The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MASNKVVIPALLVVVVSVLAATTTMADHHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFVK
RQCVAPGTLDEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHPMAEVFRG
CRRGDIERAAASLPAFCNVDIPNGVGGVCYWLPGTGY
Sequence Info Allergen Name Length Opt Bits Score E Value
BAA07712 Ory s TAI 157 1116 149.1 5.3e-38
BAA07713 Ory s TAI 160 850 116.3 4e-28
BAA02000 Ory s TAI 166 836 114.6 1.4e-27
BAA01998 Ory s TAI 165 829 113.7 2.5e-27
BAA07710 Ory s TAI 166 810 111.4 1.2e-26
BAA01996 Ory s TAI 157 806 110.9 1.7e-26
BAA07711 Ory s TAI 160 783 108.0 1.2e-25
BAA01997 Ory s TAI 162 763 105.6 6.8e-25
AAB99797 Ory s TAI 157 597 85.1 9.6e-19
BAA07773 Ory s TAI 109 527 76.3 2.9e-16
BAA07774 Ory s TAI 113 515 74.9 8.4e-16
BAA07772 Ory s TAI 111 510 74.2 1.3e-15
P16968 Hor v 1 146 453 67.3 2e-13
P16968 Hor v 15.0101 146 453 67.3 2e-13
BAA01999 Ory s TAI 95 420 63.1 2.5e-12
CAA08836 Hor v 1 152 358 55.6 6.9e-10
CBA13560 Tri a 15.0101 121 331 52.2 5.9e-09
P01083 Tri a TAI 123 327 51.7 8.4e-09
P01085 Tri a TAI 124 256 43.0 3.6e-06
CAI84642 Tri a 28.0101 119 253 42.6 4.6e-06
P01084 Tri a TAI 124 241 41.1 1.3e-05
CAA46705 Hor v 1 148 178 33.4 0.0032
P01086 Hor v 1 144 172 32.7 0.0053
CAA31794 Hor v 1 147 171 32.6 0.0059
CAA39099 Tri a TAI 145 169 32.3 0.0069
CAA35188 Hor v 1 144 167 32.1 0.0081
CAA49556 Hor v 1 149 165 31.8 0.0099
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s TAI Sequence ID: BAA07712

 Score = 149.1 bits 1116,  Expect = 5e-38
 Identities = 157/157 100%, Positives = 157/157 100%, Gaps = 0/157 0%
Query  1    MASNKVVIPALLVVVVSVLAATTTMADHHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFVK 60
            MASNKVVIPALLVVVVSVLAATTTMADHHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFVK
Sbjct  1    MASNKVVIPALLVVVVSVLAATTTMADHHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFVK 60
Query  61   RQCVAPGTLDEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHPMAEVFRG 120
            RQCVAPGTLDEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHPMAEVFRG
Sbjct  61   RQCVAPGTLDEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHPMAEVFRG 120
Query  121  CRRGDIERAAASLPAFCNVDIPNGVGGVCYWLPGTGY 157
            CRRGDIERAAASLPAFCNVDIPNGVGGVCYWLPGTGY
Sbjct  121  CRRGDIERAAASLPAFCNVDIPNGVGGVCYWLPGTGY 157

Sequence Alignment: 2. Allergen Name: Ory s TAI Sequence ID: BAA07713

 Score = 116.3 bits 850,  Expect = 4e-28
 Identities = 121/157 77%, Positives = 133/157 84%, Gaps = 3/157 1%
Query  1    MASNKVVIPALLVVVVSVLAATTTMAD-HHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFV 59
            MASNKVV   LL+ VVSVLAAT TMA+ HHQ+QVVYTP  LCQPG+GYP YPLPRCRA+V
Sbjct  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRALV 60
Query  60   KRQCVAPGTLD--EQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHPMAEV 117
            KRQCV  GT    EQVRR CCRQLA +D SWCRC+A++HML  IYRE  A D GHPM+EV
Sbjct  61   KRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEV 120
Query  118  FRGCRRGDIERAAASLPAFCNVDIPNGVGGVCYWLPGTGY 157
            FRGCRRGD+ERAAASLPAFCNVDIPNG GGVCYWL  +GY
Sbjct  121  FRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY 160

Sequence Alignment: 3. Allergen Name: Ory s TAI Sequence ID: BAA02000

 Score = 114.6 bits 836,  Expect = 1e-27
 Identities = 120/157 76%, Positives = 135/157 85%, Gaps = 9/157 5%
Query  1    MASNKVVIPALLVVVVSVLAATTTMADHHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFVK 60
            MASNKVV  ALL+++VSVLAAT TMADHH++QVVY+ G+ CQPG+GYP Y LPRCRA VK
Sbjct  1    MASNKVVFSALLLIIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
Query  61   RQCV---APG-TLDEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHPMAE 116
            RQCV   APG  +DEQ+R+ CCRQLA +D SWCRC ALNHM+  IYRE  A D GHPMAE
Sbjct  61   RQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 120
Query  117  VFRGCRRGDIERAAASLPAFCNVDIPNGVGGVCYWL-----PGTGY 157
            VF GCRRGD+ERAAASLPAFCNVDIPNG GGVCYWL     P TG+
Sbjct  121  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166

Sequence Alignment: 4. Allergen Name: Ory s TAI Sequence ID: BAA01998

 Score = 113.7 bits 829,  Expect = 2e-27
 Identities = 117/157 74%, Positives = 134/157 85%, Gaps = 8/157 5%
Query  1    MASNKVVIPALLVVVVSVLAATTTMADHHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFVK 60
            MASNKVV  ALL+++VSVLAATT MADHH++QVVY+ G+ CQPG+GYP Y LPRCRA VK
Sbjct  1    MASNKVVFSALLLIIVSVLAATTRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
Query  61   RQCV---APGTLDEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHPMAEV 117
            RQCV   +PG +DEQ+ + CCR+LA +D SWCRC ALNHM+  IYRE  A D GHPMAEV
Sbjct  61   RQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEV 120
Query  118  FRGCRRGDIERAAASLPAFCNVDIPNGVGGVCYWL-----PGTGY 157
            F GCRRGD+ERAAASLPAFCNVDIPNG GGVCYWL     P TG+
Sbjct  121  FPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 165

Sequence Alignment: 5. Allergen Name: Ory s TAI Sequence ID: BAA07710

 Score = 111.4 bits 810,  Expect = 1e-26
 Identities = 117/157 74%, Positives = 132/157 84%, Gaps = 9/157 5%
Query  1    MASNKVVIPALLVVVVSVLAATTTMADHHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFVK 60
            MASNKVV  ALL+++VSVLAAT  MADHH++QVVY+ G+ CQPG+GYP Y LPRCRA VK
Sbjct  1    MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
Query  61   RQCVA---PGTL-DEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHPMAE 116
            RQCVA   P    +EQ+R+ CCRQLA +D SWCRC ALNHM+  IYRE  A D GHPMAE
Sbjct  61   RQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 120
Query  117  VFRGCRRGDIERAAASLPAFCNVDIPNGVGGVCYWL-----PGTGY 157
            VF GCRRGD+ERAAASLPAFCNVDIPNG GGVCYWL     P TG+
Sbjct  121  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166

Sequence Alignment: 6. Allergen Name: Ory s TAI Sequence ID: BAA01996

 Score = 110.9 bits 806,  Expect = 2e-26
 Identities = 115/156 73%, Positives = 128/156 82%, Gaps = 2/156 1%
Query  1    MASNKVVIPALLVVVVSVLAATTTMAD-HHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFV 59
            MASNKVV   LL+ VVSVLAAT TMA+ HHQ+QVVYT  + CQPG+GYP Y LPRCRA+V
Sbjct  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTRAR-CQPGMGYPMYSLPRCRALV 59
Query  60   KRQCVAPGTLDEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHPMAEVFR 119
            KRQC       EQVRR CCRQLA +D SWCRC+A++HML  IYRE  A D GHPM+EVFR
Sbjct  60   KRQCRGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFR 119
Query  120  GCRRGDIERAAASLPAFCNVDIPNGVGGVCYWLPGTGY 157
            GCRRGD+ERAAASLPAFCNVDIPNG GGVCYWL  +GY
Sbjct  120  GCRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY 157

Sequence Alignment: 7. Allergen Name: Ory s TAI Sequence ID: BAA07711

 Score = 108.0 bits 783,  Expect = 1e-25
 Identities = 108/142 76%, Positives = 122/142 85%, Gaps = 4/142 2%
Query  11   LLVVVVSVLAATTTMADHHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFVKRQCV---APG 67
            LL+++VSVLAAT  MADHH++QVVY+ G+ CQPG+GYP Y LPRCRA VKRQCV   APG
Sbjct  4    LLLIIVSVLAATRRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPG 63
Query  68   -TLDEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHPMAEVFRGCRRGDI 126
              +DEQ+R+ CCRQLA +D SWCRC ALNHM+  IYRE  A D GHPMAEVF GCRRGD+
Sbjct  64   GAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDL 123
Query  127  ERAAASLPAFCNVDIPNGVGGVCYWL 152
            ERAAASLPAFCNVDIPNG GGVCYWL
Sbjct  124  ERAAASLPAFCNVDIPNGTGGVCYWL 149

Sequence Alignment: 8. Allergen Name: Ory s TAI Sequence ID: BAA01997

 Score = 105.6 bits 763,  Expect = 7e-25
 Identities = 113/154 73%, Positives = 127/154 82%, Gaps = 11/154 7%
Query  1    MASNKVVIPALLVVVVSVLAAT-TTMADHHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFV 59
            MASNKVV   LL+VV+SVLAA   TMADHHQ   VY+PG+ C+PGI YPTY LP+CR +V
Sbjct  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQ---VYSPGEQCRPGISYPTYSLPQCRTLV 57
Query  60   KRQCVAPGT--LDEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHPMAEV 117
            +RQCV  G    DEQV + CCRQLA +D  WCRC AL+HML  IYRE  A +AGHPMAEV
Sbjct  58   RRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAEV 117
Query  118  FRGCRRGDIERAAASLPAFCNVDIPNGVGGVCYWL-----PGTGY 157
            F GCRRGD+ERAAASLPAFCNVDIPNG GGVCYWL     P TG+
Sbjct  118  FPGCRRGDLERAAASLPAFCNVDIPNGPGGVCYWLGYPRTPRTGH 162

Sequence Alignment: 9. Allergen Name: Ory s TAI Sequence ID: AAB99797

 Score = 85.1 bits 597,  Expect = 1e-18
 Identities = 98/147 66%, Positives = 111/147 75%, Gaps = 20/147 13%
Query  1    MASNKVVIPALLVVVVSVLAATTTMAD-HHQEQVVYTPGQLCQPGIGYPTYPL------- 52
            MASNKVV   LL+ VVSVLAAT TMA+ HHQ+QVVYTPG LCQPG+GYP YPL       
Sbjct  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPMYPLRVAGVGE 60
Query  53   -PRC-RAFVKRQCVAPGTLDEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADA 110
             P   RA  +R+ V PG         CCRQ+  +D SWCRC+A++HML  IYRE  A D 
Sbjct  61   APLLGRARPRRRAV-PGD--------CCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDV 111
Query  111  GHPMAEVFRGCRRGDIERAAASLPAFCNVDIPNGVGGVCYWLPGTGY 157
            GHPM+EVFRGCRRG    A    P    VDIPNG GGVCYWL  +GY
Sbjct  112  GHPMSEVFRGCRRGTWS-ARRRAPGVLQVDIPNGGGGVCYWLARSGY 157

Sequence Alignment: 10. Allergen Name: Ory s TAI Sequence ID: BAA07773

 Score = 76.3 bits 527,  Expect = 3e-16
 Identities = 75/99 75%, Positives = 82/99 82%, Gaps = 8/99 8%
Query  59   VKRQCVAP---GTLDEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHPMA 115
            VKRQCVA    G  DEQ+R+ CCRQLA +D SWCRC ALNHM+  IYRE  A D GHPMA
Sbjct  3    VKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 62
Query  116  EVFRGCRRGDIERAAASLPAFCNVDIPNGVGGVCYWL-----PGTGY 157
            EVF GCRRGD+ERA A+LPAFCNVDIPNG GGVCYWL     P TG+
Sbjct  63   EVFPGCRRGDLERARATLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 109

Sequence Alignment: 11. Allergen Name: Ory s TAI Sequence ID: BAA07774

 Score = 74.9 bits 515,  Expect = 8e-16
 Identities = 73/100 73%, Positives = 81/100 81%, Gaps = 9/100 9%
Query  58   FVKRQCVAPGTL----DEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHP 113
            F +RQCV P        +Q+R+ CCRQLA +D SWCRC ALNHM+  IYRE  A D GHP
Sbjct  5    FRQRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP 64
Query  114  MAEVFRGCRRGDIERAAASLPAFCNVDIPNGVGGVCYWL-----PGTGY 157
            MAEVF GCRRGD+ERAAASLPAFCNVDIPNG GGVCYWL     P TG+
Sbjct  65   MAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 113

Sequence Alignment: 12. Allergen Name: Ory s TAI Sequence ID: BAA07772

 Score = 74.2 bits 510,  Expect = 1e-15
 Identities = 76/100 76%, Positives = 82/100 82%, Gaps = 13/100 13%
Query  56   RAFVKRQCVA------PGTLDEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAAD 109
            R  VKRQCVA      PGT  EQ+R+ CCRQLA +D SWCRC ALNHM+  IYRE  A D
Sbjct  1    RHEVKRQCVATTHPAAPGT--EQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATD 58
Query  110  AGHPMAEVFRGCRRGDIERAAASLPAFCNVDIPNGVGGVCYWL-----PGTGY 157
             GHPMAEVF GCRRGD+ER   SLPAFCNVDIPNG GGVCYWL     P TG+
Sbjct  59   VGHPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 111

Sequence Alignment: 13. Allergen Name: Hor v 1 Sequence ID: P16968

 Score = 67.3 bits 453,  Expect = 2e-13
 Identities = 67/129 51%, Positives = 85/129 65%, Gaps = 5/129 3%
Query  23   TTMADHHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFVKRQCVAPGTLDEQVRRGCCRQLA 82
            T++A  +   V  +PG+ C PG+GYP YP+PRCRA+VK QC A G + E +++ CCRQ+A
Sbjct  2    TSVAVDQGSMVSNSPGEWCWPGMGYPVYPFPRCRALVKSQC-AGGQVVESIQKDCCRQIA 60
Query  83   GIDSSWCRCDALNHMLRIIYREERAA--DAGHPMAEVFRGCRRGDIERAAASLPAFCNVD 140
             I   WC C AL  M   +Y+E   A  D    +AEVF GCR   ++RA ASLPA CN  
Sbjct  61   AIGDEWCICGALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQY 120
Query  141  IPN--GVGGVCYWL 152
            IPN  G  GVCYWL
Sbjct  121  IPNTNGTDGVCYWL 134

Sequence Alignment: 14. Allergen Name: Hor v 15.0101 Sequence ID: P16968

 Score = 67.3 bits 453,  Expect = 2e-13
 Identities = 67/129 51%, Positives = 85/129 65%, Gaps = 5/129 3%
Query  23   TTMADHHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFVKRQCVAPGTLDEQVRRGCCRQLA 82
            T++A  +   V  +PG+ C PG+GYP YP+PRCRA+VK QC A G + E +++ CCRQ+A
Sbjct  2    TSVAVDQGSMVSNSPGEWCWPGMGYPVYPFPRCRALVKSQC-AGGQVVESIQKDCCRQIA 60
Query  83   GIDSSWCRCDALNHMLRIIYREERAA--DAGHPMAEVFRGCRRGDIERAAASLPAFCNVD 140
             I   WC C AL  M   +Y+E   A  D    +AEVF GCR   ++RA ASLPA CN  
Sbjct  61   AIGDEWCICGALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQY 120
Query  141  IPN--GVGGVCYWL 152
            IPN  G  GVCYWL
Sbjct  121  IPNTNGTDGVCYWL 134

Sequence Alignment: 15. Allergen Name: Ory s TAI Sequence ID: BAA01999

 Score = 63.1 bits 420,  Expect = 2e-12
 Identities = 62/92 67%, Positives = 73/92 79%, Gaps = 6/92 6%
Query  1    MASNKVVIPALLVVVVSVLAAT-TTMADHHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFV 59
            MASNKVV   LL+VV+SVLAA   TMADHHQ   VY+PG+ C+PGI YPTY LP+CR +V
Sbjct  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQ---VYSPGEQCRPGISYPTYSLPQCRTLV 57
Query  60   KRQCVAPGT--LDEQVRRGCCRQLAGIDSSWCRCDALN 95
            +RQCV  G    DEQV + CCRQLA +D  WCRC AL+
Sbjct  58   RRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALD 95

Sequence Alignment: 16. Allergen Name: Hor v 1 Sequence ID: CAA08836

 Score = 55.6 bits 358,  Expect = 7e-10
 Identities = 57/142 40%, Positives = 81/142 57%, Gaps = 9/142 6%
Query  8    IPALLVVVVSVLAATTTMADHHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFVKRQCVAPG 67
            + ++L+V++  +   T M     +     P   C P +G+   PL RCRA+VK +CV   
Sbjct  6    MKSMLLVLLLCMLMVTPMTGARSDN--SGPWMWCDPEMGHKVSPLTRCRALVKLECVG-N 62
Query  68   TLDEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHPMAEVFRGCRRGDIE 127
             + E V R CC+++A I + WCRC  L  MLR +Y    A   G    EVF GC++  ++
Sbjct  63   RVPEDVLRDCCQEVANISNEWCRCGDLGSMLRSVYA---ALGVGGGPEEVFPGCQKDVMK 119
Query  128  RAAASLPAFCNVDIPN---GVGGVCYWLPGT 155
               A +PA+CNV IPN   G  GVCYW   T
Sbjct  120  LLVAGVPALCNVPIPNEAAGTRGVCYWSAST 150

Sequence Alignment: 17. Allergen Name: Tri a 15.0101 Sequence ID: CBA13560

 Score = 52.2 bits 331,  Expect = 6e-09
 Identities = 53/110 48%, Positives = 67/110 60%, Gaps = 8/110 7%
Query  37   PGQLCQPGIGYPTYPLPRCRAFVKRQCVAPGTLDEQVRRGCCRQLAGIDSSWCRCDALNH 96
            P   C P  GY    L  CRA VK QCV    + E V R CC+QLA +++ WCRC+ L+ 
Sbjct  3    PWSWCDPATGYKVSALTGCRAMVKLQCVG-SQVPEAVLRDCCQQLADVNNEWCRCEDLSS 61
Query  97   MLRIIYREERAADAGHPMAEVFRGCRRGDIERAAASLPAFCNVDIPNGVG---GVCYW 151
            MLR +Y +E  A  G    EV+ GCR+  ++  AAS+P    V IPN  G   GVCYW
Sbjct  62   MLRSVY-QELGAREGK---EVLPGCRKEVMKLTAASVPEVRKVPIPNPSGDRAGVCYW 115

Sequence Alignment: 18. Allergen Name: Tri a TAI Sequence ID: P01083

 Score = 51.7 bits 327,  Expect = 8e-09
 Identities = 54/110 49%, Positives = 66/110 60%, Gaps = 10/110 9%
Query  37   PGQLCQPGIGYPTYPLPRCRAFVKRQCVAPGTLDEQVRRGCCRQLAGIDSSWCRCDALNH 96
            P   C P  GY    L  CRA VK QCV    + E V R CC+QLA I++ WCRC  L+ 
Sbjct  3    PWSWCNPATGYKVSALTGCRAMVKLQCVG-SQVPEAVLRDCCQQLADINNEWCRCGDLSS 61
Query  97   MLRIIYREERAADAGHPMAEVFRGCRRGDIERAAASLPAFCNVDIPNGVG---GVCY--W 151
            MLR +Y +E     G    EV+ GCR+  ++  AAS+P  C V IPN  G   GVCY  W
Sbjct  62   MLRSVY-QELGVREGK---EVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGDW 117

Sequence Alignment: 19. Allergen Name: Tri a TAI Sequence ID: P01085

 Score = 43.0 bits 256,  Expect = 4e-06
 Identities = 45/107 42%, Positives = 60/107 56%, Gaps = 7/107 6%
Query  40   LCQPGIGYPTYPLPRCRAFVKRQCVAPGTLDEQVRRGCCRQLAGIDSSWCRCDALNHMLR 99
            +C PG  +    LP CR +++ QC     + E V R CC+QLA I S WCRC AL  ML 
Sbjct  5    MCYPGQAFQVPALPACRPLLRLQC-NGSQVPEAVLRDCCQQLAHI-SEWCRCGALYSMLD 62
Query  100  IIYREERAADAGHPMAEVFRGCRRGDIERAAASLPAFCNVDI---PNGVGG-VC 149
             +Y+E   A  G+     F  CRR  ++  AAS+ A C + I    +G G  VC
Sbjct  63   SMYKEH-GAQEGQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115

Sequence Alignment: 20. Allergen Name: Tri a 28.0101 Sequence ID: CAI84642

 Score = 42.6 bits 253,  Expect = 5e-06
 Identities = 45/106 42%, Positives = 59/106 55%, Gaps = 7/106 6%
Query  41   CQPGIGYPTYPLPRCRAFVKRQCVAPGTLDEQVRRGCCRQLAGIDSSWCRCDALNHMLRI 100
            C PG  +    LP CR +++ QC     + E V R CC+QLA I S WCRC AL  ML  
Sbjct  1    CYPGQAFQVPALPACRPLLRLQCNG-SQVPEAVLRDCCQQLAHI-SEWCRCGALYSMLDS 58
Query  101  IYREERAADAGHPMAEVFRGCRRGDIERAAASLPAFCNVDI---PNGVGG-VC 149
            +Y+E   A  G+     F  CRR  ++  AAS+ A C + I    +G G  VC
Sbjct  59   MYKEH-GAQEGQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 110

Sequence Alignment: 21. Allergen Name: Tri a TAI Sequence ID: P01084

 Score = 41.1 bits 241,  Expect = 1e-05
 Identities = 44/107 41%, Positives = 60/107 56%, Gaps = 7/107 6%
Query  40   LCQPGIGYPTYPLPRCRAFVKRQCVAPGTLDEQVRRGCCRQLAGIDSSWCRCDALNHMLR 99
            +C PG  +    LP CR ++K QC     + E V R CC+QLA I S W RC AL  ML 
Sbjct  5    MCYPGQAFQVPALPGCRPLLKLQC-NGSQVPEAVLRDCCQQLADI-SEWPRCGALYSMLD 62
Query  100  IIYREERAADAGHPMAEVFRGCRRGDIERAAASLPAFCNVDI---PNGVGG-VC 149
             +Y+E   ++ G+     F  CRR  ++  AAS+ A C + I    +G G  VC
Sbjct  63   SMYKEHGVSE-GQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115

Sequence Alignment: 22. Allergen Name: Hor v 1 Sequence ID: CAA46705

 Score = 33.4 bits 178,  Expect = 0.003
 Identities = 40/112 35%, Positives = 59/112 52%, Gaps = 15/112 13%
Query  38   GQLCQPGIGYPTYPLPRCRAFVKRQ-C-VAPGTLDEQVRRGCCRQLAGIDSSWCRCDALN 95
            G  C PG   P  PL  CR +V  Q C   P  L   ++R CC +L+ I + +CRC+AL 
Sbjct  26   GDSCAPGDALPHNPLRACRTYVVSQICHQGPRLLTSDMKRRCCDELSAIPA-YCRCEALR 84
Query  96   HMLRIIYREERAADAGHPMAEVFR---GCRRGDIERAAASL--PAFCNVDIPNGVGGVCY 150
             +++ +   + A +  +     F+    C R      AA+L  P  CN+   +G    C 
Sbjct  85   IIMQGVVTWQGAFEGAY-----FKDSPNCPRERQTSYAANLVTPQECNLGTIHG-SAYCP 138
Query  151  WL-PGTG 156
             L PG G
Sbjct  139  ELQPGYG 145

Sequence Alignment: 23. Allergen Name: Hor v 1 Sequence ID: P01086

 Score = 32.7 bits 172,  Expect = 0.005
 Identities = 39/110 35%, Positives = 58/110 52%, Gaps = 15/110 13%
Query  38   GQLCQPGIGYPTYPLPRCRAFVKRQ-C-VAPGTLDEQVRRGCCRQLAGIDSSWCRCDALN 95
            G  C PG   P  PL  CR +V  Q C   P  L   ++R CC +L+ I + +CRC+AL 
Sbjct  26   GDSCAPGDALPHNPLRACRTYVVSQICHQGPRLLTSDMKRRCCDELSAIPA-YCRCEALR 84
Query  96   HMLRIIYREERAADAGHPMAEVFR---GCRRGDIERAAASL--PAFCNVDIPNGVGGVCY 150
             +++ +   + A +  +     F+    C R      AA+L  P  CN+   +G    C 
Sbjct  85   IIMQGVVTWQGAFEGAY-----FKDSPNCPRERQTSYAANLVTPQECNLGTIHG-SAYCP 138
Query  151  WL-PG 154
             L PG
Sbjct  139  ELQPG 143

Sequence Alignment: 24. Allergen Name: Hor v 1 Sequence ID: CAA31794

 Score = 32.6 bits 171,  Expect = 0.006
 Identities = 41/128 32%, Positives = 64/128 50%, Gaps = 14/128 10%
Query  1    MASNKVVIPALLVVVVSVLAATTTMADHHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFV- 59
            MAS+         V++SVLA      +  +++        CQ G+ +P  PL  C  +V 
Sbjct  1    MASDHRRFVLSGAVLLSVLAVAAATLESVKDE--------CQLGVDFPHNPLATCHTYVI 52
Query  60   KRQCVAPGTLDEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHPMAEVFR 119
            KR C    +    V+  CCR+LA +    CRC+AL  ++  +   E     G  + +  R
Sbjct  53   KRVCGRGPSRPMLVKERCCRELAAVPDH-CRCEALRILMDGVRTPEGRVVEGR-LGDR-R 109
Query  120  GCRRGDIERAAASL--PAFCNV 139
             C R +    AA+L   A CN+
Sbjct  110  DCPREEQRAFAATLVTAAECNL 131

Sequence Alignment: 25. Allergen Name: Tri a TAI Sequence ID: CAA39099

 Score = 32.3 bits 169,  Expect = 0.007
 Identities = 46/118 38%, Positives = 68/118 57%, Gaps = 34/118 28%
Query  1    MASNKVVIPALLV-VVVSVLAATTTMADHHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFV 59
            MAS   +   LL  V+VSV+AA                G  C PG+G P+ PL  CR +V
Sbjct  1    MASKSSITHLLLAAVLVSVFAAAAAT------------GPYCYPGMGLPSNPLEGCREYV 48
Query  60   KRQCVAPGTLDEQV--------RRGCCRQLAGIDSSW-CRCDALNHMLRIIYREERAADA 110
             +Q    G +   V        R  CC++L   D+S  CRC+A+ + +       R +D 
Sbjct  49   AQQTCGVGIVGSPVSTEPGNTPRDRCCKEL--YDASQHCRCEAVRYFI------GRTSDP 100
Query  111  GHPMAEVFRGCRRGDIERAAASL---PAFCNV 139
               + + + GC R + +R  A +   P  CNV
Sbjct  101  NSGVLKDLPGCPR-EPQRDFAKVLVTPGHCNV 131

Sequence Alignment: 26. Allergen Name: Hor v 1 Sequence ID: CAA35188

 Score = 32.1 bits 167,  Expect = 0.008
 Identities = 35/101 34%, Positives = 54/101 53%, Gaps = 13/101 12%
Query  38   GQLCQPGIGYPTYPLPRCRAFVKRQ-C-VAPGTLDEQVRRGCCRQLAGIDSSWCRCDALN 95
            G  C PG   P  PL  CR +V  Q C   P  L   ++R CC +L+ I + +CRC+AL 
Sbjct  26   GDSCAPGDALPHNPLRACRTYVVSQICHQGPRLLTSDMKRRCCDELSAIPA-YCRCEALR 84
Query  96   HMLRIIYREERAADAGHPMAEVFR---GCRRGDIERAAASL--PAFCNVDIPNG 144
             +++ +   + A +  +     F+    C R      AA+L  P  CN+   +G
Sbjct  85   IIMQGVVTWQGAFEGAY-----FKDSPNCPRERQTSYAANLVTPQECNLGTIHG 133

Sequence Alignment: 27. Allergen Name: Hor v 1 Sequence ID: CAA49556

 Score = 31.8 bits 165,  Expect = 0.01
 Identities = 45/119 37%, Positives = 62/119 52%, Gaps = 26/119 21%
Query  1    MASNKVVIPALLVVVVSVLAATTTMADHHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFVK 60
            MAS       L  V+VS++AA   +               C P    P  PLP CR +V+
Sbjct  1    MASKSSCDLLLAAVLVSIFAAVAAVGSED-----------CTPWTATPITPLPSCRDYVE 49
Query  61   RQ-CV--APGTLDEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHPMAEV 117
            +Q C    PG      ++ CC +LA I    CRC AL   +    R+ R   +G  + E+
Sbjct  50   QQACRIETPGP-PYLAKQQCCGELANIPQQ-CRCQALRFFMG---RKSRPDQSG--LMEL 102
Query  118  FRGCRRG---DIERAAASLPAFCNV 139
              GC R    D  R   + P FCN+
Sbjct  103  -PGCPREVQMDFVRILVT-PGFCNL 125

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.