The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDN
GGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNT
EPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNP
NYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTES
DQKLVANDVIPDNWKANALYKSEIQVD
Sequence Info Allergen Name Length Opt Bits Score E Value
AAF72991 Ory s 1 267 1875 370.1 4.6e-104
AAF72983 Ory s 1 267 1615 320.0 5.5e-89
Q40638 Ory s 1 263 1389 276.5 6.9e-76
P43213 Phl p 1 263 1309 261.0 3e-71
AAF72990 Ory s 1 269 1289 257.2 4.5e-70
CAA81613 Phl p 1.0101 263 1286 256.6 6.5e-70
CAA10140 Hol l 1 263 1280 255.5 1.4e-69
CAA10520 Poa p a 263 1272 253.9 4.2e-69
P43216 Hol l 1 265 1262 252.0 1.6e-68
Q41260 Pha a 1 269 1261 251.8 1.9e-68
CAA93121 Hol l 1.0102 248 1253 250.3 5e-68
CAB63699 Lol p 1.0103 263 1246 248.9 1.4e-67
ACA23876 Pas n 1.0101 265 1241 247.9 2.7e-67
AAA63279 Lol p 1.0101 263 1239 247.6 3.5e-67
P14946 Lol p 1 263 1237 247.2 4.5e-67
AAA63278 Lol p 1.0102 252 1235 246.8 5.6e-67
P58738 Zea m 1 269 1227 245.2 1.8e-66
A0A4D6G2J8 Uro m 1.0201 229 1213 242.6 9.5e-66
AAL14077 Cyn d 1.0202 262 1200 240.0 6.3e-65
A0A4D6FZ45 Uro m 1.0101 262 1200 240.0 6.3e-65
AAL14079 Cyn d 1.0203 262 1200 240.0 6.3e-65
AAL14078 Cyn d 1 262 1184 237.0 5.3e-64
QCX36431 Zoy m 1.0101 272 1182 236.6 7.3e-64
AAK96255 Cyn d 1.0201 244 1174 235.0 1.9e-63
AAF80379 Cyn d 1.0204 244 1171 234.5 2.8e-63
ABC58726 Sor h 1.0101 239 1160 232.4 1.2e-62
O04701 Cyn d 1 246 1142 228.9 1.4e-61
AAF72984 Ory s 1 268 1042 209.6 9.4e-56
AAF72987 Ory s 1 275 1033 207.9 3.2e-55
AAF72985 Ory s 1 286 992 199.9 8e-53
AAF72989 Ory s 1 271 961 194.0 4.7e-51
AAB61710 Ory s 1 261 957 193.2 7.8e-51
AAD10496 Tri a ps93 271 956 193.0 9.3e-51
Q07154 Zea m 1 191 897 181.7 1.6e-47
AAF72988 Ory s 1 327 813 165.4 2.3e-42
AAA50175 Gly m 2 277 801 163.2 9.3e-42
AAF72986 Ory s 1 275 755 154.3 4.3e-39
CAB37496 Ara t expansin 265 488 102.9 1.3e-23
AAG13596 Ory s 1 275 389 83.8 7.2e-18
BAA85432 Ory s 1 284 372 80.5 7.3e-17
CAA10346 Cyn d 2 122 296 66.0 7e-13
CAA10345 Dac g 2 122 292 65.3 1.2e-12
CAA10348 Poa p 2 122 292 65.3 1.2e-12
P43214 Phl p 2 122 292 65.3 1.2e-12
P93124 Dac g 3 96 263 59.7 4.4e-11
P14947 Lol p 2 97 263 59.7 4.4e-11
2JNZ_A Phl p 3.0101 108 254 58.0 1.7e-10
CAA51775 Lol p 2 88 235 54.3 1.7e-09
P14948 Lol p 3 97 228 53.0 4.8e-09
CAA90746 Tri a 3 118 223 52.0 1.2e-08
Q7M1X8 Dac g 1.0101 34 210 49.7 1.6e-08
AAP80171 Cyn d 15 112 218 51.0 2.1e-08
Q7M1X6 Ant o 1.0101 32 182 44.3 6.2e-07
A0A077B7S9 Sor h 2.0101 119 150 37.9 0.0002
A0A077B2S0 Sor h 2.0201 121 132 34.4 0.0023
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 370.1 bits 1875,  Expect = 5e-104
 Identities = 267/267 100%, Positives = 267/267 100%, Gaps = 0/267 0%
Query  1    MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDN 60
            MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDN
Sbjct  1    MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDN 60
Query  61   GGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNT 120
            GGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNT
Sbjct  61   GGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNT 120
Query  121  EPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNP 180
            EPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNP
Sbjct  121  EPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNP 180
Query  181  NYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTES 240
            NYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTES
Sbjct  181  NYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTES 240
Query  241  DQKLVANDVIPDNWKANALYKSEIQVD 267
            DQKLVANDVIPDNWKANALYKSEIQVD
Sbjct  241  DQKLVANDVIPDNWKANALYKSEIQVD 267

Sequence Alignment: 2. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 320.0 bits 1615,  Expect = 5e-89
 Identities = 219/265 82%, Positives = 243/265 91%, Gaps = 0/265 0%
Query  1    MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDN 60
            MASS LLLACVV AAMVSAVSCGPPKVPPGPNIT +YG +WLEA+ TWYG PKGAGP DN
Sbjct  1    MASSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDN 60
Query  61   GGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNT 120
            GGACGYKD+DKAPFLGMNSCGNDPIFKDGKGCGSCFE+KCSKPEACSDKP +IH+TDMN 
Sbjct  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
Query  121  EPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNP 180
            EPIAAYHFDLSG AFGAMAK+GKDEELRKAGIID QFRRV+CKYP +TK+TFH+EK SNP
Sbjct  121  EPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 180
Query  181  NYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTES 240
            NY+A+LVKYV GDGDVV+VE+KEKGSEEWK L ESWGAIWRIDTPKPLKGPFS+RVTTE 
Sbjct  181  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 240
Query  241  DQKLVANDVIPDNWKANALYKSEIQ 265
             +K++A D IPD WKA+++YKS +Q
Sbjct  241  GEKIIAEDAIPDGWKADSVYKSNVQ 265

Sequence Alignment: 3. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 276.5 bits 1389,  Expect = 7e-76
 Identities = 196/249 78%, Positives = 216/249 86%, Gaps = 3/249 1%
Query  1    MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDN 60
            MASS LLLACVV AAMVS    G PKVPPGPNIT +YG +WLEAR     +P+   P DN
Sbjct  1    MASSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDN 60
Query  61   GGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNT 120
            GGACGYKD+DKAPFLGMNSCGNDPIFKDGKGCGSCFE+KCSKPEACSDKP +IH+TDMN 
Sbjct  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
Query  121  EPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNP 180
            EPIAAYHFDLSG A   MAK+GKDEELRKAGIID QFRRV+CKYP +TK+TFH+EK SNP
Sbjct  121  EPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 177
Query  181  NYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTES 240
            NY+A+LVKYV GDGDVV+VE+KEKGSEEWK L ESWGAIWRIDTPKPLKGPFS+RVTTE 
Sbjct  178  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 237
Query  241  DQKLVANDVIPD 252
             ++  A D IPD
Sbjct  238  ARRSSAEDAIPD 249

Sequence Alignment: 4. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 261.0 bits 1309,  Expect = 3e-71
 Identities = 179/263 68%, Positives = 212/263 80%, Gaps = 0/263 0%
Query  1    MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDN 60
            MASS  +L  VV  A+    + G PKVPPGPNITA YG +WL+A+ TWYGKP GAGP DN
Sbjct  1    MASSSSVLLVVVLFAVFLGSAYGIPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNT 120
            GGACGYKD+DK PF GM  CGN PIFK G+GCGSCFE+KC+KPEACS +PV++HITD N 
Sbjct  61   GGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNE 120
Query  121  EPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNP 180
            EPIA YHFDLSGHAFGAMAK+G +++LR AG +++QFRRV+CKYP  TKVTFHVEKGSNP
Sbjct  121  EPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNP 180
Query  181  NYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTES 240
            NY+A+LVKYV GDGDVV V++KEKG ++W  L ESWGAIWRIDTP  L GPF++R TTE 
Sbjct  181  NYLALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEG 240
Query  241  DQKLVANDVIPDNWKANALYKSE 263
              K  A DVIP+ WKA+  Y+S+
Sbjct  241  GTKTEAEDVIPEGWKADTSYESK 263

Sequence Alignment: 5. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 257.2 bits 1289,  Expect = 4e-70
 Identities = 174/263 66%, Positives = 209/263 79%, Gaps = 0/263 0%
Query  3    SSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDNGG 62
            ++ ++LA  V AA+V   SCGPPKVPPGPNIT  Y   WL AR TWYG+P G+G  DNGG
Sbjct  5    TTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGSTDNGG 64
Query  63   ACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTEP 122
            ACG K+++  P+ GM SCGN PIFKDG+GCGSC+EVKC +P ACS +PV + ITDMN EP
Sbjct  65   ACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEP 124
Query  123  IAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNY 182
            I+AYHFD+SG AFGAMA  GK+ ELRKAGIIDMQFRRVRCKYPG  KVTFHVEKGSNPNY
Sbjct  125  ISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNY 184
Query  183  FAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQ 242
            +AVLVK+V  DGDV++++L+E G   W+P+  SWGAIWR+DT  PLK PFS+RVTTES +
Sbjct  185  LAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGK 244
Query  243  KLVANDVIPDNWKANALYKSEIQ 265
             L+A DVIP NW  +A+Y S +Q
Sbjct  245  SLIAKDVIPVNWMPDAIYVSNVQ 267

Sequence Alignment: 6. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 256.6 bits 1286,  Expect = 6e-70
 Identities = 176/263 66%, Positives = 212/263 80%, Gaps = 0/263 0%
Query  1    MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDN 60
            MASS  +L  V   A+    + G PKVPPGPNITA YG +WL+A+ TWYGKP  AGP DN
Sbjct  1    MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYGKPTAAGPKDN 60
Query  61   GGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNT 120
            GGACGYKD+DK PF GM  CGN PIFK G+GCGSCFE+KC+KPEACS +PV++HITD N 
Sbjct  61   GGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNE 120
Query  121  EPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNP 180
            EPIAAYHFDLSG AFG+MAK+G +++LR AG +++QFRRV+CKYP  TKVTFHVEKGSNP
Sbjct  121  EPIAAYHFDLSGIAFGSMAKKGDEQKLRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNP 180
Query  181  NYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTES 240
            NY+A+LVK+V GDGDVV V++KEKG ++W  L ESWGAIWRIDTP+ LKGPF++R TTE 
Sbjct  181  NYLALLVKFVAGDGDVVAVDIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEG 240
Query  241  DQKLVANDVIPDNWKANALYKSE 263
              K  A DVIP+ WKA+  Y+S+
Sbjct  241  GTKGEAKDVIPEGWKADTAYESK 263

Sequence Alignment: 7. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 255.5 bits 1280,  Expect = 1e-69
 Identities = 171/263 65%, Positives = 213/263 80%, Gaps = 0/263 0%
Query  1    MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDN 60
            MASS L+L  V   A+    + G  KVPPGPNITA YG +WL+A+ TWYGKP GAGP DN
Sbjct  1    MASSSLVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNT 120
            GGACGYKD+DK PF GM  CGN PIFK G+GCGSCFE+KC+KPE+CS +P+++HITD N 
Sbjct  61   GGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPIVVHITDDNE 120
Query  121  EPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNP 180
            EPIAAYH+DLSG AFGAMAK+G++++LR AG ++++FRRV+C+YP  TKVTFHVEKGSNP
Sbjct  121  EPIAAYHLDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPKGTKVTFHVEKGSNP 180
Query  181  NYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTES 240
            NY+A+LVKYV GDGDVV V++KEKG ++W  L ESWGA+WR+DTP  L GPF++R TTE 
Sbjct  181  NYLALLVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEG 240
Query  241  DQKLVANDVIPDNWKANALYKSE 263
              K+ A DVIP+ WKA+  Y+S+
Sbjct  241  GTKVEAEDVIPEGWKADTAYESK 263

Sequence Alignment: 8. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 253.9 bits 1272,  Expect = 4e-69
 Identities = 173/263 65%, Positives = 211/263 80%, Gaps = 0/263 0%
Query  1    MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDN 60
            MASS  +L  V   A+    + G  KVPPGPNITA YG +WL+A+ TWYGKP GAGP DN
Sbjct  1    MASSSSVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNT 120
            GGACGYKD+DKAPF GM  CGN PIFK G+GCGSCFE+KC+KPE+CS +PV++HITD N 
Sbjct  61   GGACGYKDVDKAPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPVLVHITDDNE 120
Query  121  EPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNP 180
            EPIAAYHFDLSG AFGAMAK+G++++LR AG ++++FRRV+C+YP  TKVTFHVEKGSNP
Sbjct  121  EPIAAYHFDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPEGTKVTFHVEKGSNP 180
Query  181  NYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTES 240
            NY+A+LVKYV GDGDVV V++KEKG ++W  L ESWG+IWR+DTP  L GPF++R TTE 
Sbjct  181  NYLALLVKYVTGDGDVVAVDIKEKGKDKWIELKESWGSIWRVDTPDKLTGPFTVRYTTEG 240
Query  241  DQKLVANDVIPDNWKANALYKSE 263
              K  A DVIP+ WKA+  Y S+
Sbjct  241  GTKGEAEDVIPEGWKADTAYASK 263

Sequence Alignment: 9. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 252.0 bits 1262,  Expect = 2e-68
 Identities = 171/263 65%, Positives = 212/263 80%, Gaps = 2/263 0%
Query  1    MASSCLLLACVVAA--AMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPD 58
            MASS   +  +VAA  A+    + G  KVPPGPNITA YG +WL+A+ TWYGKP GAGP 
Sbjct  1    MASSSRSVLLLVAALFAVFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPK 60
Query  59   DNGGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDM 118
            DNGGACGYKD+DK PF GM  CGN PIFKDG+GCGSCFE+KC+KPE+CS +PV +HITD 
Sbjct  61   DNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEPVTVHITDD 120
Query  119  NTEPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGS 178
            N EPIA YHFDLSGHAFG+MAK+G++++LR AG ++++FRRV+CKYP  TK TFHVEKGS
Sbjct  121  NEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGS 180
Query  179  NPNYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTT 238
            NPNY+A+LVKY+ GDGDVV V++KEKG ++W  L ESWGA+WR+DTP  L GPF++R TT
Sbjct  181  NPNYLALLVKYIDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTT 240
Query  239  ESDQKLVANDVIPDNWKANALYKSE 263
            E   K  A DVIP+ WKA+  Y+++
Sbjct  241  EGGTKGEAEDVIPEGWKADTAYEAK 265

Sequence Alignment: 10. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 251.8 bits 1261,  Expect = 2e-68
 Identities = 172/255 67%, Positives = 205/255 80%, Gaps = 1/255 0%
Query  2    ASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDNG 61
            +SS LL+   + A  V +   G  KVPPGPNITA YG +WL+A+ TWYGKP GAGP DNG
Sbjct  9    SSSSLLVVAALLAVFVGSAQ-GIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNG 67
Query  62   GACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTE 121
            GACGYKD+DKAPF GM  CGN PIFKDG+GCGSCFE+KCSKPE+CS +P+ +HITD N E
Sbjct  68   GACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFELKCSKPESCSGEPITVHITDDNEE 127
Query  122  PIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPN 181
            PIA YHFDLSGHAFG+MAK+G++E +R AG +++QFRRV+CKYP  TK TFHVEKGSNPN
Sbjct  128  PIAPYHFDLSGHAFGSMAKKGEEENVRGAGELELQFRRVKCKYPDGTKPTFHVEKGSNPN 187
Query  182  YFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESD 241
            Y+A+LVKYV GDGDVV V++KEKG ++W  L ESWGAIWRIDTP  L GPF++R TTE  
Sbjct  188  YLALLVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGG 247
Query  242  QKLVANDVIPDNWKAN 257
             K    DVIP+ WKA+
Sbjct  248  TKAEFEDVIPEGWKAD 263

Sequence Alignment: 11. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 250.3 bits 1253,  Expect = 5e-68
 Identities = 164/241 68%, Positives = 200/241 82%, Gaps = 0/241 0%
Query  23   GPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDNGGACGYKDIDKAPFLGMNSCGN 82
            G  KVPPGPNITA YG +WL+A+ TWYGKP GAGP DNGGACGYKD+DK PF GM  CGN
Sbjct  8    GIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGN 67
Query  83   DPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAFGAMAKEG 142
             PIFKDG+GCGSCFE+KCSKPE+CS +PV +HITD N EPIA YHFDLSGHAFG+MAK+G
Sbjct  68   TPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKG 127
Query  143  KDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELK 202
            ++++LR AG ++++FRRV+CKYP  TK TFHVEKGSNPNY+A+LVKY+ GDGDVV V++K
Sbjct  128  EEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIK 187
Query  203  EKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDVIPDNWKANALYKS 262
            EKG ++W  L ESWGA+WR+DTP  L GPF++R TTE   K  A DVIP+ WKA+  Y++
Sbjct  188  EKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEA 247
Query  263  E 263
            +
Sbjct  248  K 248

Sequence Alignment: 12. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 248.9 bits 1246,  Expect = 1e-67
 Identities = 170/263 64%, Positives = 206/263 78%, Gaps = 0/263 0%
Query  1    MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDN 60
            MASS  +L  V   A+    + G  KVPPGPNITA YG +WL+A+ TWYGKP GAGP DN
Sbjct  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNT 120
            GGACGYKD+DKAPF GM  CGN PIFKDG+GCGSCFE+KC+KPE+CS + V + ITD N 
Sbjct  61   GGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
Query  121  EPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNP 180
            EPIA YHFDLSGHAFG+MAK+G++++LR AG +++QFRRV+CKYP  TK TFHVEK SNP
Sbjct  121  EPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNP 180
Query  181  NYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTES 240
            NY+A+LVKYV GDGDVV V++KEKG ++W  L ESWGA+WRIDTP  L GPF++R TTE 
Sbjct  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
Query  241  DQKLVANDVIPDNWKANALYKSE 263
              K    DVIP+ WKA+  Y ++
Sbjct  241  GTKSEVEDVIPEGWKADTSYSAK 263

Sequence Alignment: 13. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 247.9 bits 1241,  Expect = 3e-67
 Identities = 165/252 65%, Positives = 204/252 80%, Gaps = 2/252 0%
Query  12   VAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDNGGACGYKDIDK 71
            V AA+V+  SCGPPKVPPGPNIT  Y  +WL A+ TWYG+P GAGPDDNGGACG K+++ 
Sbjct  13   VLAALVAGGSCGPPKVPPGPNITTNYNGKWLPAKATWYGQPNGAGPDDNGGACGIKNVNL 72
Query  72   APFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTEPIAAYHFDLS 131
             P+ G  +CGN PIFKDGKGCGSC+E++C+KPE CS +PV + ITDMN EPIA YHFDLS
Sbjct  73   PPYNGFTACGNPPIFKDGKGCGSCYEIRCNKPE-CSGQPVTVFITDMNYEPIAPYHFDLS 131
Query  132  GHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVG 191
            G AFGAMAK G +++LR  GI D++FRRVRCKY G  K+ FHVEKGSNPNY+A+LVK+V 
Sbjct  132  GKAFGAMAKPGLNDKLRHYGIFDLEFRRVRCKYQGGQKIVFHVEKGSNPNYLAMLVKFVA 191
Query  192  GDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDVIP 251
             DGD+V +ELKEK S+ WKP+  SWGAIWR+DTPK L  PFS+R+T+ES +K++A DVIP
Sbjct  192  DDGDIVLMELKEKSSD-WKPMKLSWGAIWRMDTPKALVPPFSIRLTSESGKKVIAQDVIP 250
Query  252  DNWKANALYKSEIQ 265
             NWK + +Y S +Q
Sbjct  251  VNWKPDTVYNSNVQ 264

Sequence Alignment: 14. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 247.6 bits 1239,  Expect = 3e-67
 Identities = 168/263 63%, Positives = 206/263 78%, Gaps = 0/263 0%
Query  1    MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDN 60
            MASS  +L  V   A+    + G  KVPPGPNITA YG +WL+A+ TWYGKP GAGP DN
Sbjct  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNT 120
            GGACGYK++DKAPF GM  CGN PIFKDG+GCGSCFE+KC+KPE+CS + V + ITD N 
Sbjct  61   GGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
Query  121  EPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNP 180
            EPIA YHFDLSGHAFG+MAK+G+++ +R AG +++QFRRV+CKYP +TK TFHVEK SNP
Sbjct  121  EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNP 180
Query  181  NYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTES 240
            NY+A+LVKYV GDGDVV V++KEKG ++W  L ESWGA+WRIDTP  L GPF++R TTE 
Sbjct  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
Query  241  DQKLVANDVIPDNWKANALYKSE 263
              K    DVIP+ WKA+  Y ++
Sbjct  241  GTKSEFEDVIPEGWKADTSYSAK 263

Sequence Alignment: 15. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 247.2 bits 1237,  Expect = 5e-67
 Identities = 168/263 63%, Positives = 206/263 78%, Gaps = 0/263 0%
Query  1    MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDN 60
            MASS  +L  V   A+    + G  KVPPGPNITA YG +WL+A+ TWYGKP GAGP DN
Sbjct  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNT 120
            GGACGYK++DKAPF GM  CGN PIFKDG+GCGSCFE+KC+KPE+CS + V + ITD N 
Sbjct  61   GGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
Query  121  EPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNP 180
            EPIA YHFDLSGHAFG+MAK+G+++ +R AG +++QFRRV+CKYP +TK TFHVEK SNP
Sbjct  121  EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNP 180
Query  181  NYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTES 240
            NY+A+LVKYV GDGDVV V++KEKG ++W  L ESWGA+WRIDTP  L GPF++R TTE 
Sbjct  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
Query  241  DQKLVANDVIPDNWKANALYKSE 263
              K    DVIP+ WKA+  Y ++
Sbjct  241  GTKSEFEDVIPEGWKADTSYSAK 263

Sequence Alignment: 16. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 246.8 bits 1235,  Expect = 6e-67
 Identities = 163/241 67%, Positives = 197/241 81%, Gaps = 0/241 0%
Query  23   GPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDNGGACGYKDIDKAPFLGMNSCGN 82
            G  KVPPGPNITA YG +WL+A+ TWYGKP GAGP DNGGACGYKD+DKAPF GM  CGN
Sbjct  12   GIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFNGMTGCGN 71
Query  83   DPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAFGAMAKEG 142
             PIFKDG+GCGSCFE+KC+KPE+CS + V + ITD N EPIA YHFDLSGHAFG+MAK+G
Sbjct  72   TPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKG 131
Query  143  KDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELK 202
            +++ +R AG +++QFRRV+CKYP +TK TFHVEKGSNPNY+A+LVKYV GDGDVV V++K
Sbjct  132  EEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKGSNPNYLAILVKYVDGDGDVVAVDIK 191
Query  203  EKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDVIPDNWKANALYKS 262
            EKG ++W  L ESWGA+WRIDTP  L GPF++R TTE   K    DVIP+ WKA+  Y +
Sbjct  192  EKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYSA 251
Query  263  E 263
            +
Sbjct  252  K 252

Sequence Alignment: 17. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 245.2 bits 1227,  Expect = 2e-66
 Identities = 159/260 61%, Positives = 205/260 78%, Gaps = 0/260 0%
Query  6    LLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDNGGACG 65
            +++   V AA+V+  SCGPPKVPPGPNIT  Y  +WL AR TWYG+P GAG  DNGGACG
Sbjct  8    IMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAPDNGGACG 67
Query  66   YKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTEPIAA 125
             K+++  P+ GM +CGN PIFKDGKGCGSC+EV+C +   CS  PV ++ITDMN EPIA 
Sbjct  68   IKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDMNYEPIAP 127
Query  126  YHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAV 185
            YHFDLSG AFG++AK G ++++R  GI+D++FRRVRCKYP   K+ FH+EKG NPNY+AV
Sbjct  128  YHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAV 187
Query  186  LVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLV 245
            LVKYV  DGD+V +E+++K S EWKP+  SWGAIWR+DT K LKGPFS+R+T+ES +K++
Sbjct  188  LVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVI 247
Query  246  ANDVIPDNWKANALYKSEIQ 265
            A DVIP NW+ +A+Y S +Q
Sbjct  248  AKDVIPANWRPDAVYTSNVQ 267

Sequence Alignment: 18. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 242.6 bits 1213,  Expect = 9e-66
 Identities = 157/226 69%, Positives = 192/226 84%, Gaps = 0/226 0%
Query  40   QWLEARGTWYGKPKGAGPDDNGGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVK 99
            +WL+A+ TWYGKP GAGPDDNGGACGYKD++KAPF  M +CGN PIFKDG GCGSC+E+K
Sbjct  3    KWLDAKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNPPIFKDGLGCGSCYEIK 62
Query  100  CSKPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRR 159
            C KP  CS +PVI+HITD N EPIAAYHFDL+G AFGAMAK+G++E+LRKAGIIDMQFRR
Sbjct  63   CDKPAECSGEPVIVHITDQNYEPIAAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQFRR 122
Query  160  VRCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAI 219
            V+CKYP  TK+ FHVEKG NPNYFA+L+KY  GDGD+V V++KEKGSEE+ PL  SWGAI
Sbjct  123  VKCKYPANTKIAFHVEKGCNPNYFALLIKYAAGDGDIVAVDIKEKGSEEFIPLKHSWGAI 182
Query  220  WRIDTPKPLKGPFSLRVTTESDQKLVANDVIPDNWKANALYKSEIQ 265
            WRID+PKP+KGP ++R+T+E    LV +D IP+ WKA+ +Y S++Q
Sbjct  183  WRIDSPKPIKGPIAVRLTSEGGTTLVQDDAIPEGWKADTVYTSKLQ 228

Sequence Alignment: 19. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 240.0 bits 1200,  Expect = 6e-65
 Identities = 162/259 62%, Positives = 208/259 80%, Gaps = 2/259 0%
Query  6    LLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGK-PKGAGPDDNGGAC 64
            L +  VV A+MV    C      PGPNITA YG +WL+A+ T+YG  P+GA PDD+GGAC
Sbjct  2    LAVVAVVLASMVGGALCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  65   GYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTEPIA 124
            GYKD+DKAPF GM  CGN+PIFKDG  CGSC+E+KC +P  CS +PV+I ITD N E IA
Sbjct  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  125  AYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFA 184
            AYHFDLSG AFGAMAK+G++++LRKAG + +QFRRV+C+YP +TK+ FHVEKGSNPNY+A
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  185  VLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKL 244
            +LVKY  GDG++V V++K KGS+E+ P+ +SWGAIWRID PKPLKGPF++R+T+ES   +
Sbjct  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
Query  245  VANDVIPDNWKANALYKSEIQ 265
               DVIP++WK + +YKS+IQ
Sbjct  241  EQEDVIPEDWKPDTVYKSKIQ 261

Sequence Alignment: 20. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 240.0 bits 1200,  Expect = 6e-65
 Identities = 162/259 62%, Positives = 208/259 80%, Gaps = 2/259 0%
Query  6    LLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGK-PKGAGPDDNGGAC 64
            L +  VV A+MV    C      PGPNITA YG +WL+A+ T+YG  P+GA PDD+GGAC
Sbjct  2    LAVVAVVLASMVGGALCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  65   GYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTEPIA 124
            GYKD+DKAPF  M  CGN+PIFKDG GCGSC+E+KC +P  CS +PV+I ITD N E IA
Sbjct  61   GYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  125  AYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFA 184
            AYHFDLSG AFGAMAK+G++++LRKAG + +QFRRV+C+YP +TK+ FHVEKGSNPNY+A
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  185  VLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKL 244
            +LVKY  GDG++V V++K KGS+E+ P+ +SWGAIWRID PKPLKGPF++R+T+ES   +
Sbjct  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
Query  245  VANDVIPDNWKANALYKSEIQ 265
               DVIP++WK + +YKS+IQ
Sbjct  241  EQEDVIPEDWKPDTVYKSKIQ 261

Sequence Alignment: 21. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 240.0 bits 1200,  Expect = 6e-65
 Identities = 162/259 62%, Positives = 208/259 80%, Gaps = 2/259 0%
Query  6    LLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGK-PKGAGPDDNGGAC 64
            L +  VV A+MV    C      PGPNITA YG +WL+A+ T+YG  P+GA PDD+GGAC
Sbjct  2    LAVVAVVLASMVGGALCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  65   GYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTEPIA 124
            GYKD+DKAPF  M  CGN+PIFKDG GCGSC+E+KC +P  CS +PV+I ITD N E IA
Sbjct  61   GYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  125  AYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFA 184
            AYHFDLSG AFGAMAK+G++++LRKAG + +QFRRV+C+YP +TK+ FHVEKGSNPNY+A
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  185  VLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKL 244
            +LVKY  GDG++V V++K KGS+E+ P+ +SWGAIWRID PKPLKGPF++R+T+ES   +
Sbjct  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
Query  245  VANDVIPDNWKANALYKSEIQ 265
               DVIP++WK + +YKS+IQ
Sbjct  241  EQEDVIPEDWKPDTVYKSKIQ 261

Sequence Alignment: 22. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 237.0 bits 1184,  Expect = 5e-64
 Identities = 160/254 62%, Positives = 206/254 81%, Gaps = 2/254 0%
Query  11   VVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGK-PKGAGPDDNGGACGYKDI 69
            VV A+MV    C      PGPNITA YG +WL+A+ T+YG  P+GA PDD+GGACGYKD+
Sbjct  7    VVLASMVGGAWCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDV 65
Query  70   DKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTEPIAAYHFD 129
            DKAPF GM  CGN+PIFKDG GCGSC+E+KC +P  CS +PV+I ITD N E IAAYHFD
Sbjct  66   DKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFD 125
Query  130  LSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKY 189
            LSG AFGAMAK+G++++LRKAG + +QFRRV+C+YP +TK+TFHVEKGS+PNY+A+LVKY
Sbjct  126  LSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKY 185
Query  190  VGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDV 249
              GDG++V V++K KGS+ + P+  SWGAIWR+D PKPLKGPF++R+T+ES   +   DV
Sbjct  186  AAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQEDV 245
Query  250  IPDNWKANALYKSEIQ 265
            IP++WK + +YKS+IQ
Sbjct  246  IPEDWKPDTVYKSKIQ 261

Sequence Alignment: 23. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 236.6 bits 1182,  Expect = 7e-64
 Identities = 160/254 62%, Positives = 203/254 79%, Gaps = 2/254 0%
Query  11   VVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGK-PKGAGPDDNGGACGYKDI 69
            V+ +AMV +  C      PGPNITA Y ++W +A+ T+YG  P+GA PDD+GGACGYK++
Sbjct  17   VLLSAMVGSALCEIGD-KPGPNITATYNEEWQDAKATFYGSNPRGAAPDDDGGACGYKNV 75
Query  70   DKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTEPIAAYHFD 129
            DKAPF+GM  CGN+PIFKDG GCGSCFE+KC +P  CSDKPV+I ITD N E IAAYHFD
Sbjct  76   DKAPFFGMTGCGNEPIFKDGLGCGSCFEIKCKEPAECSDKPVLIRITDKNYEHIAAYHFD 135
Query  130  LSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKY 189
            LSG AFG+MAK+G+++ LRKAG + +QFRRV+C+YP +TK+TFHVEKG N NY+A+LV+Y
Sbjct  136  LSGKAFGSMAKQGQEDNLRKAGELTLQFRRVKCEYPSKTKITFHVEKGCNDNYLALLVEY 195
Query  190  VGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDV 249
              GDGD+V V++K KGS+E+ P+  SWGAIWRID  KPLKGPF++R+T+ES  KLV  DV
Sbjct  196  AAGDGDIVAVDIKPKGSDEFLPMKPSWGAIWRIDPKKPLKGPFTVRLTSESGAKLVQEDV 255
Query  250  IPDNWKANALYKSEIQ 265
            IP +WK N  Y S +Q
Sbjct  256  IPADWKPNTAYTSNLQ 271

Sequence Alignment: 24. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 235.0 bits 1174,  Expect = 2e-63
 Identities = 154/237 64%, Positives = 200/237 84%, Gaps = 1/237 0%
Query  29   PGPNITAAYGKQWLEARGTWYGK-PKGAGPDDNGGACGYKDIDKAPFLGMNSCGNDPIFK 87
            PGPNITA YG +WL+A+ T+YG  P+GA PDD+GGACGYKD+DKAPF GM  CGN+PIFK
Sbjct  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
Query  88   DGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAFGAMAKEGKDEEL 147
            DG  CGSC+E+KC +P  CS +PV+I ITD N E IAAYHFDLSG AFGAMAK+G++++L
Sbjct  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
Query  148  RKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELKEKGSE 207
            RKAG + +QFRRV+C+YP +TK+ FHVEKGS+PNY+A+LVKY  GDG++V V++K KGS+
Sbjct  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
Query  208  EWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDVIPDNWKANALYKSEIQ 265
            E+ P+ +SWGAIWRID PKPLKGPF++R+T+ES   +  +DVIP++WK + +YKS+IQ
Sbjct  186  EFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQ 243

Sequence Alignment: 25. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 234.5 bits 1171,  Expect = 3e-63
 Identities = 153/237 64%, Positives = 200/237 84%, Gaps = 1/237 0%
Query  29   PGPNITAAYGKQWLEARGTWYGK-PKGAGPDDNGGACGYKDIDKAPFLGMNSCGNDPIFK 87
            PGPNITA YG +WL+A+ T+YG  P+GA PDD+GGACGYKD+DKAPF GM  CGN+PIFK
Sbjct  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
Query  88   DGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAFGAMAKEGKDEEL 147
            DG  CGSC+E+KC +P  CS +PV+I ITD N E IAAYHFDLSG AFGAMAK+G++++L
Sbjct  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
Query  148  RKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELKEKGSE 207
            RKAG + +QFRRV+C+YP +TK+ FHVEKGS+PNY+A+LVKY  GDG++V V++K KGS+
Sbjct  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
Query  208  EWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDVIPDNWKANALYKSEIQ 265
            E+ P+ +SWGAIWR+D PKPLKGPF++R+T+ES   +  +DVIP++WK + +YKS+IQ
Sbjct  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQ 243

Sequence Alignment: 26. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 232.4 bits 1160,  Expect = 1e-62
 Identities = 160/237 67%, Positives = 195/237 82%, Gaps = 5/237 2%
Query  24   PPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDNGGACGYKDIDKAPFLGMNSCGND 83
            PPKV  G NIT  YG  WLE + TWYGKP GAGPDDNGGACGYKD++KAPF  M +CGN 
Sbjct  1    PPKVAKGKNITETYGSDWLERKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNL 60
Query  84   PIFKDGKGCGSCFEVKCSKPEA--CSDKPVIIHITDMNTEPIAAYHFDLSGHAFGAMAKE 141
            PIFKDG  CGSCFE+KC KP+   CS + V++HITDMN E IAAYHFDL+GHAFGAMAK+
Sbjct  61   PIFKDGL-CGSCFEIKCDKPKPAECSGEAVVVHITDMNYEQIAAYHFDLAGHAFGAMAKK 119
Query  142  GKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVEL 201
            G++E+L KAGIIDM+FRRV+CKY GE KVTFHVEKGSNPNY+A+LVKYV GDGD+V V++
Sbjct  120  GQEEKLAKAGIIDMKFRRVKCKY-GE-KVTFHVEKGSNPNYLALLVKYVDGDGDIVGVDI 177
Query  202  KEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDVIPDNWKANALYK 261
            KEKG + ++PL  SWGAIWR D+P P+K P ++++TTE   K   +DVIP+ WKA+  Y 
Sbjct  178  KEKGGDAYQPLKHSWGAIWRKDSPDPIKFPVTVQITTEGGTKTAYDDVIPEGWKADTTYT 237
Query  262  SE 263
            ++
Sbjct  238  AK 239

Sequence Alignment: 27. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 228.9 bits 1142,  Expect = 1e-61
 Identities = 151/237 63%, Positives = 194/237 81%, Gaps = 1/237 0%
Query  29   PGPNITAAYGKQWLEARGTWYGK-PKGAGPDDNGGACGYKDIDKAPFLGMNSCGNDPIFK 87
            PGPNITA YG +WLEAR T+YG  P+GA PDD+GGACGYKD+DK PF GM +CGN+PIFK
Sbjct  6    PGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFK 65
Query  88   DGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAFGAMAKEGKDEEL 147
            DG GC +C+E+KC +P  CS +PV++ ITD N E IAAYHFDLSG AFGAMAK+G++++L
Sbjct  66   DGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL 125
Query  148  RKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELKEKGSE 207
            RKAG + +QFRRV+CKYP  TK+TFH+EKGSN +Y+A+LVKY  GDG++V V++K + S+
Sbjct  126  RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD 185
Query  208  EWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDVIPDNWKANALYKSEIQ 265
            E+ P+  SWGAIWRID  KPLKGPFS+R+T+E    LV +DVIP NWK + +Y S++Q
Sbjct  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQ 243

Sequence Alignment: 28. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 209.6 bits 1042,  Expect = 9e-56
 Identities = 150/262 57%, Positives = 189/262 72%, Gaps = 6/262 2%
Query  1    MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAA---YGKQWLEARGTWYGKPKGAGP 57
            MA S    A V A      V+C      PG N +A+       W  AR TWYG P GAGP
Sbjct  1    MAFSISKKAAVAALFSFLVVTC-VAGARPG-NFSASDFTADPNWEVARATWYGAPTGAGP 58
Query  58   DDNGGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITD 117
            DD+GGACG+K+ ++ PF  M SCGN+PIFKDGKGCGSC++++C    ACS  P  + ITD
Sbjct  59   DDDGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITD 118
Query  118  MNTEPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKG 177
            MN  P++ YHFDLSG AFGAMAK G++++LR AGIID+QF+RV C +PG  KVTFHVE+G
Sbjct  119  MNYYPVSKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPG-LKVTFHVEEG 177
Query  178  SNPNYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVT 237
            SNP YFAVLV+Y  GDGDVV+V+L E  S+ W P+ ESWG+IWR+D+   L  PFSLR+T
Sbjct  178  SNPVYFAVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRIT 237
Query  238  TESDQKLVANDVIPDNWKANALYKSEIQ 265
             ES ++LVA+ VIP NW   A+Y+S +Q
Sbjct  238  NESGKQLVASQVIPANWAPMAVYRSFVQ 265

Sequence Alignment: 29. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 207.9 bits 1033,  Expect = 3e-55
 Identities = 144/253 56%, Positives = 186/253 73%, Gaps = 7/253 2%
Query  12   VAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDNGGACGYKDIDK 71
            + + +V   SC    V    +  +AYG  WL AR TWYG P GAGPDDNGGACG+K++++
Sbjct  15   ILSVLVVHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPDDNGGACGFKNVNQ 74
Query  72   APFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTEPIAAYHFDLS 131
             PF  M SCGN+PIFKDGKGCGSC++++C+K  +CS     + ITDMN  P+A YHFDLS
Sbjct  75   YPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYYPVARYHFDLS 134
Query  132  GHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVG 191
            G AFGAMAK G +++LR +GIID+QFRRV C YPG  K+ FHVE+GSNP YFAVLV+Y  
Sbjct  135  GTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPG-LKINFHVEEGSNPVYFAVLVEYED 193
Query  192  GDGDVVKVELKEKGSEE------WKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLV 245
             DGDVV+V+L E  S        W P+ ESWG+IWR+D+   L+ PFSLR+ ++S + LV
Sbjct  194  LDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIRSDSGKTLV 253
Query  246  ANDVIPDNWKANALYKSEIQ 265
            AN+VIP NW  N+ Y+S +Q
Sbjct  254  ANNVIPANWSPNSNYRSIVQ 273

Sequence Alignment: 30. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 199.9 bits 992,  Expect = 8e-53
 Identities = 131/230 56%, Positives = 177/230 76%, Gaps = 7/230 3%
Query  35   AAYGKQWLEARGTWYGKPKGAGPDDNGGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGS 94
            A Y   W +AR TWYG+P GAGPDDNGGACG+K  ++ PF+ M SCGN P+FKDGKGCGS
Sbjct  49   AVYWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGS 108
Query  95   CFEVKCSKPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIID 154
            C++++C+K ++CS +   + ITDMN  P+A +HFDLSG AFG +AK G +++LR +GIID
Sbjct  109  CYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIID 168
Query  155  MQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELKEKGSE------E 208
            ++F RV C++PG  K+ FHVE+ SNP YFAVLV+Y  GDGDVV+V+L E  +       +
Sbjct  169  IEFTRVPCEFPG-LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGK 227
Query  209  WKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDVIPDNWKANALYKSEIQ 265
            W P+ ESWG+IWR+DT   L+ PFS+R+  ES + LVAN+VIP NW+ N +Y+S +Q
Sbjct  228  WTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQ 284

Sequence Alignment: 31. Allergen Name: Ory s 1 Sequence ID: AAF72989

 Score = 194.0 bits 961,  Expect = 5e-51
 Identities = 126/224 56%, Positives = 171/224 76%, Gaps = 3/224 1%
Query  41   WLEARGTWYGKPKGAGPDDNGGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKC 100
            W  A+ TWYG+P GAG  DNGGACG+K +++ PF+GM SCGN P++K GKGCGSC+ V+C
Sbjct  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRC 102
Query  101  SKPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRV 160
            ++  ACS     + ITDMN  P++ YHFDLSG AFG +AK G+ ++LR+AGIID+QF RV
Sbjct  103  NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARV 162
Query  161  RCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELKEKGSE--EWKPLNESWGA 218
             C++PG  KV FHVE+GS+P Y+AVLV+Y  GDGDV +V+LKE G+    W P+ ESWG+
Sbjct  163  PCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGS 221
Query  219  IWRIDTPKPLKGPFSLRVTTESDQKLVANDVIPDNWKANALYKSEIQ 265
            +WR+D+   L+ PFS+R+ ++S + LVA DVIP NW  N +Y+S +Q
Sbjct  222  VWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQ 268

Sequence Alignment: 32. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 193.2 bits 957,  Expect = 8e-51
 Identities = 126/228 55%, Positives = 172/228 75%, Gaps = 6/228 2%
Query  37   YGKQWLEARGTWYGKPKGAGPDDNGGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCF 96
            Y   WL A+ TWYG+P GAGPDDNGGACG+K+ ++ PF+ M SCGN+P+F+DGKGCG+C+
Sbjct  27   YTNDWLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACY 86
Query  97   EVKCSKPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQ 156
            +++C+   +CS +P  + ITDMN  P+A YHFDLSG AFGAMA+ G +++LR AGIID+Q
Sbjct  87   QIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQ 146
Query  157  FRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELKE-----KGSEEWKP 211
            FRRV C + G   V FHVE GSNP Y+AVLV++   DG VV++++ E     K +  W P
Sbjct  147  FRRVPCYHRG-LYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTP 205
Query  212  LNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDVIPDNWKANALYKSEIQ 265
            +  SWG+IWR+D    L+GP SLR+ +ES Q ++A+ VIP NW+AN  Y S++Q
Sbjct  206  MRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQ 259

Sequence Alignment: 33. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 193.0 bits 956,  Expect = 9e-51
 Identities = 128/232 55%, Positives = 176/232 75%, Gaps = 7/232 3%
Query  33   ITAAYGKQWLEARGTWYGKPKGAGPDDNGGACGYKDIDKAPFLGMNSCGNDPIFKDGKGC 92
            +  +Y   WL A+ TWYG P GAGPDDNGGACG+K++++ P   M +CGN+PIF  G+GC
Sbjct  32   VARSYTSGWLPAKATWYGAPNGAGPDDNGGACGFKNVNQYPISSMGACGNEPIFAGGEGC 91
Query  93   GSCFEVKC--SKPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAFGAMAKEGKDEELRKA 150
            G C+E+KC  S   +CS +P  I ITDMN  P+A YH+DLSG AFG+MAK G ++ LR A
Sbjct  92   GMCYEIKCEYSNNPSCSGQPRRIVITDMNYYPVARYHLDLSGTAFGSMAKYGLNDRLRHA 151
Query  151  GIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELKE----KGS 206
            GIIDMQFRRV C +PG  KVTFHV++GSNPNY+AVLV+YV  DG VV++EL +    + +
Sbjct  152  GIIDMQFRRVPCNFPG-MKVTFHVQRGSNPNYLAVLVEYVNVDGTVVRMELMQTMNGRPT 210
Query  207  EEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDVIPDNWKANALYKSEIQ 265
              W+ +  SWG++WR+DT +P++GPFS+R+T+++ + LVAN+ IP  W+ +  Y S +Q
Sbjct  211  GYWQDMRRSWGSVWRMDTNRPVQGPFSIRITSDTGKTLVANNAIPAYWQQDHAYWSNLQ 269

Sequence Alignment: 34. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 181.7 bits 897,  Expect = 2e-47
 Identities = 117/189 61%, Positives = 151/189 79%, Gaps = 0/189 0%
Query  77   MNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAFG 136
            M +CGN PIFKDGKGCGSC+EV+C +   CS  PV + ITDMN EPIA YHFDLSG AFG
Sbjct  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
Query  137  AMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDV 196
            ++AK G +++LR  GI+D++FRRVRCKYP   K+ FH+EKG NPNY AVLVK+V  DGD+
Sbjct  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
Query  197  VKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDVIPDNWKA 256
            V +E+++K S EWKP+  SWGAIWR+DT K LKGPFS+R+T+ES +K++A D+IP NW+ 
Sbjct  121  VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRP 180
Query  257  NALYKSEIQ 265
            +A+Y S +Q
Sbjct  181  DAVYTSNVQ 189

Sequence Alignment: 35. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 165.4 bits 813,  Expect = 2e-42
 Identities = 146/243 60%, Positives = 184/243 75%, Gaps = 15/243 6%
Query  24   PPKVPPGPNITAAY----GKQWLEARGTWYGKPKGAGPDDNGGACGYKDIDKAPFLGMNS 79
            PP   PG   +       G  WL AR TWYG P GAGPDDNGGACG+K+++  PF  M S
Sbjct  71   PPIPSPGTGSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTS 130
Query  80   CGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAFGAMA 139
            CGN+P+FKDGKGCGSC++++C    ACS  P  + ITDMN  P++ YHFDLSG AFGAMA
Sbjct  131  CGNEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMA 190
Query  140  KEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKV 199
            K+ +++ELR AGIID+QFRRV C+YPG T VTFHVE+GSNP Y A+LV+Y  GDGDVV+V
Sbjct  191  KDNRNDELRHAGIIDIQFRRVPCQYPGLT-VTFHVEQGSNPVYMAILVEYENGDGDVVQV 249
Query  200  ELKEK--------GSEE--WKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDV 249
            +L E         G+    W P+ ESWG+IWR+DT  PL+GPFSLR+T ES + L+A+ V
Sbjct  250  DLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQV 309
Query  250  IPDNWKANALYKSEIQVD 267
            IP +W+ N +Y S +Q D
Sbjct  310  IPADWQPNTVYSSIVQFD 327

Sequence Alignment: 36. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 163.2 bits 801,  Expect = 9e-42
 Identities = 123/257 47%, Positives = 160/257 62%, Gaps = 8/257 3%
Query  3    SSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDNGG 62
            S  L L  +++  +V    C  PK     +  +     W  A  TWYG   G G +  GG
Sbjct  10   SELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSDWSPAVATWYGPANGDGSE--GG 67
Query  63   ACGYKD-IDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITD--MN 119
            ACGY + + + PF  + S G+  I+  GKGCGSC+EVKC+   ACS  PV + ITD    
Sbjct  68   ACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECAG 127
Query  120  TEPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSN 179
                A YHFDLSG+AFGAMA  G+DE LR AG I++Q RR+ C YPG + + FHV+ GSN
Sbjct  128  CGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRS-IAFHVDSGSN 186
Query  180  PNYFAVLVKYVGGDGDVVKVELKEK-GSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTT 238
              YFA LV+Y  GDGD+ KVELKE   S  W  + +SWGA+W+ D   PL+ PFS+++TT
Sbjct  187  QEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLTT 246
Query  239  -ESDQKLVANDVIPDNWKANALYKS 262
             ES Q +VAN+VIP  W     Y+S
Sbjct  247  LESGQTIVANNVIPAGWTPGQTYRS 271

Sequence Alignment: 37. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 154.3 bits 755,  Expect = 4e-39
 Identities = 115/255 45%, Positives = 166/255 65%, Gaps = 14/255 5%
Query  6    LLLACVVAAAMVS-AVSCGPPKVPPGPNITAAYGKQ--WLEARGTWYGKPKGAGPDDNGG 62
            +++A +VA  ++S  VS        G   T + G+   W     TWYG P+G G +  GG
Sbjct  7    FVFAVLVALPILSLPVSGYEQNYTAGRRSTMSLGRGYGWSSGGATWYGGPQGDGSE--GG 64
Query  63   ACGYKD-IDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTE 121
            ACGY+  + + PF  M + G   +FK+GKGCGSC+++KC+   ACS +PV + ITD    
Sbjct  65   ACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVTVVITDSCPG 124
Query  122  PIA---AYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGS 178
             +    A HFD+SG AFGAMA  G  + LR AG++ +Q++RV C++     V F V+ GS
Sbjct  125  GVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQYKRVPCRF--AMNVAFKVDAGS 182
Query  179  NPNYFAVLVKYVGGDGDVVKVE-LKEKGSEEWKPLNESWGAIWRID--TPKPLKGPFSLR 235
            NP Y+A+LV+Y  GDGD+  V  +K +G   WK + +SWGA WR++  T KPL  PFS+R
Sbjct  183  NPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGKPLSPPFSIR 242
Query  236  VTTESDQKLVANDVIPDNWKANALYKSEI 264
            +T+ S + LVAN+VIP  W+A   Y+S +
Sbjct  243  LTSGSGKVLVANNVIPSGWQAGLTYRSTV 271

Sequence Alignment: 38. Allergen Name: Ara t expansin Sequence ID: CAB37496

 Score = 102.9 bits 488,  Expect = 1e-23
 Identities = 80/204 39%, Positives = 115/204 56%, Gaps = 7/204 3%
Query  60   NGGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMN 119
            + GAC Y  +    F G  +     I+KDG GCG+CF+V+C  P  CS K   + +TD+N
Sbjct  41   SSGACAYGSMATGFFAGHIAAALPSIYKDGSGCGACFQVRCKNPTLCSSKGTTVIVTDLN 100
Query  120  TEPIAAYHFDLSGHAFGAMAKE--GKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKG 177
                    + LS  AF AMAK   G D +L K GI+D+++RRV C Y G  K+   VE+ 
Sbjct  101  KT--NQTDLVLSSRAFRAMAKPVVGADRDLLKQGIVDIEYRRVPCDY-GNKKMNVRVEES 157
Query  178  S-NPNYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRV 236
            S NPNY+A+ + Y GG  +VV + + + GS  W  +  S GA+W  D        F + V
Sbjct  158  SKNPNYLAIKLLYQGGQTEVVAIYIAQVGSSHWSYMTRSHGAVWVTDKVPNGALQFRFVV 217
Query  237  TTESDQKLV-ANDVIPDNWKANALYKSEIQV 266
            T   D K+V +  V+P NW+A   Y + +Q+
Sbjct  218  TAGYDGKMVWSQRVLPANWEAGKSYDAGVQI 248

Sequence Alignment: 39. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 83.8 bits 389,  Expect = 7e-18
 Identities = 67/203 33%, Positives = 107/203 52%, Gaps = 10/203 4%
Query  60   NGGACGYKDIDKAPFLGMNSCGNDP-IFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDM 118
            N G+CGY  +  A F G +     P +F+ G GCG+CF+V+C   + CS     + +TD 
Sbjct  50   NAGSCGYGSL-AASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTD- 107
Query  119  NTEPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGS 178
                     + LS  A+ AMA+ G   +LR    +D++++RV C+Y     ++  VE+ S
Sbjct  108  EARSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKS 167
Query  179  NPNY-FAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVT 237
             P   +++   Y GG  D+V V++   GS  WK +   +G  W   T +   GP+ +RV 
Sbjct  168  RPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFRVV 225
Query  238  TES--DQKLVAND--VIPDNWKANALYKSEIQV 266
                 D K V  D  V+P  W A  +Y + +Q+
Sbjct  226  VTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQI 258

Sequence Alignment: 40. Allergen Name: Ory s 1 Sequence ID: BAA85432

 Score = 80.5 bits 372,  Expect = 7e-17
 Identities = 79/241 32%, Positives = 125/241 51%, Gaps = 35/241 14%
Query  8    LACVVAAAMVSA--VSCGPPKVPPGPNITAAYG-KQWLEARGTWYGKPKGAGPDDNGGAC 64
            LA   AA +V+A   +    +  P P     Y    W +   T+YG P G G DD GGAC
Sbjct  16   LAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTSDWHDGSATFYGDPSGMG-DDFGGAC 74
Query  65   GYKDIDKAPFLGMNSCG-NDPIFKDGKGCGSCFEVKCSKPEACSD-KPVIIHITDMNTEP 122
            GY   D   +    +   + P+F DG GCG C+E++C K   C+   P ++ IT  N  P
Sbjct  75   GYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPWCNPGSPSVV-ITGTNLCP 133
Query  123  IAAY--------------HFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGET 168
               Y              HFD++  +F  +A+       R AGI+ +Q+RRV C+  G  
Sbjct  134  PNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ-------RVAGIVPVQYRRVPCQRTGGV 186
Query  169  KVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELKEKGSE-EWKPLNESWGAIWRIDTPKP 227
            +  ++     N  ++ + V  VGG GDV  + +K  G    W     +WG  +++     
Sbjct  187  RFCLQ----GNHYWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALD 242
Query  228  LKGPFSLRVTTES--DQKLVANDVIPDNWKANALYK 261
                +++++TT S   Q ++ +D I   W     Y+
Sbjct  243  NSDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCYQ 278

Sequence Alignment: 41. Allergen Name: Cyn d 2 Sequence ID: CAA10346

 Score = 66.0 bits 296,  Expect = 7e-13
 Identities = 46/92 50%, Positives = 64/92 69%, Gaps = 4/92 4%
Query  169  KVTFHVEKGSNPNYFAVLVKYVGGDGDVV-KVELKEKGSEEWKPLNESWGAIWRIDTPKP 227
            KVTF VEKGSN  ++AVLVKY   +GD + +VEL+E GS+EW  + +  G +W  D+ +P
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEP 85
Query  228  LKGPFSLRVTTESDQKLVANDVIPDNWKANALYKSE 263
            LKGPF++R  TE   K V +DV+P+ +   A Y  E
Sbjct  86   LKGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPE 121

Sequence Alignment: 42. Allergen Name: Dac g 2 Sequence ID: CAA10345

 Score = 65.3 bits 292,  Expect = 1e-12
 Identities = 45/92 48%, Positives = 64/92 69%, Gaps = 4/92 4%
Query  169  KVTFHVEKGSNPNYFAVLVKYVGGDGDVV-KVELKEKGSEEWKPLNESWGAIWRIDTPKP 227
            KVTF VEKGSN  ++AVLVKY   +GD + +VEL+E GS+EW  + +  G +W  D+ +P
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEP 85
Query  228  LKGPFSLRVTTESDQKLVANDVIPDNWKANALYKSE 263
            L+GPF++R  TE   K V +DV+P+ +   A Y  E
Sbjct  86   LQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPE 121

Sequence Alignment: 43. Allergen Name: Poa p 2 Sequence ID: CAA10348

 Score = 65.3 bits 292,  Expect = 1e-12
 Identities = 45/92 48%, Positives = 64/92 69%, Gaps = 4/92 4%
Query  169  KVTFHVEKGSNPNYFAVLVKYVGGDGDVV-KVELKEKGSEEWKPLNESWGAIWRIDTPKP 227
            KVTF VEKGSN  ++AVLVKY   +GD + +VEL+E GS+EW  + +  G +W  D+ +P
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEP 85
Query  228  LKGPFSLRVTTESDQKLVANDVIPDNWKANALYKSE 263
            L+GPF++R  TE   K V +DV+P+ +   A Y  E
Sbjct  86   LQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPE 121

Sequence Alignment: 44. Allergen Name: Phl p 2 Sequence ID: P43214

 Score = 65.3 bits 292,  Expect = 1e-12
 Identities = 45/92 48%, Positives = 64/92 69%, Gaps = 4/92 4%
Query  169  KVTFHVEKGSNPNYFAVLVKYVGGDGDVV-KVELKEKGSEEWKPLNESWGAIWRIDTPKP 227
            KVTF VEKGSN  ++AVLVKY   +GD + +VEL+E GS+EW  + +  G +W  D+ +P
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEP 85
Query  228  LKGPFSLRVTTESDQKLVANDVIPDNWKANALYKSE 263
            L+GPF++R  TE   K V +DV+P+ +   A Y  E
Sbjct  86   LQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPE 121

Sequence Alignment: 45. Allergen Name: Dac g 3 Sequence ID: P93124

 Score = 59.7 bits 263,  Expect = 4e-11
 Identities = 38/94 40%, Positives = 59/94 62%, Gaps = 1/94 1%
Query  169  KVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPL 228
            KVTF VEKGS+P  + + +KY      + +VEL++ GSEEW+PL +  G +W + + KPL
Sbjct  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKPL 60
Query  229  KGPFSLRVTTESDQKLVANDVIPDNWKANALYKSE 263
             GPF++R  ++   + V ++VIP  +K    Y  E
Sbjct  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPE 95

Sequence Alignment: 46. Allergen Name: Lol p 2 Sequence ID: P14947

 Score = 59.7 bits 263,  Expect = 4e-11
 Identities = 41/93 44%, Positives = 60/93 64%, Gaps = 2/93 2%
Query  170  VTFHVEKGSNPNYFAVLVKYVGGDGD-VVKVELKEKGSEEWKPLNESWGAIWRIDTPKPL 228
            V F VEKGS+   +A+ +KY   +GD + +VELKE GS EW  L ++   +W I + KPL
Sbjct  4    VEFTVEKGSDEKNLALSIKY-NKEGDSMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPL 62
Query  229  KGPFSLRVTTESDQKLVANDVIPDNWKANALYKSE 263
            KGPF++R  +E   + V +DV+P ++K    YK E
Sbjct  63   KGPFNFRFVSEKGMRNVFDDVVPADFKVGTTYKPE 97

Sequence Alignment: 47. Allergen Name: Phl p 3.0101 Sequence ID: 2JNZ_A

 Score = 58.0 bits 254,  Expect = 2e-10
 Identities = 36/94 38%, Positives = 59/94 62%, Gaps = 1/94 1%
Query  169  KVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPL 228
            +VTF V+KGS+P  + + +KY      + +VEL++ GSEEW+PL +  G +W + + KPL
Sbjct  14   QVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPL 72
Query  229  KGPFSLRVTTESDQKLVANDVIPDNWKANALYKSE 263
             GPF++R  ++   + V ++VIP  +     YK E
Sbjct  73   VGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYKPE 107

Sequence Alignment: 48. Allergen Name: Lol p 2 Sequence ID: CAA51775

 Score = 54.3 bits 235,  Expect = 2e-09
 Identities = 37/83 44%, Positives = 55/83 66%, Gaps = 2/83 2%
Query  172  FHVEKGSNPNYFAVLVKYVGGDGDVV-KVELKEKGSEEWKPLNESWGAIWRIDTPKPLKG 230
            F VEKGS+   +A+ +KY   +GD + +VELKE GS EW  L ++   +W I + KPLKG
Sbjct  2    FTVEKGSDEKNLALSIKY-SKEGDAMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLKG 60
Query  231  PFSLRVTTESDQKLVANDVIPDNWK 255
            PF++R  +E     V +DV+P ++K
Sbjct  61   PFNFRFVSEKGMWNVFDDVVPADFK 85

Sequence Alignment: 49. Allergen Name: Lol p 3 Sequence ID: P14948

 Score = 53.0 bits 228,  Expect = 5e-09
 Identities = 34/95 35%, Positives = 56/95 58%, Gaps = 1/95 1%
Query  168  TKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKP 227
            TKV + VEKGS+   + + +KY      + +VEL++ GSEEW+P+ +  G +W + + KP
Sbjct  1    TKVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKP 59
Query  228  LKGPFSLRVTTESDQKLVANDVIPDNWKANALYKSE 263
            L GP ++R  ++   K V ++VIP  +     Y  E
Sbjct  60   LTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYTPE 95

Sequence Alignment: 50. Allergen Name: Tri a 3 Sequence ID: CAA90746

 Score = 52.0 bits 223,  Expect = 1e-08
 Identities = 33/94 35%, Positives = 58/94 61%, Gaps = 1/94 1%
Query  169  KVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPL 228
            KV + V+KGS+   +A+ + Y   +  + +VEL++ GSEEW+PL +  G +W +   KPL
Sbjct  24   KVKLTVQKGSDKKKLALKIDYTRPNDSLSEVELRQYGSEEWQPLTKK-GDVWEVSCSKPL 82
Query  229  KGPFSLRVTTESDQKLVANDVIPDNWKANALYKSE 263
             GPF++R  +++  K V ++V   ++K    Y+ E
Sbjct  83   VGPFNFRFLSKNGMKKVFDEVFSTDFKIGKTYEPE 117

Sequence Alignment: 51. Allergen Name: Dac g 1.0101 Sequence ID: Q7M1X8

 Score = 49.7 bits 210,  Expect = 2e-08
 Identities = 26/33 78%, Positives = 29/33 87%, Gaps = 0/33 0%
Query  25   PKVPPGPNITAAYGKQWLEARGTWYGKPKGAGP 57
            PKVPPGPNITA YG +WL+A+ TWYGKP GAGP
Sbjct  2    PKVPPGPNITATYGDKWLDAKSTWYGKPTGAGP 34

Sequence Alignment: 52. Allergen Name: Cyn d 15 Sequence ID: AAP80171

 Score = 51.0 bits 218,  Expect = 2e-08
 Identities = 36/89 40%, Positives = 61/89 68%, Gaps = 7/89 7%
Query  170  VTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLK 229
            + FHVE+ S+P  FA+ +K      ++ +V+++E G++   P+ +S G  W ID  KPLK
Sbjct  22   IIFHVEE-SSPK-FALSIK--DSAKEITQVDVREHGADNMDPMTKS-GDSWTID--KPLK 74
Query  230  GPFSLRVTTESDQKLVANDVIPDNWKANALYKSEIQ 265
            GP+++R+  E     V +DVIP+NWKA   Y ++++
Sbjct  75   GPLNIRLRAEGGGSRVQDDVIPENWKAGTDYPTKLH 110

Sequence Alignment: 53. Allergen Name: Ant o 1.0101 Sequence ID: Q7M1X6

 Score = 44.3 bits 182,  Expect = 6e-07
 Identities = 23/30 76%, Positives = 26/30 86%, Gaps = 0/30 0%
Query  26   KVPPGPNITAAYGKQWLEARGTWYGKPKGA 55
            KVPPGPNITA YG +WL+A+ TWYGKP GA
Sbjct  3    KVPPGPNITATYGDKWLDAKSTWYGKPTGA 32

Sequence Alignment: 54. Allergen Name: Sor h 2.0101 Sequence ID: A0A077B7S9

 Score = 37.9 bits 150,  Expect = 0.0002
 Identities = 31/94 32%, Positives = 56/94 59%, Gaps = 6/94 6%
Query  168  TKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELKEKGSEEWKP-LNESWGAIWRIDTPK 226
            T +T+ + K S    + VLV       DV +V +K+KG+ ++   L ES    +  ++ +
Sbjct  25   TLMTWTIGKDSTSTRL-VLV----ASADVSEVAVKDKGATDFSDDLKESPAKTFTYESKE 79
Query  227  PLKGPFSLRVTTESDQKLVANDVIPDNWKANALYKSEIQV 266
            P+KGP+S+R   +       +DVIP ++K  ++YK++ QV
Sbjct  80   PIKGPLSVRFAVKGQGYRTTDDVIPADFKPGSVYKTKEQV 119

Sequence Alignment: 55. Allergen Name: Sor h 2.0201 Sequence ID: A0A077B2S0

 Score = 34.4 bits 132,  Expect = 0.002
 Identities = 26/94 27%, Positives = 53/94 56%, Gaps = 6/94 6%
Query  168  TKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELKEKGSEEWKP-LNESWGAIWRIDTPK 226
            T +T  V K S    ++++         + +V +K KG+ ++   L ES    + +D+ +
Sbjct  27   TTLTIEVGKDSTSTKLSLITNVA-----ISEVSVKPKGATDFTDDLKESEPKTFTLDSKE 81
Query  227  PLKGPFSLRVTTESDQKLVANDVIPDNWKANALYKSEIQV 266
            P++GP ++R   +     V ++ IP ++KA ++YK+  QV
Sbjct  82   PIEGPIAFRFLAKGGGYRVVDNAIPADFKAGSVYKTTEQV 121

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.