The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD
FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV
HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT
NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF
NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT
KNAGVVT
Sequence Info Allergen Name Length Opt Bits Score E Value
P81294 Jun a 1.0101 367 2518 580.4 4.3e-167
AAD03609 Jun a 1.0102 367 2518 580.4 4.3e-167
CAC48400 Jun o 1 367 2444 563.5 5.1e-162
Q9LLT1 Jun v 1.0101 367 2430 560.3 4.7e-161
AAF72626 Cup s 1.0102 367 2424 559.0 1.2e-160
AAF80164 Jun v 1.0102 367 2422 558.5 1.6e-160
AAF72625 Cup s 1.0101 367 2419 557.8 2.6e-160
AAF72627 Cup s 1.0103 367 2415 556.9 5e-160
AAF72628 Cup s 1.0104 367 2409 555.5 1.3e-159
CAC37790 Cup a 1 367 2404 554.4 2.8e-159
AAF72629 Cup s 1.0105 367 2402 553.9 3.9e-159
Q9SCG9 Cup a 1 346 2261 521.8 1.7e-149
Q96385 Cha o 1 375 2216 511.5 2.3e-146
P18632 Cry j 1.0101 374 2073 478.9 1.5e-136
BAB86287 Cry j 1.0103 374 2070 478.3 2.4e-136
BAA05543 Cry j 1.0102 374 2052 474.2 4.1e-135
AY904433 Art v 6.0101 396 1070 250.3 1.1e-67
P27761 Amb a 1 397 1067 249.6 1.7e-67
AAA32669 Amb a 1 397 1067 249.6 1.7e-67
A0A251RNJ1 Hel a 6.0101 394 1062 248.5 3.8e-67
P27762 Amb a 2 397 1061 248.2 4.4e-67
P27760 Amb a 1 398 1032 241.6 4.3e-65
P27759 Amb a 1 396 1029 240.9 6.9e-65
P28744 Amb a 1 392 961 225.4 3.2e-60
ABM60783 Pen c 32.0101 290 263 66.4 1.7e-12
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Jun a 1.0101 Sequence ID: P81294

 Score = 580.4 bits 2518,  Expect = 4e-167
 Identities = 367/367 100%, Positives = 367/367 100%, Gaps = 0/367 0%
Query  1    MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
            MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
            FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV
Sbjct  61   FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
Query  301  TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT
Sbjct  301  TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  KNAGVVT 367
            KNAGVVT
Sbjct  361  KNAGVVT 367

Sequence Alignment: 2. Allergen Name: Jun a 1.0102 Sequence ID: AAD03609

 Score = 580.4 bits 2518,  Expect = 4e-167
 Identities = 367/367 100%, Positives = 367/367 100%, Gaps = 0/367 0%
Query  1    MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
            MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
            FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV
Sbjct  61   FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
Query  301  TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT
Sbjct  301  TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  KNAGVVT 367
            KNAGVVT
Sbjct  361  KNAGVVT 367

Sequence Alignment: 3. Allergen Name: Jun o 1 Sequence ID: CAC48400

 Score = 563.5 bits 2444,  Expect = 5e-162
 Identities = 356/367 97%, Positives = 359/367 97%, Gaps = 0/367 0%
Query  1    MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
            MASPCL AVLVFLCAIVSCYSDNPIDSCWRGDSNW QNRMKLADC VGFGSSTMGGKGG+
Sbjct  1    MASPCLRAVLVFLCAIVSCYSDNPIDSCWRGDSNWGQNRMKLADCVVGFGSSTMGGKGGE 60
Query  61   FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
            FYTVTS +DNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV
Sbjct  61   FYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMRKVSHVILH LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYD+DKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDNDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
Query  301  TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCES SACANWVWRSTRDAF NGAYFVSSGK EETNIYNSNEAFKVENGNAAPQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFTNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  KNAGVVT 367
            KNAGVVT
Sbjct  361  KNAGVVT 367

Sequence Alignment: 4. Allergen Name: Jun v 1.0101 Sequence ID: Q9LLT1

 Score = 560.3 bits 2430,  Expect = 5e-161
 Identities = 354/366 96%, Positives = 356/366 97%, Gaps = 0/366 0%
Query  1    MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
            MASPCLIA LVFLCAIVSC SDNPIDSCWRGDSNW QNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
            FYTVTS DDNPVNPTPGTLRYGATREK LWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV
Sbjct  61   FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMRKVSHVILH LHIHGCNTSVLGDVLVSESIGV PVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAP+E+YKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
Query  301  TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCES SACANWVWRSTRDAF NGAYFVSSGK EETNIYNSNEAFKVENGNAAPQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  KNAGVV 366
            KNAGVV
Sbjct  361  KNAGVV 366

Sequence Alignment: 5. Allergen Name: Cup s 1.0102 Sequence ID: AAF72626

 Score = 559.0 bits 2424,  Expect = 1e-160
 Identities = 353/366 96%, Positives = 357/366 97%, Gaps = 0/366 0%
Query  1    MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
            M SPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
             YTVTS +DNPVNPTPGTLRYGATREKALWIIFSQNMNIKL+MPLYVAGHKTIDGRGADV
Sbjct  61   IYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLEMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMRKVSHVILH LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTL STGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYD WNIYAIGGSSNPTILSEGNSFTAP+E+YKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
Query  301  TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCES SACANWVWRSTRDAF NGAYFVSSGKTEETNIYNSNEAFKVENGN APQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLT 360
Query  361  KNAGVV 366
            KNAGVV
Sbjct  361  KNAGVV 366

Sequence Alignment: 6. Allergen Name: Jun v 1.0102 Sequence ID: AAF80164

 Score = 558.5 bits 2422,  Expect = 2e-160
 Identities = 353/366 96%, Positives = 355/366 96%, Gaps = 0/366 0%
Query  1    MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
            MASPCLIA LVFLCAIVSC SDNPIDSCWRGDSNW QNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
            FYTVTS DDNPVNPTPGTLRYGATREK LWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV
Sbjct  61   FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMRKVSHVILH LHIHGCNTSVLGDVLVSESIGV PVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTLGSTGITI NNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITIFNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAP+E+YKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
Query  301  TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCES SACANWVWRSTRDAF NGAYFVSSGK EETNIYNSNEAFKVENGNAAPQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  KNAGVV 366
            KNAGVV
Sbjct  361  KNAGVV 366

Sequence Alignment: 7. Allergen Name: Cup s 1.0101 Sequence ID: AAF72625

 Score = 557.8 bits 2419,  Expect = 3e-160
 Identities = 352/366 96%, Positives = 355/366 96%, Gaps = 0/366 0%
Query  1    MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
            M SPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
             YT TS +DNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV
Sbjct  61   IYTATSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMRKVSHVILH LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTL STGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYD WNIYAIGGSSNPTILSEGNSF AP+E+YKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFAAPNENYKKEV 300
Query  301  TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCES SACANWVWRSTRDAF NGAYFVSSGKTEETNIYNSNEAFKVENGN APQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLT 360
Query  361  KNAGVV 366
            KNAGVV
Sbjct  361  KNAGVV 366

Sequence Alignment: 8. Allergen Name: Cup s 1.0103 Sequence ID: AAF72627

 Score = 556.9 bits 2415,  Expect = 5e-160
 Identities = 352/366 96%, Positives = 355/366 96%, Gaps = 0/366 0%
Query  1    MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
            M SPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
             YTVTS +DNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV
Sbjct  61   IYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMRKVSHVILH LHIH CNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHSCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            NAWIDHNSL DCSDGLIDVTL STGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF
Sbjct  181  NAWIDHNSLPDCSDGLIDVTLSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYD WNIYAIGGSSNPTILSEGNSFTAP+E+YKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
Query  301  TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCES SACANWVWRSTRDAF NGAYFVSSGKTEETNIYNSNEAFKVENGN APQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLT 360
Query  361  KNAGVV 366
            KNAGVV
Sbjct  361  KNAGVV 366

Sequence Alignment: 9. Allergen Name: Cup s 1.0104 Sequence ID: AAF72628

 Score = 555.5 bits 2409,  Expect = 1e-159
 Identities = 351/366 95%, Positives = 355/366 96%, Gaps = 0/366 0%
Query  1    MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
            M SPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
             YTVTS +DNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV
Sbjct  61   IYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMRKVSHVILH LHIHGCNTSVLG+VLVSESIGVEPVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGNVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTL STGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYD WNIYAIGGSSNPTILSEGNSF AP+E+YKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFAAPNENYKKEV 300
Query  301  TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGC S SACANWVWRSTRDAF NGAYFVSSGKTEETNIYNSNEAFKVENGN APQLT
Sbjct  301  TKRIGCVSTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLT 360
Query  361  KNAGVV 366
            KNAGVV
Sbjct  361  KNAGVV 366

Sequence Alignment: 10. Allergen Name: Cup a 1 Sequence ID: CAC37790

 Score = 554.4 bits 2404,  Expect = 3e-159
 Identities = 349/367 95%, Positives = 355/367 96%, Gaps = 0/367 0%
Query  1    MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
            MASPCL+AVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADC VGFGS TMGGKGG+
Sbjct  1    MASPCLVAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGE 60
Query  61   FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
             YTVTS+DDNPVNPTPGTLRYGATREKALWIIFSQNMNIKL+MPLYVAG+KTIDGRGADV
Sbjct  61   IYTVTSSDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADV 120
Query  121  HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMR  SHVILH LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRTASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDD SMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYD WNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
Query  301  TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCES SACANWVWR TRDAF NGAYFVSSGK EETNIYNSNEAFKVENGNAAPQLT
Sbjct  301  TKRIGCESTSACANWVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  KNAGVVT 367
            +NAGVVT
Sbjct  361  QNAGVVT 367

Sequence Alignment: 11. Allergen Name: Cup s 1.0105 Sequence ID: AAF72629

 Score = 553.9 bits 2402,  Expect = 4e-159
 Identities = 350/366 95%, Positives = 354/366 96%, Gaps = 0/366 0%
Query  1    MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
            M SPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
             YTVTS +DNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV
Sbjct  61   IYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMRKVSHVILH LHIHGCNTSVLG+VLVSESIGVEPVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGNVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTL STGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYD WNIYAIGGSSNPTILSEGNSF AP+E+YKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFAAPNENYKKEV 300
Query  301  TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGC S SACANWVWRSTRDAF NGAYFVSSGKTEETNIY SNEAFKVENGN APQLT
Sbjct  301  TKRIGCVSTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYTSNEAFKVENGNLAPQLT 360
Query  361  KNAGVV 366
            KNAGVV
Sbjct  361  KNAGVV 366

Sequence Alignment: 12. Allergen Name: Cup a 1 Sequence ID: Q9SCG9

 Score = 521.8 bits 2261,  Expect = 2e-149
 Identities = 327/345 94%, Positives = 336/345 97%, Gaps = 0/345 0%
Query  22   DNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGDFYTVTSTDDNPVNPTPGTLRY 81
            DNPIDSCWRGDSNWDQNRMKLADC VGFGSSTMGGKGG+ YTVTS++DNPVNPTPGTLRY
Sbjct  1    DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRY 60
Query  82   GATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHS 141
            GATREKALWIIFSQNMNIKL+MPLYVAG+KTIDGRGA VHLGNGGPCLFMRK SHVILH 
Sbjct  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
Query  142  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 201
            LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL
Sbjct  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
Query  202  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 261
            GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV
Sbjct  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
Query  262  ANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESPSACANWVWRSTR 321
            ANNNYD WNIYAIGGSSNPTILSEGNSFTAP+ESYKKEVTKRIGCE+ SACANWVWRSTR
Sbjct  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
Query  322  DAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLTKNAGVV 366
            DAF NGAYFVSSGK E+TNIYNSNEAFKVENGNAAPQLT+NAGVV
Sbjct  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVV 345

Sequence Alignment: 13. Allergen Name: Cha o 1 Sequence ID: Q96385

 Score = 511.5 bits 2216,  Expect = 2e-146
 Identities = 314/367 85%, Positives = 345/367 94%, Gaps = 0/367 0%
Query  1    MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
            MAS  L+AVLVFLCAIVSC+SDNPIDSCWRGD+NWDQNRMKLADCAVGFGSS MGGKGG 
Sbjct  1    MASCTLLAVLVFLCAIVSCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGA 60
Query  61   FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
            FYTVTS+DD+PVNP PGTLRYGATRE++LWIIFS+N+NIKL MPLY+AG+KTIDGRGA+V
Sbjct  61   FYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEV 120
Query  121  HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            H+GNGGPCLFMR VSHVILH L+IHGCNTSV G+VL+SE+ GV PVHAQDGDAITMRNVT
Sbjct  121  HIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            + WIDHNSLSD SDGL+DVTL STG+TISNNHFFNHHKVMLLGH D Y DDKSMKVTVAF
Sbjct  181  DVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPNAGQRMPRARYGL+HVANNNYDPW+IYAIGGSSNPTILSEGNSFTAP++S KKEV
Sbjct  241  NQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEV 300
Query  301  TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT 360
            T+R+GCESPS CANWVWRST+D+F NGAYFVSSGK E TNIYN+NEAFKVENG+AAPQLT
Sbjct  301  TRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLT 360
Query  361  KNAGVVT 367
            KNAGV+T
Sbjct  361  KNAGVLT 367

Sequence Alignment: 14. Allergen Name: Cry j 1.0101 Sequence ID: P18632

 Score = 478.9 bits 2073,  Expect = 1e-136
 Identities = 289/367 78%, Positives = 331/367 90%, Gaps = 0/367 0%
Query  1    MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
            M SPCL+A+LV+   I SC+SDNPIDSCWRGDSNW QNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MDSPCLVALLVLSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
            +YTVT++DD+PVNP PGTLRYGATR++ LWIIFS NMNIKLKMP+Y+AG+KT DGRGA V
Sbjct  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
Query  121  HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            ++GNGGPC+F+++VS+VI+H LH++GC+TSVLG+VL++ES GVEPVH QDGDA+T+R  T
Sbjct  121  YIGNGGPCVFIKRVSNVIIHGLHLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            N WIDHNS+S+ SDGL+DVTL STG+TISNN FFNHHKVMLLGHDD Y DDKSMKVTVAF
Sbjct  181  NIWIDHNSFSNSSDGLVDVTLSSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPN GQRMPRARYGLVHVANNNYDPW IYAIGGSSNPTILSEGNSFTAP+ESYKK+V
Sbjct  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
Query  301  TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT 360
            T RIGC++ S+C+NWVW+ST+D F NGAYFVSSGK E  NIY   EAF VENGNA PQLT
Sbjct  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT 360
Query  361  KNAGVVT 367
            KNAGV+T
Sbjct  361  KNAGVLT 367

Sequence Alignment: 15. Allergen Name: Cry j 1.0103 Sequence ID: BAB86287

 Score = 478.3 bits 2070,  Expect = 2e-136
 Identities = 289/367 78%, Positives = 331/367 90%, Gaps = 0/367 0%
Query  1    MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
            M SPCL+A+LVF   I SC+SDNPIDSCWRGDSNW QNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
            +YTVT++DD+PVNP PGTLRYGATR++ LWIIFS NMNIKLKMP+Y+AG+KT DGRGA V
Sbjct  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
Query  121  HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            ++GNGGPC+F+++VS+VI+H L+++GC+TSVLG+VL++ES GVEPVH QDGDA+T+R  T
Sbjct  121  YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            N WIDHNS+S+ SDGL+DVTL STG+TISNN FFNHHKVMLLGHDD Y DDKSMKVTVAF
Sbjct  181  NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPN GQRMPRARYGLVHVANNNYDPW IYAIGGSSNPTILSEGNSFTAP+ESYKK+V
Sbjct  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
Query  301  TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT 360
            T RIGC++ S+C+NWVW+ST+D F NGAYFVSSGK E  NIY   EAF VENGNA PQLT
Sbjct  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT 360
Query  361  KNAGVVT 367
            KNAGV+T
Sbjct  361  KNAGVLT 367

Sequence Alignment: 16. Allergen Name: Cry j 1.0102 Sequence ID: BAA05543

 Score = 474.2 bits 2052,  Expect = 4e-135
 Identities = 286/367 77%, Positives = 330/367 89%, Gaps = 0/367 0%
Query  1    MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
            M SPCL+A+LVF   I SC+SDNPIDSCWRGDSNW QNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
            +YTVT++DD+PVNP PGTLRYGATR++ LWIIFS NMNIKLKMP+Y+AG+KT DGRGA V
Sbjct  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
Query  121  HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            ++GNGGPC+F+++VS+VI+H L+++GC+TSVLG+VL++ES GVEPVH QDGDA+T+R  T
Sbjct  121  YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            N WIDHNS+S+ SDGL+DVTL STG+TISNN FFNHHKVM LGHDD Y DDKSMKVTVAF
Sbjct  181  NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMSLGHDDAYSDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPN GQRMPRARYGLVHVANNNYDPW IYAIGGSSNPTILSEGNSFTAP+ESYKK+V
Sbjct  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
Query  301  TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT 360
            T RIGC++ S+C+NWVW+ST+D F NGAYFVSSGK E  NIY   EAF VENGNA P+LT
Sbjct  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPHLT 360
Query  361  KNAGVVT 367
            +NAGV+T
Sbjct  361  QNAGVLT 367

Sequence Alignment: 17. Allergen Name: Art v 6.0101 Sequence ID: AY904433

 Score = 250.3 bits 1070,  Expect = 1e-67
 Identities = 166/343 48%, Positives = 218/343 63%, Gaps = 7/343 2%
Query  19   CYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGDFYTVTS-TDDNPVNPTPG 77
            C + N ID CWR  ++W++NR  LA CA GF   T GG GG+ Y VT  +DDN  NP PG
Sbjct  44   CAAHNIIDKCWRCKADWEKNRQALAKCAQGFAKGTTGGLGGEIYVVTDCSDDNAANPKPG 103
Query  78   TLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHV 137
            TLR G T++K LWIIF ++M IKLK  L +   KTIDGRGA+V +  GG  L +  V +V
Sbjct  104  TLRCGVTQDKPLWIIFKKDMVIKLKHELVINKDKTIDGRGANVEITCGG--LTIHNVCNV 161
Query  138  ILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLI 197
            I+H++HIH    +  G ++ +        H  DGD I +   +  WIDH +LS   DGLI
Sbjct  162  IIHNIHIHDIKVTE-GGIIKATDAKPGHRHKSDGDGICVAGSSKIWIDHCTLSHGPDGLI 220
Query  198  DVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYG 257
            DVTLGST +TISN  F +H+K++LLG D+++ DDK M VTVAFN+F     QRMPR R+G
Sbjct  221  DVTLGSTAVTISNCKFSHHQKILLLGADNSHVDDKKMHVTVAFNRFAEACDQRMPRCRFG 280
Query  258  LVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESP-SACANWV 316
            + +V NN+Y  W  YAIGGS+NPTILS+GN F AP++  KK V  R   ++P +    W 
Sbjct  281  FFQVVNNDYTSWGTYAIGGSANPTILSQGNRFHAPNDPMKKNVLVR--ADAPHTESMKWN 338
Query  317  WRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLTKNAGVV 366
            WRS +D + NGA FV+SG          +     E G+A  QLT  AG +
Sbjct  339  WRSEKDLLENGAIFVASGCDPHLTPEQKSHLIPAEPGSAVLQLTSCAGTL 388

Sequence Alignment: 18. Allergen Name: Amb a 1 Sequence ID: P27761

 Score = 249.6 bits 1067,  Expect = 2e-67
 Identities = 171/344 49%, Positives = 215/344 62%, Gaps = 9/344 2%
Query  18   SCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGDFYTVTST-DDNPVNPTP 76
            +C + N ID CWRG ++W+ NR  LADCA GF   T GGK GD YTVTS  DD+  NP  
Sbjct  44   ACEALNIIDKCWRGKADWENNRQALADCAQGFAKGTYGGKWGDVYTVTSNLDDDVANPKE 103
Query  77   GTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSH 136
            GTLR+ A + + LWIIF  +M I L   L V   KTIDGRG  V + NGG  L +  V +
Sbjct  104  GTLRFAAAQNRPLWIIFKNDMVINLNQELVVNSDKTIDGRGVKVEIINGG--LTLMNVKN 161
Query  137  VILHSLHIHGCNTSVLGDVLVSESIGVEPV--HAQDGDAITMRNVTNAWIDHNSLSDCSD 194
            +I+H+++IH  +  VL   ++  + G  P+  +A DGD I +   +  WIDH SLS   D
Sbjct  162  IIIHNINIH--DVKVLPGGMIKSNDG-PPILRQASDGDTINVAGSSQIWIDHCSLSKSFD 218
Query  195  GLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRA 254
            GL+DVTLGST +TISN  F  + K +LLG DDT+  DK M  TVAFN F  N  QRMPR 
Sbjct  219  GLVDVTLGSTHVTISNCKFTQQSKAILLGADDTHVQDKGMLATVAFNMFTDNVDQRMPRC 278
Query  255  RYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESPSACAN 314
            R+G+ +V NNNYD W  YAIGGSS PTIL +GN F AP +  KK V  R G  +  + A 
Sbjct  279  RFGFFQVVNNNYDRWGTYAIGGSSAPTILCQGNRFLAPDDQIKKNVLARTGTGAAESMA- 337
Query  315  WVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLTKNAGVVT 367
            W WRS +D + NGA FV+SG         S      E G AA +LT +AGV +
Sbjct  338  WNWRSDKDLLENGAIFVTSGSDPVLTPVQSAGMIPAEPGEAAIKLTSSAGVFS 390

Sequence Alignment: 19. Allergen Name: Amb a 1 Sequence ID: AAA32669

 Score = 249.6 bits 1067,  Expect = 2e-67
 Identities = 171/344 49%, Positives = 215/344 62%, Gaps = 9/344 2%
Query  18   SCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGDFYTVTST-DDNPVNPTP 76
            +C + N ID CWRG ++W+ NR  LADCA GF   T GGK GD YTVTS  DD+  NP  
Sbjct  44   ACEALNIIDKCWRGKADWENNRQALADCAQGFAKGTYGGKWGDVYTVTSNLDDDVANPKE 103
Query  77   GTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSH 136
            GTLR+ A + + LWIIF  +M I L   L V   KTIDGRG  V + NGG  L +  V +
Sbjct  104  GTLRFAAAQNRPLWIIFKNDMVINLNQELVVNSDKTIDGRGVKVEIINGG--LTLMNVKN 161
Query  137  VILHSLHIHGCNTSVLGDVLVSESIGVEPV--HAQDGDAITMRNVTNAWIDHNSLSDCSD 194
            +I+H+++IH  +  VL   ++  + G  P+  +A DGD I +   +  WIDH SLS   D
Sbjct  162  IIIHNINIH--DVKVLPGGMIKSNDG-PPILRQASDGDTINVAGSSQIWIDHCSLSKSFD 218
Query  195  GLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRA 254
            GL+DVTLGST +TISN  F  + K +LLG DDT+  DK M  TVAFN F  N  QRMPR 
Sbjct  219  GLVDVTLGSTHVTISNCKFTQQSKAILLGADDTHVQDKGMLATVAFNMFTDNVDQRMPRC 278
Query  255  RYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESPSACAN 314
            R+G+ +V NNNYD W  YAIGGSS PTIL +GN F AP +  KK V  R G  +  + A 
Sbjct  279  RFGFFQVVNNNYDRWGTYAIGGSSAPTILCQGNRFLAPDDQIKKNVLARTGTGAAESMA- 337
Query  315  WVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLTKNAGVVT 367
            W WRS +D + NGA FV+SG         S      E G AA +LT +AGV +
Sbjct  338  WNWRSDKDLLENGAIFVTSGSDPVLTPVQSAGMIPAEPGEAAIKLTSSAGVFS 390

Sequence Alignment: 20. Allergen Name: Hel a 6.0101 Sequence ID: A0A251RNJ1

 Score = 248.5 bits 1062,  Expect = 4e-67
 Identities = 167/345 48%, Positives = 215/345 62%, Gaps = 7/345 2%
Query  18   SCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGDFYTVTS-TDDNPVNPTP 76
            +C + N +D CWR  ++W  NR  +ADCA GF   T GGKGGD Y VTS  DD+P NP  
Sbjct  41   ACEAVNIMDQCWRCKADWADNRQAMADCAQGFAKGTTGGKGGDVYVVTSEADDDPANPKE 100
Query  77   GTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSH 136
            GTLR+G T+ + LWI F ++M I L   L VA  KTIDGRGA V + NGG  L +  V +
Sbjct  101  GTLRFGVTQGRPLWITFEKDMVISLTQELVVASDKTIDGRGAKVEITNGG--LTLMDVKN 158
Query  137  VILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGL 196
            +I+ ++++H     + G ++ S        +  DGD IT+      WIDH S+S   DGL
Sbjct  159  IIISNINVHDV-VELPGGMIKSGDGPATQRQKSDGDCITVAGGKQIWIDHCSFSKAFDGL 217
Query  197  IDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARY 256
            +DVTLGS+ +T+SN  F  H KVMLLG DD +  DK+M VTVAFN F  N  QRMPR R+
Sbjct  218  VDVTLGSSHVTVSNCKFTQHSKVMLLGADDGHHQDKNMVVTVAFNLFTDNCDQRMPRCRF 277
Query  257  GLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESP-SACANW 315
            G+ +V NNNYD W  YAIGGSS PTILS+GN F AP ++ KK V  R   ++P S    W
Sbjct  278  GFFQVVNNNYDRWGTYAIGGSSAPTILSQGNRFLAPDDAAKKNVCVRA--DAPESESMTW 335
Query  316  VWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLTKNAGVVT 367
             WR+ +D + NGA FV SG              + E G  AP+LT +AGV+T
Sbjct  336  NWRTEKDVLENGAVFVPSGSDPALTGEQQGGMIQAEPGENAPKLTASAGVLT 387

Sequence Alignment: 21. Allergen Name: Amb a 2 Sequence ID: P27762

 Score = 248.2 bits 1061,  Expect = 4e-67
 Identities = 168/344 48%, Positives = 216/344 62%, Gaps = 7/344 2%
Query  19   CYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGDFYTVTST-DDNPVNPTPG 77
            C + N ID CWR   +W +NR  L +CA GFG +T GGK GD Y VTS  DD+ VNP  G
Sbjct  45   CEAHNIIDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVNPKEG 104
Query  78   TLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHV 137
            TLR+GAT+++ LWIIF ++M I L+  + V   KTIDGRGA V L  GG  + +  V +V
Sbjct  105  TLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELVYGG--ITLMNVKNV 162
Query  138  ILHSLHIHGCNTSVL-GDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGL 196
            I+H++ IH  +  VL G  + S      P H  DGDAI +   ++ WIDH +LS   DGL
Sbjct  163  IIHNIDIH--DVRVLPGGRIKSNGGPAIPRHQSDGDAIHVTGSSDIWIDHCTLSKSFDGL 220
Query  197  IDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARY 256
            +DV  GSTG+TISN  F +H K +LLG  DT+  D  M VT+A+N F     +RMPR R+
Sbjct  221  VDVNWGSTGVTISNCKFTHHEKAVLLGASDTHFQDLKMHVTLAYNIFTNTVHERMPRCRF 280
Query  257  GLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESPSACANWV 316
            G+ ++ NN YD W+ YAIGGSSNPTILS+GN F AP   YKK V  R G + P     W 
Sbjct  281  GFFQIVNNFYDRWDKYAIGGSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEW-MTWN 339
Query  317  WRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLTKNAGVVT 367
            WR+  D + NGA FV+SG         +    + E G+  PQLT NAGV+T
Sbjct  340  WRTQNDVLENGAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLT 390

Sequence Alignment: 22. Allergen Name: Amb a 1 Sequence ID: P27760

 Score = 241.6 bits 1032,  Expect = 4e-65
 Identities = 165/344 47%, Positives = 213/344 61%, Gaps = 9/344 2%
Query  18   SCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGDFYTVTST-DDNPVNPTP 76
            +C + N ID CWR  ++W  NR  LADCA GF   T GGK GD YTVTS  DD+  NP  
Sbjct  45   ACEAHNIIDKCWRCKADWANNRQALADCAQGFAKGTYGGKHGDVYTVTSDKDDDVANPKE 104
Query  77   GTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSH 136
            GTLR+ A + + LWIIF +NM I L   L V   KTIDGRG  V++ N G  L +  V +
Sbjct  105  GTLRFAAAQNRPLWIIFKRNMVIHLNQELVVNSDKTIDGRGVKVNIVNAG--LTLMNVKN 162
Query  137  VILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQ--DGDAITMRNVTNAWIDHNSLSDCSD 194
            +I+H+++IH  +  V    ++  + G  P+  Q  DGDAI +   +  WIDH SLS  SD
Sbjct  163  IIIHNINIH--DIKVCPGGMIKSNDG-PPILRQQSDGDAINVAGSSQIWIDHCSLSKASD 219
Query  195  GLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRA 254
            GL+D+TLGS+ +T+SN  F  H+ V+LLG DDT+  DK M  TVAFN F  +  QRMPR 
Sbjct  220  GLLDITLGSSHVTVSNCKFTQHQFVLLLGADDTHYQDKGMLATVAFNMFTDHVDQRMPRC 279
Query  255  RYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESPSACAN 314
            R+G+ +V NNNYD W  YAIGGSS PTILS+GN F AP +  KK V  R G    +   +
Sbjct  280  RFGFFQVVNNNYDRWGTYAIGGSSAPTILSQGNRFFAPDDIIKKNVLARTGT-GNAESMS 338
Query  315  WVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLTKNAGVVT 367
            W WR+ RD + NGA F+ SG                E G A  +LT +AGV++
Sbjct  339  WNWRTDRDLLENGAIFLPSGSDPVLTPEQKAGMIPAEPGEAVLRLTSSAGVLS 391

Sequence Alignment: 23. Allergen Name: Amb a 1 Sequence ID: P27759

 Score = 240.9 bits 1029,  Expect = 7e-65
 Identities = 161/341 47%, Positives = 214/341 62%, Gaps = 5/341 1%
Query  23   NPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGDFYTVTST-DDNPVNPTPGTLRY 81
            N ID CWRG ++W +NR  LADCA GFG  T+GGK GD YTVTS  DD+  NP  GTLR+
Sbjct  48   NIIDGCWRGKADWAENRKALADCAQGFGKGTVGGKDGDIYTVTSELDDDVANPKEGTLRF 107
Query  82   GATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHS 141
            GA + + LWIIF ++M I+L   + V   KTIDGRGA V + N G  + +  V +VI+H+
Sbjct  108  GAAQNRPLWIIFERDMVIRLDKEMVVNSDKTIDGRGAKVEIINAG--FTLNGVKNVIIHN 165
Query  142  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 201
            +++H    +  G ++ S      P    DGDAI++   +  WIDH SLS   DGL+D  L
Sbjct  166  INMHDVKVNP-GGLIKSNDGPAAPRAGSDGDAISISGSSQIWIDHCSLSKSVDGLVDAKL 224
Query  202  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 261
            G+T +T+SN+ F  H+ V+L+G  D   +D+ M  TVAFN F  N  QRMPR R+G+ +V
Sbjct  225  GTTRLTVSNSLFTQHQFVLLFGAGDENIEDRGMLATVAFNTFTDNVDQRMPRCRHGFFQV 284
Query  262  ANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESPSACANWVWRSTR 321
             NNNYD W  YAIGGS++PTILS+GN F AP E  KK V  R G E+ +    W WR+ +
Sbjct  285  VNNNYDKWGSYAIGGSASPTILSQGNRFCAPDERSKKNVLGRHG-EAAAESMKWNWRTNK 343
Query  322  DAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLTKNAGVVT 367
            D + NGA FV+SG         S      E G +A  LT +AGV++
Sbjct  344  DVLENGAIFVASGVDPVLTPEQSAGMIPAEPGESALSLTSSAGVLS 389

Sequence Alignment: 24. Allergen Name: Amb a 1 Sequence ID: P28744

 Score = 225.4 bits 961,  Expect = 3e-60
 Identities = 159/344 46%, Positives = 211/344 61%, Gaps = 10/344 2%
Query  15   AIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGDFYTVTST-DDNPVN 73
            ++ +C + N ID CWRG ++W +NR  LADCA GF   T+GGK GD YTVTS  DD+  N
Sbjct  41   SLTTCGTYNIIDGCWRGKADWAENRKALADCAQGFAKGTIGGKDGDIYTVTSELDDDVAN 100
Query  74   PTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRK 133
            P  GTLR+GA + + LWIIF+++M I+L   L +   KTIDGRGA V + N G  ++   
Sbjct  101  PKEGTLRFGAAQNRPLWIIFARDMVIRLDRELAINNDKTIDGRGAKVEIINAGFAIY--N 158
Query  134  VSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCS 193
            V ++I+H++ +H    +  G ++ S      P    DGDAI +   +  WIDH SLS   
Sbjct  159  VKNIIIHNIIMHDIVVNP-GGLIKSHDGPPVPRKGSDGDAIGISGGSQIWIDHCSLSKAV 217
Query  194  DGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPR 253
            DGLID   GST  T+SN  +F +H+ +LL  D    D++ M  TVAFN+F  N  QRMP 
Sbjct  218  DGLIDAKHGSTHFTVSNC-LFTQHQYLLLFWD---FDERGMLCTVAFNKFTDNVDQRMPN 273
Query  254  ARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESPSACA 313
             R+G+V+V NNNY+ W  YA+GGS+ PTILS+GN F A     KKEV  R G  + S   
Sbjct  274  LRHGFVQVVNNNYERWGSYALGGSAGPTILSQGNRFLAS--DIKKEVVGRYGESAMSESI 331
Query  314  NWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLTKNAGVVT 367
            NW WRS  D F NGA FV SG         +      E G A  +LT +AGV++
Sbjct  332  NWNWRSYMDVFENGAIFVPSGVDPVLTPEQNAGMIPAEPGEAVLRLTSSAGVLS 385

Sequence Alignment: 25. Allergen Name: Pen c 32.0101 Sequence ID: ABM60783

 Score = 66.4 bits 263,  Expect = 2e-12
 Identities = 74/216 34%, Positives = 116/216 53%, Gaps = 45/216 20%
Query  42   LADCAVGFGS---STMGGKGGDFYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMN 98
            + D A G+ S    T GG GG   TV+S            +    + + A  ++F     
Sbjct  1    VGDVATGYASENGGTTGGSGGTTTTVSSY---------AAFTEAVSGDDAK-VVFVSGKI 50
Query  99   IKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVS 158
             K      V  + +I G+ ++  L   G  +++++ S+VI+ +L                
Sbjct  51   SKTADQARVGSNTSIIGKDSNAILSGFG--VLVKEASNVIIRNL---------------- 92
Query  159  ESIGVEPVHAQDGDAITMRNVTNAWIDHNSLS-------DCSDGLIDVTLGSTGITISNN 211
               GVE V A +GDAI ++   N W+DH  +S       D  DGLID+T  +  +T+SN 
Sbjct  93   ---GVEKVLADNGDAIGIQKSNNVWVDHCDVSSDRDHDKDYYDGLIDITHAADYVTVSNT 149
Query  212  HFFNHHKVMLLGHDDTY-DDDKS-MKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDPW 269
               +H K  L+GH D+  D+DK  + VT+  N +  N   R P  R+G  HV N+ Y   
Sbjct  150  SIHDHWKACLIGHSDSNGDEDKGHLHVTLN-NNYWYNINSRGPSFRFGTGHVYNSYYLDM 208
Query  270  NIYAIGGSSNPTILSEGNSFT 290
            +   I        L E N+F+
Sbjct  209  S-DGINTRQGAQHLVESNTFS 228

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.