The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGI
RSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK
Sequence Info Allergen Name Length Opt Bits Score E Value
A0A059ST23 Pun g 1.0301 120 805 151.4 6.1e-39
A0A059SSZ0 Pun g 1.0201 120 513 99.9 2e-23
A0A059STC4 Pun g 1.0101 120 505 98.5 5.4e-23
Q9M5X8 Pru av 3 117 481 94.2 1e-21
Q4PLU0 Fra a 3.0201 117 480 94.0 1.1e-21
Q9M5X7 Mal d 3 115 479 93.8 1.3e-21
Q9M5X6 Pyr c 3 115 479 93.8 1.3e-21
Q0Z8V0 Rub i 3.0101 117 467 91.7 5.6e-21
Q4PLT6 Fra a 3.0202 117 463 91.0 9.1e-21
Q8VX12 Fra a 3.0101 117 457 90.0 1.9e-20
AAK28533 Cor a 8 115 453 89.2 3.1e-20
Q4PLT9 Fra a 3.0102 117 451 88.9 4e-20
AAL25839 Hev b 12 116 448 88.4 5.7e-20
P85894 Mor n 3.0101 91 445 87.7 7.3e-20
CAB96876 Pru p 3 91 439 86.6 1.5e-19
W0U0V5 Can s 3.0101 91 433 85.5 3.2e-19
ABY21307 Pla or 3.0101 118 431 85.4 4.6e-19
P81651 Pru ar 3 91 429 84.8 5.2e-19
P81402 Pru p 3 91 429 84.8 5.2e-19
CAL07989 Pla a 3.0101 118 427 84.7 7.5e-19
A0AT29 Len c 3.0101 118 427 84.7 7.5e-19
ADC80503 Pha v 3.0201 118 426 84.5 8.5e-19
XP_019446786 Lup an 3.0101 116 423 84.0 1.2e-18
P19656-1 Zea m 14.0101 120 423 84.0 1.2e-18
P19656-2 Zea m 14.0102 128 419 83.3 2.1e-18
A0A161AT60 Pis s 3.0101 120 412 82.0 4.7e-18
CAH69206 Tri tu 14.0101 115 411 81.8 5.2e-18
P82534 Pru d 3 91 410 81.5 5.3e-18
ABX56711 Ara h 9.0101 116 410 81.7 6e-18
ACN11576 Pru du 3.0101 123 403 80.5 1.4e-17
ACV04796 Api g 2 118 397 79.4 2.9e-17
AAB42069 Lyc e 3 114 396 79.2 3.3e-17
P93224 Sola l 3.0101 114 396 79.2 3.3e-17
ADC80502 Pha v 3.0101 115 372 74.9 6.2e-16
ABX75045 Ara h 9.0201 92 362 73.0 1.9e-15
EU564845 Art v 3.0201 114 356 72.1 4.4e-15
ANC85019 Art ar 3.0101 116 356 72.1 4.4e-15
ANC85024 Art la 3.0101 116 356 72.1 4.4e-15
ANC85027 Art si 3.0102 116 355 71.9 5e-15
ACE07187 Art v 3.0202 116 355 71.9 5e-15
ANC85020 Art ar 3.0102 116 355 71.9 5e-15
ANC85022 Art gm 3.0101 117 354 71.8 5.7e-15
ANC85023 Art gm 3.0102 117 354 71.8 5.7e-15
ANC85018 Art an 3.0102 117 349 70.9 1e-14
ANC85025 Art la 3.0102 115 348 70.7 1.2e-14
ANC85026 Art si 3.0101 116 346 70.4 1.5e-14
QIN55516 Art ca 3.0102 117 345 70.2 1.7e-14
ABU95411 Sin a 3.0101 92 344 69.8 1.7e-14
EU564847 Art v 3.0301 117 344 70.0 1.9e-14
ANC85017 Art an 3.0101 117 342 69.7 2.5e-14
ANC85021 Art ca 3.0101 117 342 69.7 2.5e-14
AAA32970 Hor v 1 117 328 67.2 1.4e-13
CAA42832 Hor v 1 134 325 66.8 2.1e-13
A0A510A9S3 Ara h 17.0101 93 318 65.2 4.2e-13
NP_001316123 Sola l 7.0101 115 282 59.0 3.8e-11
19846220 Tri a 14.0101 90 278 58.2 5.5e-11
P82007 Hel a 3.0101 116 272 57.3 1.3e-10
O04403 Par j 2 133 221 48.4 7.1e-08
P55958 Par j 2 133 207 45.9 3.9e-07
Q40905 Par j 1 138 202 45.1 7.4e-07
P43217 Par j 1 139 199 44.5 1.1e-06
CAI94601 Par j 1.0103 139 197 44.2 1.4e-06
O04404 Par j 1 176 190 43.1 3.6e-06
CAA54587 Par j 1.0101 133 176 40.4 1.7e-05
O04004 Amb a 6 118 170 39.3 3.4e-05
10998016 Cas s 8 36 139 32.9 0.00087
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pun g 1.0301 Sequence ID: A0A059ST23

 Score = 151.4 bits 805,  Expect = 6e-39
 Identities = 120/120 100%, Positives = 120/120 100%, Gaps = 0/120 0%
Query  1    MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGI 60
            MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGI
Sbjct  1    MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGI 60
Query  61   RSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            RSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK
Sbjct  61   RSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120

Sequence Alignment: 2. Allergen Name: Pun g 1.0201 Sequence ID: A0A059SSZ0

 Score = 99.9 bits 513,  Expect = 2e-23
 Identities = 77/119 64%, Positives = 92/119 77%, Gaps = 2/119 1%
Query  1    MASSGFLR-LAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNG 59
            MAS  FL  L   +++CM VA++V E+ +TCGQV+SSL  CI YARG  A P   ACC+G
Sbjct  1    MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVAAP-SAACCSG 59
Query  60   IRSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNV 119
            +RSLN+AAKTTPDRQ AC CLK +A SI+GINYG V   PGKCGVSIPYKI+PST+C  V
Sbjct  60   VRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPGKCGVSIPYKISPSTDCSRV 119
Query  120  K 120
            K
Sbjct  120  K 120

Sequence Alignment: 3. Allergen Name: Pun g 1.0101 Sequence ID: A0A059STC4

 Score = 98.5 bits 505,  Expect = 5e-23
 Identities = 75/119 63%, Positives = 94/119 78%, Gaps = 2/119 1%
Query  1    MASSGFLRLAGFVLVCMAVASTVA-EAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNG 59
            M  SG+++LA  V+    VA+ +A EA +TCGQV+SSLA CI YAR  G G VP ACC+G
Sbjct  1    MTGSGLFKLACAVFAVALVAAPIATEAAVTCGQVASSLAPCIPYARSAG-GAVPPACCSG 59
Query  60   IRSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNV 119
            I++L+  A+TTPDRQA C+CLKS ++SISGINYGLVA  P KCGV+IPYKI+PST+C  V
Sbjct  60   IKTLDGMARTTPDRQATCKCLKSASTSISGINYGLVASLPAKCGVNIPYKISPSTDCARV 119
Query  120  K 120
            K
Sbjct  120  K 120

Sequence Alignment: 4. Allergen Name: Pru av 3 Sequence ID: Q9M5X8

 Score = 94.2 bits 481,  Expect = 1e-21
 Identities = 71/117 60%, Positives = 88/117 75%, Gaps = 3/117 2%
Query  1    MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGI 60
            MA S   +LA  V +CM V+  +A+A +TCGQVSS+LA CI Y RG GA  VP ACCNGI
Sbjct  1    MACSAMTKLALVVALCMVVSVPIAQA-LTCGQVSSNLAPCIAYVRGGGA--VPPACCNGI 57
Query  61   RSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            R++N+ AKTT DRQ AC CLK L++S+ G+N    A  PGKCGV++PYKI+PSTNC  VK
Sbjct  58   RNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATVK 117

Sequence Alignment: 5. Allergen Name: Fra a 3.0201 Sequence ID: Q4PLU0

 Score = 94.0 bits 480,  Expect = 1e-21
 Identities = 72/117 61%, Positives = 89/117 76%, Gaps = 3/117 2%
Query  1    MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGI 60
            MASS  ++L+   L+C+ VA  +A+A ITCGQV+SS++ C+ Y +  GA  VP ACCNGI
Sbjct  1    MASSTAMKLSLVALLCIVVALPIAQA-ITCGQVASSISPCVNYVKSGGA--VPAACCNGI 57
Query  61   RSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            RSLNSAAKTT DRQA C CLK  + +I G+N  L AG PGKCGVS+PYKI+ STNC  VK
Sbjct  58   RSLNSAAKTTADRQATCNCLKQASGAIKGLNPSLAAGLPGKCGVSVPYKISTSTNCAAVK 117

Sequence Alignment: 6. Allergen Name: Mal d 3 Sequence ID: Q9M5X7

 Score = 93.8 bits 479,  Expect = 1e-21
 Identities = 76/115 66%, Positives = 88/115 76%, Gaps = 5/115 4%
Query  1    MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGI 60
            MASS   +LA  V +CMAV  +VA A ITCGQV+SSLA CI Y R  GA  VP ACCNGI
Sbjct  1    MASSAVTKLALVVALCMAV--SVAHA-ITCGQVTSSLAPCIGYVRSGGA--VPPACCNGI 55
Query  61   RSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            R++N  A+TT DRQ AC CLK+LA SISG+N    AG PGKCGV++PYKI+ STNC  VK
Sbjct  56   RTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATVK 115

Sequence Alignment: 7. Allergen Name: Pyr c 3 Sequence ID: Q9M5X6

 Score = 93.8 bits 479,  Expect = 1e-21
 Identities = 74/115 64%, Positives = 89/115 77%, Gaps = 5/115 4%
Query  1    MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGI 60
            MASS  ++LA  V +CMAV  +VA A ITC QVS++LA CI Y R  GA  VP ACCNGI
Sbjct  1    MASSAVIKLALVVALCMAV--SVAHA-ITCSQVSANLAPCINYVRSGGA--VPPACCNGI 55
Query  61   RSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            +++N  AKTTPDRQAAC CLK+LA S+SG+N G     PGKCGV++PYKI+ STNC  VK
Sbjct  56   KTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVNVPYKISTSTNCATVK 115

Sequence Alignment: 8. Allergen Name: Rub i 3.0101 Sequence ID: Q0Z8V0

 Score = 91.7 bits 467,  Expect = 6e-21
 Identities = 70/117 59%, Positives = 85/117 72%, Gaps = 3/117 2%
Query  1    MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGI 60
            MA S  ++LA   L+C+ VA  VA+A ITCGQV+ ++A C  Y +  GA  VP ACCNG+
Sbjct  1    MACSAVMKLALVALLCIVVAVPVAQA-ITCGQVTQNVAPCFNYVKNGGA--VPAACCNGV 57
Query  61   RSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            R+LNS AKTT DRQ  C CLK+ A SI G+N  L AG PGKCGVS+PYKI+ STNC  VK
Sbjct  58   RNLNSQAKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKCGVSVPYKISTSTNCATVK 117

Sequence Alignment: 9. Allergen Name: Fra a 3.0202 Sequence ID: Q4PLT6

 Score = 91.0 bits 463,  Expect = 9e-21
 Identities = 69/117 58%, Positives = 87/117 74%, Gaps = 3/117 2%
Query  1    MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGI 60
            MA S  ++L+   L+C+ VA  +A+A ITCGQV+SS++ C+ Y +  GA  VP ACCNGI
Sbjct  1    MAISTAMKLSLVALLCIVVALPIAQA-ITCGQVASSISPCVNYVKSGGA--VPAACCNGI 57
Query  61   RSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            RSLNSAAKTT DRQ  C CLK  + +I G+N  L AG PGKCGV++PYKI+ STNC  VK
Sbjct  58   RSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCGVNVPYKISTSTNCAAVK 117

Sequence Alignment: 10. Allergen Name: Fra a 3.0101 Sequence ID: Q8VX12

 Score = 90.0 bits 457,  Expect = 2e-20
 Identities = 68/117 58%, Positives = 87/117 74%, Gaps = 3/117 2%
Query  1    MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGI 60
            MASS  ++L+   L+C+ VA  +A+A ITCGQV+S+++ C+ Y +  GA  VP ACC+GI
Sbjct  1    MASSTAMKLSLVALLCIVVALPIAQA-ITCGQVASNISPCLTYVKSGGA--VPAACCSGI 57
Query  61   RSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            R+LN  AKTT DRQAAC CLK  A  I G+N  L AG PGKCGVS+PYKI+ +TNC  VK
Sbjct  58   RNLNGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAVK 117

Sequence Alignment: 11. Allergen Name: Cor a 8 Sequence ID: AAK28533

 Score = 89.2 bits 453,  Expect = 3e-20
 Identities = 64/114 56%, Positives = 85/114 74%, Gaps = 2/114 1%
Query  5    GFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLN 64
            G L+L   VL+CM VA+ VA A +TC Q+  +L  C+ Y + NG G +P +CC G+R++N
Sbjct  2    GSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLK-NG-GVLPPSCCKGVRAVN 59
Query  65   SAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
             A++TT DRQ+AC CLK  A  I+G+N  L AG PGKCGV+IPYKI+PSTNC+NVK
Sbjct  60   DASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115

Sequence Alignment: 12. Allergen Name: Fra a 3.0102 Sequence ID: Q4PLT9

 Score = 88.9 bits 451,  Expect = 4e-20
 Identities = 66/117 56%, Positives = 85/117 72%, Gaps = 3/117 2%
Query  1    MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGI 60
            MASS  ++L+   L+C+ VA  +A+A ITCGQV+S+++ C+ Y +  GA P P  CC+GI
Sbjct  1    MASSTAMKLSLVALLCIVVALPIAQA-ITCGQVASNISPCVTYVKSGGAVPAP--CCSGI 57
Query  61   RSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            R+LN  AKTT DRQA C CLK  A  I G+N  L AG PGKCGVS+PYKI+ +TNC  VK
Sbjct  58   RNLNGMAKTTADRQATCNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAVK 117

Sequence Alignment: 13. Allergen Name: Hev b 12 Sequence ID: AAL25839

 Score = 88.4 bits 448,  Expect = 6e-20
 Identities = 62/113 54%, Positives = 82/113 72%, Gaps = 1/113 0%
Query  7    LRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSA 66
            L++  F+++CM VA+ +    ITCGQV S+L  C+ Y +  G  P P  CCNG+R++N+A
Sbjct  4    LKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTP-PATCCNGVRTINNA 62
Query  67   AKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            AKTT DR+ AC+CLKS A S+ G+N   VAG PGKCGV+IPYKI+ STNC  VK
Sbjct  63   AKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGVNIPYKISLSTNCATVK 116

Sequence Alignment: 14. Allergen Name: Mor n 3.0101 Sequence ID: P85894

 Score = 87.7 bits 445,  Expect = 7e-20
 Identities = 65/91 71%, Positives = 73/91 80%, Gaps = 2/91 2%
Query  28   ITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSI 87
            ITCGQVSSSLA CI Y R  G   VP  CCNG+RSLN+AAKTT DRQAAC CLKS  +SI
Sbjct  1    ITCGQVSSSLAPCINYLRAGGV--VPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSI 58
Query  88   SGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
             G+N  L AG PGKCGVS+PYKI+PST+C +VK
Sbjct  59   KGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK 91

Sequence Alignment: 15. Allergen Name: Pru p 3 Sequence ID: CAB96876

 Score = 86.6 bits 439,  Expect = 2e-19
 Identities = 64/91 70%, Positives = 73/91 80%, Gaps = 2/91 2%
Query  28   ITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSI 87
            ITCGQVSSSLA CI Y RG GA  VP ACCNGIR++N+ A+TTPDRQAAC CLK L++S+
Sbjct  1    ITCGQVSSSLAPCIPYVRGGGA--VPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASV 58
Query  88   SGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
             G+N    A  PGKCGVSIPYKI+ STNC  VK
Sbjct  59   PGVNPNNAAALPGKCGVSIPYKISASTNCATVK 91

Sequence Alignment: 16. Allergen Name: Can s 3.0101 Sequence ID: W0U0V5

 Score = 85.5 bits 433,  Expect = 3e-19
 Identities = 62/91 68%, Positives = 74/91 81%, Gaps = 2/91 2%
Query  28   ITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSI 87
            ITCGQV+SSLA C+ Y +  GA  VP  CCN I+SL+ AAKT  DRQAAC+CLKS ASSI
Sbjct  1    ITCGQVASSLAPCLSYLKVGGA--VPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSI 58
Query  88   SGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
             G+N+ L +G PGKCGVSIPYKI+PST+C +VK
Sbjct  59   KGVNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91

Sequence Alignment: 17. Allergen Name: Pla or 3.0101 Sequence ID: ABY21307

 Score = 85.4 bits 431,  Expect = 5e-19
 Identities = 64/118 54%, Positives = 82/118 69%, Gaps = 2/118 1%
Query  1    MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGI 60
            MA S   +LA ++L CM   +  AEA ITCG V + L  C+ Y R  GA  V  ACCNG+
Sbjct  1    MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGA--VAPACCNGV 58
Query  61   RSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            ++LN+ AKTTPDRQAAC CLK+ ++SISGI  G  A   GKCGV++PYKI+P+ +C  VK
Sbjct  59   KALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118

Sequence Alignment: 18. Allergen Name: Pru ar 3 Sequence ID: P81651

 Score = 84.8 bits 429,  Expect = 5e-19
 Identities = 63/91 69%, Positives = 72/91 79%, Gaps = 2/91 2%
Query  28   ITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSI 87
            ITCGQVSSSLA CI Y RG GA  VP ACCNGIR++N+ A+TTPDR+ AC CLK L+ SI
Sbjct  1    ITCGQVSSSLAPCIGYVRGGGA--VPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSI 58
Query  88   SGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            SG+N    A  PGKCGV+IPYKI+ STNC  VK
Sbjct  59   SGVNPNNAAALPGKCGVNIPYKISASTNCATVK 91

Sequence Alignment: 19. Allergen Name: Pru p 3 Sequence ID: P81402

 Score = 84.8 bits 429,  Expect = 5e-19
 Identities = 62/91 68%, Positives = 72/91 79%, Gaps = 2/91 2%
Query  28   ITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSI 87
            ITCGQVSS+LA CI Y RG GA  VP ACCNGIR++N+ A+TTPDRQAAC CLK L++S+
Sbjct  1    ITCGQVSSALAPCIPYVRGGGA--VPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASV 58
Query  88   SGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
             G+N    A  PGKCGV IPYKI+ STNC  VK
Sbjct  59   PGVNPNNAAALPGKCGVHIPYKISASTNCATVK 91

Sequence Alignment: 20. Allergen Name: Pla a 3.0101 Sequence ID: CAL07989

 Score = 84.7 bits 427,  Expect = 7e-19
 Identities = 63/118 53%, Positives = 82/118 69%, Gaps = 2/118 1%
Query  1    MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGI 60
            MA S   +LA ++L CM   +  AEA ITCG V + L  C+ + R  GA  V  ACCNG+
Sbjct  1    MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGA--VAPACCNGV 58
Query  61   RSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            ++LN+ AKTTPDRQAAC CLK+ ++SISGI  G  A   GKCGV++PYKI+P+ +C  VK
Sbjct  59   KALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118

Sequence Alignment: 21. Allergen Name: Len c 3.0101 Sequence ID: A0AT29

 Score = 84.7 bits 427,  Expect = 7e-19
 Identities = 64/112 57%, Positives = 81/112 72%, Gaps = 3/112 2%
Query  7    LRLAGFVLV-CMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNS 65
            ++LA  VLV CM V + +AE  I+CG V+S L+ C+ Y  G G GP PQ CC G++ L +
Sbjct  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTG-GPGPSPQ-CCGGVKKLLA 62
Query  66   AAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            AA TTPDRQAAC CLKS A SI+ +N    A  PGKCGV+IPYKI+ +TNC+ VK
Sbjct  63   AANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117

Sequence Alignment: 22. Allergen Name: Pha v 3.0201 Sequence ID: ADC80503

 Score = 84.5 bits 426,  Expect = 8e-19
 Identities = 63/104 60%, Positives = 78/104 75%, Gaps = 5/104 4%
Query  14   LVCMAVAST-VAEAGITCGQVSSSLAGCIQY-ARGNGAGPVPQACCNGIRSLNSAAKTTP 71
            ++C+ V +   A A I+CGQV+SSLA CI +  +G   GPVP +CC+G+RSLN+AAKTTP
Sbjct  12   VLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKG---GPVPASCCSGVRSLNAAAKTTP 68
Query  72   DRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            DRQA C CLKS A +I G N       PGKCGVSIPYKI+ STNC  +K
Sbjct  69   DRQAVCNCLKSAAGAIPGFNANNAGILPGKCGVSIPYKISTSTNCATIK 117

Sequence Alignment: 23. Allergen Name: Lup an 3.0101 Sequence ID: XP_019446786

 Score = 84.0 bits 423,  Expect = 1e-18
 Identities = 60/115 52%, Positives = 81/115 70%, Gaps = 2/115 1%
Query  4    SGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSL 63
            +G ++LA  VL+CM V S      ITCGQV+++LA C+ Y R  GA P P  CCNGI+++
Sbjct  2    AGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPAP--CCNGIKNI 59
Query  64   NSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
             + AKTTPDR+ AC CLK+ A++  G+N       PGKCGV+IPYKI+ STNC ++K
Sbjct  60   LNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGVNIPYKISTSTNCASIK 116

Sequence Alignment: 24. Allergen Name: Zea m 14.0101 Sequence ID: P19656-1

 Score = 84.0 bits 423,  Expect = 1e-18
 Identities = 62/118 52%, Positives = 85/118 72%, Gaps = 2/118 1%
Query  1    MASSGFLRLAGFVLVCMAV-ASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNG 59
            MA +  L +    +V + + A+  +EA I+CGQV+S++A CI YARG G+GP    CC+G
Sbjct  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGP-SAGCCSG 59
Query  60   IRSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNV 119
            +RSLN+AA+TT DR+AAC CLK+ A+ +SG+N G  A  P KCGVSIPY I+ ST+C  V
Sbjct  60   VRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119

Sequence Alignment: 25. Allergen Name: Zea m 14.0102 Sequence ID: P19656-2

 Score = 83.3 bits 419,  Expect = 2e-18
 Identities = 61/115 53%, Positives = 84/115 73%, Gaps = 2/115 1%
Query  1    MASSGFLRLAGFVLVCMAV-ASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNG 59
            MA +  L +    +V + + A+  +EA I+CGQV+S++A CI YARG G+GP    CC+G
Sbjct  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGP-SAGCCSG 59
Query  60   IRSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNC 116
            +RSLN+AA+TT DR+AAC CLK+ A+ +SG+N G  A  P KCGVSIPY I+ ST+C
Sbjct  60   VRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDC 116

Sequence Alignment: 26. Allergen Name: Pis s 3.0101 Sequence ID: A0A161AT60

 Score = 82.0 bits 412,  Expect = 5e-18
 Identities = 65/117 55%, Positives = 82/117 70%, Gaps = 5/117 4%
Query  1    MASSGFLRLAGFVLV-CMAVASTVAEAGITCGQVSSSLAGCIQYARG-NGAGPVPQACCN 58
            MA S  ++LA   LV CM V + +AEA ++CG VS+ +A C+ Y +  N A P P  CC 
Sbjct  1    MARS--MKLACVALVICMVVIAPMAEAALSCGTVSADMAPCVTYLQAPNNASP-PPPCCA 57
Query  59   GIRSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDN 118
            G++ L +AA TTPDRQAAC CLKS A SI  +N    A  PGKCGVSIPYKI+ STNC+ 
Sbjct  58   GVKKLLAAATTTPDRQAACNCLKSAAGSIPKLNTNNAAALPGKCGVSIPYKISTSTNCNT 117
Query  119  VK 120
            V+
Sbjct  118  VR 119

Sequence Alignment: 27. Allergen Name: Tri tu 14.0101 Sequence ID: CAH69206

 Score = 81.8 bits 411,  Expect = 5e-18
 Identities = 61/115 53%, Positives = 84/115 73%, Gaps = 5/115 4%
Query  1    MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGI 60
            MA S   ++  +V V  A+   V EA ++CGQVSS+L+ CI YARGNGA P   ACC+G+
Sbjct  1    MARSAVAQVV-LVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP-SAACCSGV 58
Query  61   RSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            RSL S+A++T D+QAAC+C+KS A+   G+N G  AG P KCGVS+PY I+ S +C  ++
Sbjct  59   RSLASSARSTADKQAACKCIKSAAA---GLNAGKAAGIPTKCGVSVPYAISSSVDCSKIR 115

Sequence Alignment: 28. Allergen Name: Pru d 3 Sequence ID: P82534

 Score = 81.5 bits 410,  Expect = 5e-18
 Identities = 59/91 64%, Positives = 71/91 78%, Gaps = 2/91 2%
Query  28   ITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSI 87
            ITCGQVSS+LA CI Y +G GA  VP ACCNGIR++N+ A+TT DR+AAC CLK L+ SI
Sbjct  1    ITCGQVSSNLAPCINYVKGGGA--VPPACCNGIRNVNNLARTTADRRAACNCLKQLSGSI 58
Query  88   SGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
             G+N    A  PGKCGV++PYKI+ STNC  VK
Sbjct  59   PGVNPNNAAALPGKCGVNVPYKISASTNCATVK 91

Sequence Alignment: 29. Allergen Name: Ara h 9.0101 Sequence ID: ABX56711

 Score = 81.7 bits 410,  Expect = 6e-18
 Identities = 64/115 55%, Positives = 81/115 70%, Gaps = 5/115 4%
Query  1    MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGI 60
            MAS   L++A  +LVCMA+        I+CGQV+S+LA CI +    GA P P ACC+G+
Sbjct  1    MAS---LKFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLTKGGA-P-PPACCSGV 55
Query  61   RSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            R L  A +TT DRQAAC CLK+ A S+ G+N G  A  PG+CGVSIPYKI+ STNC  +K
Sbjct  56   RGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGVSIPYKISTSTNCATIK 115

Sequence Alignment: 30. Allergen Name: Pru du 3.0101 Sequence ID: ACN11576

 Score = 80.5 bits 403,  Expect = 1e-17
 Identities = 65/118 55%, Positives = 83/118 70%, Gaps = 7/118 5%
Query  1    MASSG-FLRLAGFVLV--CMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACC 57
            MASSG +L+L  +V V  CMAV    A A ++CGQV ++L  CI Y   NG G +  +CC
Sbjct  1    MASSGQLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYV-ANG-GALNPSCC 58
Query  58   NGIRSLNSAAKTTPDRQAACRCLKSLASSI--SGINYGLVAGAPGKCGVSIPYKIAPSTN 115
             G+RSL S A+TT DRQ+ C CLK   + I  +  N GL AG PGKCGV+IPYKI+PST+
Sbjct  59   TGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTD 118
Query  116  CDNVK 120
            C  +K
Sbjct  119  CKTIK 123

Sequence Alignment: 31. Allergen Name: Api g 2 Sequence ID: ACV04796

 Score = 79.4 bits 397,  Expect = 3e-17
 Identities = 54/105 51%, Positives = 71/105 67%, Gaps = 2/105 1%
Query  13   VLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPD 72
            +L+ + +       G+TCGQV+  L GC+ Y +G G  P P ACC G++ LNS AKT  D
Sbjct  13   MLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGY-PSP-ACCGGVKGLNSLAKTPAD 70
Query  73   RQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNV 119
            R+ AC CLK+LA S+ GINYG  +  PGKCG+ IPY I+PST+C  V
Sbjct  71   RKQACACLKTLAGSVKGINYGAASALPGKCGIRIPYPISPSTDCSRV 117

Sequence Alignment: 32. Allergen Name: Lyc e 3 Sequence ID: AAB42069

 Score = 79.2 bits 396,  Expect = 3e-17
 Identities = 59/111 53%, Positives = 79/111 71%, Gaps = 4/111 3%
Query  6    FLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNS 65
            F ++A FV+ CM V +  AE+ ++CG+V+S LA C+ Y  G G  P+   CC G++ L  
Sbjct  4    FGKIACFVVFCMVVVAPHAES-LSCGEVTSGLAPCLPYLEGRG--PLG-GCCGGVKGLLG 59
Query  66   AAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            AAKT  DR+ AC CLKS A+SI GI+ G  AG PG CGV+IPYKI+PST+C  V+
Sbjct  60   AAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114

Sequence Alignment: 33. Allergen Name: Sola l 3.0101 Sequence ID: P93224

 Score = 79.2 bits 396,  Expect = 3e-17
 Identities = 59/111 53%, Positives = 79/111 71%, Gaps = 4/111 3%
Query  6    FLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNS 65
            F ++A FV+ CM V +  AE+ ++CG+V+S LA C+ Y  G G  P+   CC G++ L  
Sbjct  4    FGKIACFVVFCMVVVAPHAES-LSCGEVTSGLAPCLPYLEGRG--PLG-GCCGGVKGLLG 59
Query  66   AAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            AAKT  DR+ AC CLKS A+SI GI+ G  AG PG CGV+IPYKI+PST+C  V+
Sbjct  60   AAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114

Sequence Alignment: 34. Allergen Name: Pha v 3.0101 Sequence ID: ADC80502

 Score = 74.9 bits 372,  Expect = 6e-16
 Identities = 53/114 46%, Positives = 79/114 69%, Gaps = 5/114 4%
Query  1    MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGI 60
            MAS   +++A  V++CM V       G+TCGQV S+L  C+ + + NG G VP  CCNG+
Sbjct  1    MAS---VKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQ-NG-GFVPAGCCNGV 55
Query  61   RSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNV 119
            R++ ++A++T DR+  C CLK+ A ++ G+N       PGKCGV+IPYKI+ STNC ++
Sbjct  56   RNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114

Sequence Alignment: 35. Allergen Name: Ara h 9.0201 Sequence ID: ABX75045

 Score = 73.0 bits 362,  Expect = 2e-15
 Identities = 52/91 57%, Positives = 65/91 71%, Gaps = 2/91 2%
Query  28   ITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSI 87
            ++CGQV+S+LA CI +    G    P  CC+G+R L  AAKTT DRQAAC CLK+ A S+
Sbjct  1    LSCGQVNSALAPCITFLTKGGVPSGP--CCSGVRGLLGAAKTTADRQAACNCLKAAAGSL 58
Query  88   SGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
             G+N G  A  PG+CGVSIPYKI+ STNC  +K
Sbjct  59   HGLNQGNAAALPGRCGVSIPYKISTSTNCATIK 91

Sequence Alignment: 36. Allergen Name: Art v 3.0201 Sequence ID: EU564845

 Score = 72.1 bits 356,  Expect = 4e-15
 Identities = 51/105 48%, Positives = 69/105 65%, Gaps = 3/105 2%
Query  13   VLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPD 72
            ++VCM V+S+ AEA + C  VS+ ++ C+ Y +  G   VP  CC G++ LN AAKTTPD
Sbjct  10   MVVCMVVSSSYAEA-LKCSDVSNKISACLSYLKQGG--EVPADCCTGVKGLNDAAKTTPD 66
Query  73   RQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            RQ AC CLK+   S       + A  P KCGV+IPYKI+  T+C+ VK
Sbjct  67   RQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKVK 114

Sequence Alignment: 37. Allergen Name: Art ar 3.0101 Sequence ID: ANC85019

 Score = 72.1 bits 356,  Expect = 4e-15
 Identities = 51/105 48%, Positives = 69/105 65%, Gaps = 3/105 2%
Query  13   VLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPD 72
            ++VCM V+S+ AEA + C  VS+ ++ C+ Y +  G   VP  CC G++ LN AAKTTPD
Sbjct  12   MVVCMVVSSSYAEA-LKCSDVSNKISACLSYLKQGG--EVPADCCTGVKGLNDAAKTTPD 68
Query  73   RQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            RQ AC CLK+   S       + A  P KCGV+IPYKI+  T+C+ VK
Sbjct  69   RQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 38. Allergen Name: Art la 3.0101 Sequence ID: ANC85024

 Score = 72.1 bits 356,  Expect = 4e-15
 Identities = 51/105 48%, Positives = 69/105 65%, Gaps = 3/105 2%
Query  13   VLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPD 72
            ++VCM V+S+ AEA + C  VS+ ++ C+ Y +  G   VP  CC G++ LN AAKTTPD
Sbjct  12   MVVCMVVSSSYAEA-LKCSDVSNKISACLSYLKQGG--EVPADCCTGVKGLNDAAKTTPD 68
Query  73   RQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            RQ AC CLK+   S       + A  P KCGV+IPYKI+  T+C+ VK
Sbjct  69   RQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 39. Allergen Name: Art si 3.0102 Sequence ID: ANC85027

 Score = 71.9 bits 355,  Expect = 5e-15
 Identities = 51/105 48%, Positives = 70/105 66%, Gaps = 3/105 2%
Query  13   VLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPD 72
            ++VCM ++S+ AEA +TC  VS+ +  C+ Y +  G   VP  CC G++ LN AAKTTPD
Sbjct  12   MVVCMVLSSSYAEA-LTCSDVSNKITPCLNYLKQGG--EVPADCCTGVKGLNDAAKTTPD 68
Query  73   RQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            RQ AC CLK+   S   +   + A  P KCGV+IPYKI+  T+C+ VK
Sbjct  69   RQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 40. Allergen Name: Art v 3.0202 Sequence ID: ACE07187

 Score = 71.9 bits 355,  Expect = 5e-15
 Identities = 51/105 48%, Positives = 70/105 66%, Gaps = 3/105 2%
Query  13   VLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPD 72
            ++VCM ++S+ AEA +TC  VS+ +  C+ Y +  G   VP  CC G++ LN AAKTTPD
Sbjct  12   MVVCMVLSSSYAEA-LTCSDVSNKITPCLNYLKQGG--EVPADCCTGVKGLNDAAKTTPD 68
Query  73   RQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            RQ AC CLK+   S   +   + A  P KCGV+IPYKI+  T+C+ VK
Sbjct  69   RQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 41. Allergen Name: Art ar 3.0102 Sequence ID: ANC85020

 Score = 71.9 bits 355,  Expect = 5e-15
 Identities = 51/105 48%, Positives = 70/105 66%, Gaps = 3/105 2%
Query  13   VLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPD 72
            ++VCM ++S+ AEA +TC  VS+ +  C+ Y +  G   VP  CC G++ LN AAKTTPD
Sbjct  12   MVVCMVLSSSYAEA-LTCSDVSNKITPCLNYLKQGG--EVPADCCTGVKGLNDAAKTTPD 68
Query  73   RQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            RQ AC CLK+   S   +   + A  P KCGV+IPYKI+  T+C+ VK
Sbjct  69   RQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 42. Allergen Name: Art gm 3.0101 Sequence ID: ANC85022

 Score = 71.8 bits 354,  Expect = 6e-15
 Identities = 51/106 48%, Positives = 68/106 64%, Gaps = 2/106 1%
Query  13   VLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPD 72
            ++VCM V+S+ AEA +TC  VS+ ++ C  + +  G   VP  CC G++ LN AAKTTPD
Sbjct  12   MVVCMVVSSSYAEAALTCSDVSNKISPCTSFLKQGG--EVPADCCTGVKGLNDAAKTTPD 69
Query  73   RQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            RQ AC CLK+   S         A  P KCGV+IPYKI+  T+C+ VK
Sbjct  70   RQTACNCLKTSFKSNKDFKSDNAAVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 43. Allergen Name: Art gm 3.0102 Sequence ID: ANC85023

 Score = 71.8 bits 354,  Expect = 6e-15
 Identities = 50/106 47%, Positives = 69/106 65%, Gaps = 2/106 1%
Query  13   VLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPD 72
            ++VCM V+S+ AEA +TC  VS+ ++ C+ + +  G   VP  CC G++ LN AAKTTPD
Sbjct  12   MVVCMVVSSSYAEAALTCSDVSNKISPCLSFLKQGG--EVPADCCTGVKGLNDAAKTTPD 69
Query  73   RQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            RQ AC CLK+   S   +        P KCGV+IPYKI+  T+C+ VK
Sbjct  70   RQTACNCLKTSFKSNKDLKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 44. Allergen Name: Art an 3.0102 Sequence ID: ANC85018

 Score = 70.9 bits 349,  Expect = 1e-14
 Identities = 51/106 48%, Positives = 67/106 63%, Gaps = 2/106 1%
Query  13   VLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPD 72
            ++VCM V S+ AEA +TC  V+  ++ C  +    G   VP  CC G++ LN AAKTTPD
Sbjct  12   MVVCMVVTSSYAEAALTCNDVTKKISPCTSFLEKGG--EVPVDCCTGVKGLNDAAKTTPD 69
Query  73   RQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            RQAAC CLK+   S +       A  P KCGV+IPYKI+  T+C+ VK
Sbjct  70   RQAACNCLKTSFKSSNNFKEENAAVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 45. Allergen Name: Art la 3.0102 Sequence ID: ANC85025

 Score = 70.7 bits 348,  Expect = 1e-14
 Identities = 47/106 44%, Positives = 68/106 64%, Gaps = 2/106 1%
Query  13   VLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPD 72
            ++VCM V S+ AEA +TC  VS+ ++ C+ Y +  G   VP  CC G++ LN A KTTPD
Sbjct  10   MVVCMVVKSSYAEAALTCSDVSTKISPCLSYLKKGG--EVPADCCTGVKGLNDATKTTPD 67
Query  73   RQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            RQ AC CLK+   S   +   +    P KCG+++PYK++  T+C+ VK
Sbjct  68   RQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 115

Sequence Alignment: 46. Allergen Name: Art si 3.0101 Sequence ID: ANC85026

 Score = 70.4 bits 346,  Expect = 2e-14
 Identities = 49/105 46%, Positives = 69/105 65%, Gaps = 3/105 2%
Query  13   VLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPD 72
            ++VCM V+S+ AEA +TC  VS+ ++ C+ Y +  G   VP  CC G++ LN AAKTTPD
Sbjct  12   MVVCMVVSSSYAEA-LTCSDVSNKISPCLNYLKQGG--EVPANCCAGVKGLNDAAKTTPD 68
Query  73   RQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            RQ AC CLK+   +   +        P KCGV+IPYK++  T+C+ VK
Sbjct  69   RQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116

Sequence Alignment: 47. Allergen Name: Art ca 3.0102 Sequence ID: QIN55516

 Score = 70.2 bits 345,  Expect = 2e-14
 Identities = 49/106 46%, Positives = 66/106 62%, Gaps = 2/106 1%
Query  13   VLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPD 72
            ++VCM V S+ AEA +TC  VS+ +  C+ + +  G   VP  CC G++ LN AAKT PD
Sbjct  12   MIVCMVVLSSYAEAALTCSDVSNKITPCLSFLKQGG--EVPADCCTGVKGLNDAAKTGPD 69
Query  73   RQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            RQ AC CLK+   S   +        P KCGV+IPYKI+  T+C+ VK
Sbjct  70   RQKACNCLKTTFKSNKDLKSDNAVVLPSKCGVNIPYKISLETDCNTVK 117

Sequence Alignment: 48. Allergen Name: Sin a 3.0101 Sequence ID: ABU95411

 Score = 69.8 bits 344,  Expect = 2e-14
 Identities = 47/91 51%, Positives = 64/91 70%, Gaps = 2/91 2%
Query  28   ITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSI 87
            ++CG V+S+LA CI Y   N   P+P+ CC G+ +LN+ A+TTPDRQ ACRCL   A+S 
Sbjct  2    LSCGTVNSNLAACIGYLTQNA--PLPKGCCTGVTNLNNMARTTPDRQQACRCLVGAANSF 59
Query  88   SGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
              +N    A  P  CGV+IPYKI+ STNC++V+
Sbjct  60   PSLNAARAAALPKACGVNIPYKISKSTNCNSVR 92

Sequence Alignment: 49. Allergen Name: Art v 3.0301 Sequence ID: EU564847

 Score = 70.0 bits 344,  Expect = 2e-14
 Identities = 45/112 40%, Positives = 72/112 64%, Gaps = 2/112 1%
Query  7    LRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSA 66
            +++   ++VCM V+++ AE+ +TC  VS+ ++ C+ Y +  G   VP  CC G++ LN A
Sbjct  6    MKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGE--VPADCCTGVKGLNDA 63
Query  67   AKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
             KTTPDRQ AC CLK+   S   +   +    P KCG+++PYK++  T+C+ VK
Sbjct  64   TKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117

Sequence Alignment: 50. Allergen Name: Art an 3.0101 Sequence ID: ANC85017

 Score = 69.7 bits 342,  Expect = 2e-14
 Identities = 50/106 47%, Positives = 66/106 62%, Gaps = 2/106 1%
Query  13   VLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPD 72
            ++VCM V+S+ AEA +TC  VS+ +  C  + +  G   V   CC G++ LN AAKTTPD
Sbjct  12   MVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGG--EVSADCCTGVKGLNDAAKTTPD 69
Query  73   RQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            RQAAC CLK+   S            P KCGV+IPYKI+  T+C+ VK
Sbjct  70   RQAACNCLKTTFKSNKDFKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 51. Allergen Name: Art ca 3.0101 Sequence ID: ANC85021

 Score = 69.7 bits 342,  Expect = 2e-14
 Identities = 50/106 47%, Positives = 66/106 62%, Gaps = 2/106 1%
Query  13   VLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPD 72
            ++VCM V+S+ AEA +TC  VS+ +  C  + +  G   V   CC G++ LN AAKTTPD
Sbjct  12   MVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGG--EVSADCCTGVKGLNDAAKTTPD 69
Query  73   RQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
            RQAAC CLK+   S            P KCGV+IPYKI+  T+C+ VK
Sbjct  70   RQAACNCLKTTFKSNKDFKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 52. Allergen Name: Hor v 1 Sequence ID: AAA32970

 Score = 67.2 bits 328,  Expect = 1e-13
 Identities = 47/116 40%, Positives = 68/116 58%, Gaps = 3/116 2%
Query  1    MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGI 60
            MA +  L +A   LV M  A+  A   + CGQV S +  C+ Y +G G GP  + CCNG+
Sbjct  1    MARAQVLLMAA-ALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQG-GPGPSGE-CCNGV 57
Query  61   RSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNV 119
            R L++ A+++ DRQ  C CLK +A  I  +N    A  P KC V++PY I+P  +C  +
Sbjct  58   RDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRI 116

Sequence Alignment: 53. Allergen Name: Hor v 1 Sequence ID: CAA42832

 Score = 66.8 bits 325,  Expect = 2e-13
 Identities = 47/113 41%, Positives = 67/113 59%, Gaps = 3/113 2%
Query  1    MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGI 60
            MA +  L +A   LV M  A+  A   + CGQV S +  C+ Y +G G GP  + CCNG+
Sbjct  1    MARAQVLLMAA-ALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQG-GPGPSGE-CCNGV 57
Query  61   RSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNC 116
            R L++ A+++ DRQ  C CLK +A  I  +N    A  P KC V++PY I+P  +C
Sbjct  58   RDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDC 113

Sequence Alignment: 54. Allergen Name: Ara h 17.0101 Sequence ID: A0A510A9S3

 Score = 65.2 bits 318,  Expect = 4e-13
 Identities = 49/91 53%, Positives = 61/91 67%, Gaps = 3/91 3%
Query  28   ITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSI 87
            I C  V+ S+A C  Y +  G    P  CC+GI+++N  AKTT DRQA C CLKS A+S+
Sbjct  2    IQCSFVTKSIAPCFGYLKSGGTVSGP--CCSGIQNINGTAKTTSDRQAVCNCLKSAAASL 59
Query  88   -SGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
             S IN    A  PGKCGVSIPYKI+ S NC ++K
Sbjct  60   GSQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93

Sequence Alignment: 55. Allergen Name: Sola l 7.0101 Sequence ID: NP_001316123

 Score = 59.0 bits 282,  Expect = 4e-11
 Identities = 42/109 38%, Positives = 66/109 60%, Gaps = 4/109 3%
Query  9    LAGFVLVCMAV--ASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSA 66
            +A +VLV +AV   + VA   ITCGQV ++LA C+ +    G  P   ACC+G+R+LN  
Sbjct  4    IAILVLVVLAVFQLAMVARGAITCGQVDANLAPCVPFLTQGGE-P-GAACCSGVRTLNGN 61
Query  67   AKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNV 119
             +++ DR+ AC C+K+ A+    +        P KCG+S+   I+ + NCD +
Sbjct  62   TQSSDDRRTACNCVKAAANRYPNLKDDAAQSLPSKCGISLTVPISRTVNCDTI 114

Sequence Alignment: 56. Allergen Name: Tri a 14.0101 Sequence ID: 19846220

 Score = 58.2 bits 278,  Expect = 5e-11
 Identities = 38/90 42%, Positives = 58/90 64%, Gaps = 2/90 2%
Query  28   ITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSI 87
            I CG+V S +  C+ Y +G G GP  Q CC+G+++L++ A++  DRQ+AC CLK +A  I
Sbjct  1    IDCGHVDSLVRPCLSYVQG-GPGPSGQ-CCDGVKNLHNQARSQSDRQSACNCLKGIARGI 58
Query  88   SGINYGLVAGAPGKCGVSIPYKIAPSTNCDNV 119
              +N       P KCGV++PY I+ + +C  V
Sbjct  59   HNLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90

Sequence Alignment: 57. Allergen Name: Hel a 3.0101 Sequence ID: P82007

 Score = 57.3 bits 272,  Expect = 1e-10
 Identities = 43/111 38%, Positives = 63/111 56%, Gaps = 6/111 5%
Query  3    SSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRS 62
            S G   LA  V+  + V  +VA   ITC  V+ +L  C+ Y R +G  P P ACC G + 
Sbjct  5    SMGVAILAMIVMAQLMVHPSVA---ITCNDVTGNLTPCLPYLR-SGGKPTP-ACCAGAKK 59
Query  63   LNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNV 119
            L  A +T  DR+ AC+C K+ A  +  +   + +  PGKCG+S    I P+ NC+ +
Sbjct  60   LLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCGISTSIPINPNVNCNTI 115

Sequence Alignment: 58. Allergen Name: Par j 2 Sequence ID: O04403

 Score = 48.4 bits 221,  Expect = 7e-08
 Identities = 33/100 33%, Positives = 56/100 56%, Gaps = 4/100 4%
Query  19   VASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACR 78
            +AS  A     CG+V   +  C+++ +G    P  ++CC+G + L+   KTT  ++ AC+
Sbjct  24   LASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEP-SKSCCSGTKKLSEEVKTTEQKREACK 82
Query  79   CLKSLASSISGINYGLVAGAPGKCGVS--IPYKIAPSTNCDNVK 120
            C+ +    ISGI   LVA  P KCG++  +P  I    +C  ++
Sbjct  83   CIVAATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125

Sequence Alignment: 59. Allergen Name: Par j 2 Sequence ID: P55958

 Score = 45.9 bits 207,  Expect = 4e-07
 Identities = 35/110 31%, Positives = 62/110 56%, Gaps = 12/110 10%
Query  9    LAGFVLVCMAVA-STVAEAGIT-------CGQVSSSLAGCIQYARGNGAGPVPQACCNGI 60
            +A +V++  A+A ++ AE           CG+V   +  C+++ +G    P  + CC+G 
Sbjct  6    MAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEP-SKECCSGT 64
Query  61   RSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGV--SIPYKIAPSTNCDN 118
            + L+   KTT  ++ AC+C+      ISGI   LVA  P KC +  ++P  I    +C  
Sbjct  65   KKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLP-PITADFDCSK 123
Query  119  VK 120
            ++
Sbjct  124  IQ 125

Sequence Alignment: 60. Allergen Name: Par j 1 Sequence ID: Q40905

 Score = 45.1 bits 202,  Expect = 7e-07
 Identities = 30/87 34%, Positives = 47/87 54%, Gaps = 3/87 3%
Query  29   TCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSIS 88
            TCG V  +L  C+ + +G    P  + CC+G + L+   KT P R  AC C+++   + S
Sbjct  39   TCGTVVGALMPCLPFVQGKEKEP-SKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYS 97
Query  89   GINYGLVAGAPGKCGVSIPYKIAP-STNCD 117
             I+  LV+  P  CG+ +  K+ P   N D
Sbjct  98   DIDGKLVSEVPKHCGI-VDSKLPPIDVNMD 126

Sequence Alignment: 61. Allergen Name: Par j 1 Sequence ID: P43217

 Score = 44.5 bits 199,  Expect = 1e-06
 Identities = 29/89 32%, Positives = 49/89 55%, Gaps = 5/89 5%
Query  29   TCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSIS 88
            TCG +  +L  C+ + +G    P  + CC+G + L+   KT P R  AC C+++   + S
Sbjct  3    TCGTMVRALMPCLPFVQGKEKEP-SKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYS 61
Query  89   GINYGLVAGAPGKCGVSIPYKIAP---STNCDNV 119
             I+  LV+  P  CG+ +  K+ P   + +C  V
Sbjct  62   DIDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTV 94

Sequence Alignment: 62. Allergen Name: Par j 1.0103 Sequence ID: CAI94601

 Score = 44.2 bits 197,  Expect = 1e-06
 Identities = 29/87 33%, Positives = 47/87 54%, Gaps = 3/87 3%
Query  29   TCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSIS 88
            TCG +  +L  C+ + +G    P  + CC+G + L+   KT P R  AC C+++   + S
Sbjct  3    TCGTMVRALMPCLPFVQGKEKEP-SKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYS 61
Query  89   GINYGLVAGAPGKCGVSIPYKIAP-STNCD 117
             I+  LV+  P  CG+ +  K+ P   N D
Sbjct  62   DIDGKLVSEVPKHCGI-VDSKLPPIDVNMD 90

Sequence Alignment: 63. Allergen Name: Par j 1 Sequence ID: O04404

 Score = 43.1 bits 190,  Expect = 4e-06
 Identities = 35/106 33%, Positives = 54/106 50%, Gaps = 6/106 5%
Query  10   AGFVLVCMA-VASTVAEAGI--TCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSA 66
            AG+    +A VA      G   TCG V  +L  C+ + +G    P  + CC+G + L+  
Sbjct  18   AGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEKEP-SKGCCSGAKRLDGE 76
Query  67   AKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAP-STNCD 117
             KT   R  AC C+++   + S I+  LV+  P  CG+ +  K+ P   N D
Sbjct  77   TKTGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGI-VDSKLPPIDVNMD 127

Sequence Alignment: 64. Allergen Name: Par j 1.0101 Sequence ID: CAA54587

 Score = 40.4 bits 176,  Expect = 2e-05
 Identities = 26/82 31%, Positives = 45/82 54%, Gaps = 5/82 6%
Query  36   SLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSISGINYGLV 95
            +L  C+ + +G    P  + CC+G + L+   KT P R  AC C+++   + S I+  LV
Sbjct  4    ALMPCLPFVQGKEKEP-SKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLV 62
Query  96   AGAPGKCGVSIPYKIAP---STNCDNV 119
            +  P  CG+ +  K+ P   + +C  V
Sbjct  63   SEVPKHCGI-VDSKLPPIDVNMDCKTV 88

Sequence Alignment: 65. Allergen Name: Amb a 6 Sequence ID: O04004

 Score = 39.3 bits 170,  Expect = 3e-05
 Identities = 39/103 37%, Positives = 53/103 51%, Gaps = 7/103 6%
Query  11   GFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTT 70
            G++LV      T+  A  TC  V + LA C  +  G    P  +ACC G+ +LN++ KT 
Sbjct  13   GLLLVSW--RPTMFAASPTCDTVQNILAPCAGFLTGQ--EP-SKACCTGVNNLNNSRKTK 67
Query  71   PDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120
             DR A C C+K L  SI+  +   +     KCGV  P   A   N D  K
Sbjct  68   ADRVAVCNCIKELTKSIA-YDPKRMPLLSTKCGVK-PDFPAVDKNLDCSK 115

Sequence Alignment: 66. Allergen Name: Cas s 8 Sequence ID: 10998016

 Score = 32.9 bits 139,  Expect = 0.0009
 Identities = 17/34 50%, Positives = 21/34 61%, Gaps = 0/34 0%
Query  28   ITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIR 61
            ITC QVS SL  C+ Y + NG  P P  CC G++
Sbjct  2    ITCTQVSKSLMPCLTYLKSNGGSPPPGTCCQGVK 35

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.