPGQAFQVPALPACRPLLRLQCNGSQVP-EAVLRDCCQQLAHISE-WCRCGALYSMLDS 63
Query  101  IYRELGAPDVGHPMSEVFRGCRRGDLERAAASLPAFCN----VDIPNGGGGVC 149
            +Y+E GA + G+  +  F  CRR  ++  AAS+ A C     VD    G  VC
Sbjct  64   MYKEHGAQE-GQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115

Sequence Alignment: 21. Allergen Name: Tri a TAI Sequence ID: P01084

 Score = 49.7 bits 279,  Expect = 4e-08
 Identities = 46/106 43%, Positives = 62/106 58%, Gaps = 7/106 6%
Query  41   CQPGMGYPMYSLPRCRALVKRQCRGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGG 100
            C PG  + + +LP CR L+K QC GS    E V RDCC+QLA + + W RC A+  ML  
Sbjct  6    CYPGQAFQVPALPGCRPLLKLQCNGSQVP-EAVLRDCCQQLADISE-WPRCGALYSMLDS 63
Query  101  IYRELGAPDVGHPMSEVFRGCRRGDLERAAASLPAFCN----VDIPNGGGGVC 149
            +Y+E G  + G+  +  F  CRR  ++  AAS+ A C     VD    G  VC
Sbjct  64   MYKEHGVSE-GQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115

Sequence Alignment: 22. Allergen Name: Hor v 1 Sequence ID: CAA31794

 Score = 38.2 bits 197,  Expect = 0.0001
 Identities = 45/128 35%, Positives = 64/128 50%, Gaps = 14/128 10%
Query  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTRARCQPGMGYPMYSLPRCRA-LV 59
            MAS+   F +    ++SVLA  A   E          +  CQ G+ +P   L  C   ++
Sbjct  1    MASDHRRFVLSGAVLLSVLAVAAATLES--------VKDECQLGVDFPHNPLATCHTYVI 52
Query  60   KRQCRGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFR 119
            KR C    +    V+  CCR+LAAV D  CRCEA+  ++ G+    G    G       R
Sbjct  53   KRVCGRGPSRPMLVKERCCRELAAVPDH-CRCEALRILMDGVRTPEGRVVEGRLGDR--R 109
Query  120  GCRRGDLERAAASL--PAFCNV 139
             C R +    AA+L   A CN+
Sbjct  110  DCPREEQRAFAATLVTAAECNL 131

Sequence Alignment: 23. Allergen Name: Tri a TAI Sequence ID: CAA34709

 Score = 34.4 bits 170,  Expect = 0.002
 Identities = 47/108 43%, Positives = 68/108 62%, Gaps = 32/108 29%
Query  10   VLLLA--VVSVLAATATMAEYHHQDQVVYTRARCQPGMGYPMYSLPRCRALVKRQ-CR-- 64
            VLLLA  +VS++AA A +    ++D        C P M   +  LP CR  V++Q CR  
Sbjct  8    VLLLAAVLVSIFAAVAAIG---NED--------CTPWMSTLITPLPSCRDYVEQQACRIE 56
Query  65   --GSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFRGCR 122
              GS   A+Q    CC +LA +    CRC+A+ + +G   R    PD    M   + GC 
Sbjct  57   TPGSPYLAKQ---QCCGELANIPQQ-CRCQALRYFMGPKSR----PDQSGLME--LPGCP 106
Query  123  RG---DLERAAASLPAFCNV 139
            R    D+ R   + P +CN+
Sbjct  107  REVQMDFVRILVT-PGYCNL 125

Sequence Alignment: 24. Allergen Name: Hor v 1 Sequence ID: P01086

 Score = 33.9 bits 166,  Expect = 0.002
 Identities = 38/112 33%, Positives = 56/112 50%, Gaps = 9/112 8%
Query  41   CQPGMGYPMYSLPRCRALVKRQ-C-RGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHML 98
            C PG   P   L  CR  V  Q C +G       ++R CC +L+A+  ++CRCEA+  ++
Sbjct  29   CAPGDALPHNPLRACRTYVVSQICHQGPRLLTSDMKRRCCDELSAIP-AYCRCEALRIIM 87
Query  99   GGIYRELGAPDVGHPMSEVFRGCRRGDLERAAASL--PAFCNVDIPNGGGGVCYWLARSG 156
             G+    GA + G    +    C R      AA+L  P  CN+   +G    C  L + G
Sbjct  88   QGVVTWQGAFE-GAYFKDS-PNCPRERQTSYAANLVTPQECNLGTIHGSA-YCPEL-QPG 143
Query  157  Y 157
            Y
Sbjct  144  Y 144

Sequence Alignment: 25. Allergen Name: Hor v 1 Sequence ID: CAA46705

 Score = 33.9 bits 166,  Expect = 0.002
 Identities = 38/112 33%, Positives = 56/112 50%, Gaps = 9/112 8%
Query  41   CQPGMGYPMYSLPRCRALVKRQ-C-RGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHML 98
            C PG   P   L  CR  V  Q C +G       ++R CC +L+A+  ++CRCEA+  ++
Sbjct  29   CAPGDALPHNPLRACRTYVVSQICHQGPRLLTSDMKRRCCDELSAIP-AYCRCEALRIIM 87
Query  99   GGIYRELGAPDVGHPMSEVFRGCRRGDLERAAASL--PAFCNVDIPNGGGGVCYWLARSG 156
             G+    GA + G    +    C R      AA+L  P  CN+   +G    C  L + G
Sbjct  88   QGVVTWQGAFE-GAYFKDS-PNCPRERQTSYAANLVTPQECNLGTIHGSA-YCPEL-QPG 143
Query  157  Y 157
            Y
Sbjct  144  Y 144

Sequence Alignment: 26. Allergen Name: Hor v 1 Sequence ID: CAA49556

 Score = 33.9 bits 166,  Expect = 0.002
 Identities = 47/119 39%, Positives = 67/119 56%, Gaps = 26/119 21%
Query  1    MASNKVVFSVLLLAV-VSVLAATATMAEYHHQDQVVYTRARCQPGMGYPMYSLPRCRALV 59
            MAS K    +LL AV VS++AA A +     +D        C P    P+  LP CR  V
Sbjct  1    MAS-KSSCDLLLAAVLVSIFAAVAAVGS---ED--------CTPWTATPITPLPSCRDYV 48
Query  60   KRQ-CRGSAAAAEQV-RRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEV 117
            ++Q CR        + ++ CC +LA +    CRC+A+   +G   R    PD    M   
Sbjct  49   EQQACRIETPGPPYLAKQQCCGELANIPQQ-CRCQALRFFMGRKSR----PDQSGLME-- 101
Query  118  FRGCRRG---DLERAAASLPAFCNV 139
            + GC R    D+ R   + P FCN+
Sbjct  102  LPGCPREVQMDFVRILVT-PGFCNL 125

Sequence Alignment: 27. Allergen Name: Hor v 1 Sequence ID: CAA35188

 Score = 33.5 bits 163,  Expect = 0.003
 Identities = 34/101 33%, Positives = 51/101 50%, Gaps = 7/101 6%
Query  41   CQPGMGYPMYSLPRCRALVKRQ-C-RGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHML 98
            C PG   P   L  CR  V  Q C +G       ++R CC +L+A+  ++CRCEA+  ++
Sbjct  29   CAPGDALPHNPLRACRTYVVSQICHQGPRLLTSDMKRRCCDELSAIP-AYCRCEALRIIM 87
Query  99   GGIYRELGAPDVGHPMSEVFRGCRRGDLERAAASL--PAFCNVDIPNG 144
             G+    GA + G    +    C R      AA+L  P  CN+   +G
Sbjct  88   QGVVTWQGAFE-GAYFKDS-PNCPRERQTSYAANLVTPQECNLGTIHG 133

Sequence Alignment: 28. Allergen Name: Tri a TAI Sequence ID: CAA39099

 Score = 33.1 bits 160,  Expect = 0.004
 Identities = 53/119 44%, Positives = 67/119 56%, Gaps = 32/119 26%
Query  1    MASNKVVFSVLLLAV-VSVLAATATMAEYHHQDQVVYTRARCQPGMGYPMYSLPRCRALV 59
            MAS   +  +LL AV VSV+AA A    Y            C PGMG P   L  CR  V
Sbjct  1    MASKSSITHLLLAAVLVSVFAAAAATGPY------------CYPGMGLPSNPLEGCREYV 48
Query  60   KRQ-CR----GSAAAAE--QVRRD-CCRQLAAVDDSW-CRCEAISHMLGGIYRELGAPDV 110
             +Q C     GS  + E     RD CC++L   D S  CRCEA+ + +G        P+ 
Sbjct  49   AQQTCGVGIVGSPVSTEPGNTPRDRCCKEL--YDASQHCRCEAVRYFIG----RTSDPNS 102
Query  111  GHPMSEVFRGCRRGDLERAAASL--PAFCNV 139
            G  + + + GC R      A  L  P  CNV
Sbjct  103  G--VLKDLPGCPREPQRDFAKVLVTPGHCNV 131

Sequence Alignment: 29. Allergen Name: Tri a TAI Sequence ID: CAA35598

 Score = 32.9 bits 159,  Expect = 0.005
 Identities = 52/116 44%, Positives = 65/116 56%, Gaps = 38/116 32%
Query  1    MASNKVVFSVLLLAV-VSVLAATATMAEYHHQDQVVYTRARCQPGMGYPMYSLPRCRALV 59
            MAS   +  +LL  V VSV+AA      Y            C  GMG P+  L  CR  V
Sbjct  1    MASKSSISPLLLATVLVSVFAAATATGPY------------CYAGMGLPINPLEGCREYV 48
Query  60   KRQ-C----RGSAAAAE--QVRRD-CCRQLAAVDDSW-CRCEAISHMLGGIYRELGAPDV 110
             +Q C     GSA + E     RD CC++L   D S  CRCEA+ + +G   R       
Sbjct  49   AQQTCGISISGSAVSTEPGNTPRDRCCKEL--YDASQHCRCEAVRYFIG---RR------ 97
Query  111  GHPMSEVFR---GCRRGDLERAAASL--PAFCNV 139
              P S V++   GC R      A  L     CNV
Sbjct  98   SDPNSSVLKDLPGCPREPQRDFAKVLVTSGHCNV 131

Sequence Alignment: 30. Allergen Name: Tri a 29.0101 Sequence ID: CAZ76052

 Score = 32.3 bits 155,  Expect = 0.006
 Identities = 39/89 43%, Positives = 49/89 55%, Gaps = 23/89 25%
Query  41   CQPGMGYPMYSLPRCRALVKRQ-C----RGSAAAAE--QVRRD-CCRQLAAVDDSWCRCE 92
            C  GMG P+  L  CR  V +Q C     GSA + E     RD CC++L       CRCE
Sbjct  5    CYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQH-CRCE 63
Query  93   AISHMLGGIYRELGAPDVGHPMSEVFR---GCRRGDLERAAASL--PAFCNV 139
            A+ + +G   R         P S V++   GC R      A  L  P  CNV
Sbjct  64   AVRYFIG---RR------SDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNV 106

Sequence Alignment: 31. Allergen Name: Tri a 29.0201 Sequence ID: CBA13559

 Score = 32.1 bits 154,  Expect = 0.007
 Identities = 36/92 39%, Positives = 48/92 52%, Gaps = 17/92 18%
Query  41   CQPGMGYPMYSLPRCRALVKRQ-CR----GSAAAAE--QVRRD-CCRQLAAVDDSWCRCE 92
            C PGMG P   L  CR  V +Q C     GS  + E     RD CC++L       C CE
Sbjct  5    CYPGMGLPSNPLEGCREYVAQQTCGVGIVGSPVSTEPGNTPRDRCCKELYDASQH-CWCE 63
Query  93   AISHMLGGIYRELGAPDVGHPMSEVFRGCRRGDLERAAASL--PAFCNV 139
            A+ + +G        P+ G  + + + GC R     +A  L  P  CNV
Sbjct  64   AVRYFIG----RTSDPNSG--VLKDLPGCPREPQRDSAKVLVTPGHCNV 106

Sequence Alignment: 32. Allergen Name: Hor v 1 Sequence ID: CAA49555

 Score = 32.1 bits 153,  Expect = 0.008
 Identities = 48/117 41%, Positives = 65/117 55%, Gaps = 36/117 30%
Query  1    MASNKVVFSVLLLAVV-SVLAATATMAEYHHQDQVVYTRARCQPGMGYPMYSLPRCRALV 59
            MAS   +  +LL AV+ SV+AA     +Y            C  GMG P   L  CR  V
Sbjct  1    MASKSSITPLLLAAVLASVFAAATATGQY------------CYAGMGLPSNPLEGCREYV 48
Query  60   KRQ-C----RGSAAAAE--QVRRD-CCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVG 111
             +Q C     GS  ++E     +D CC++L       CRCEA+ + +G   R        
Sbjct  49   AQQTCGVTIAGSPVSSEPGDTPKDRCCQELDEAPQH-CRCEAVRYFIG---RR------S 98
Query  112  HPMSEVFR---GCRRGDLERAAASL--PAFCNV 139
            HP   V++   GC +      A  L  P  CNV
Sbjct  99   HPDWSVLKDLPGCPKEPQRDFAKVLVTPGQCNV 131

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.