The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MASSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDN
GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND
EPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP
NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG
GEKIIAEDAIPDGWKADSVYKSNVQAK
Sequence Info Allergen Name Length Opt Bits Score E Value
AAF72983 Ory s 1 267 1844 356.1 7.2e-100
AAF72991 Ory s 1 267 1615 313.0 7e-87
Q40638 Ory s 1 263 1556 301.9 1.5e-83
CAA81613 Phl p 1.0101 263 1364 265.7 1.2e-72
P43213 Phl p 1 263 1359 264.8 2.3e-72
CAA10140 Hol l 1 263 1343 261.8 1.8e-71
CAA10520 Poa p a 263 1342 261.6 2.1e-71
Q41260 Pha a 1 269 1311 255.7 1.2e-69
P43216 Hol l 1 265 1307 255.0 2e-69
CAB63699 Lol p 1.0103 263 1302 254.0 3.9e-69
AAA63279 Lol p 1.0101 263 1299 253.5 5.7e-69
P14946 Lol p 1 263 1297 253.1 7.4e-69
CAA93121 Hol l 1.0102 248 1291 252.0 1.5e-68
AAA63278 Lol p 1.0102 252 1273 248.6 1.6e-67
AAF72990 Ory s 1 269 1264 246.9 5.7e-67
ACA23876 Pas n 1.0101 265 1246 243.5 5.8e-66
P58738 Zea m 1 269 1243 242.9 8.8e-66
A0A4D6G2J8 Uro m 1.0201 229 1234 241.2 2.4e-65
AAL14077 Cyn d 1.0202 262 1229 240.3 5.3e-65
A0A4D6FZ45 Uro m 1.0101 262 1229 240.3 5.3e-65
AAL14079 Cyn d 1.0203 262 1229 240.3 5.3e-65
AAL14078 Cyn d 1 262 1213 237.3 4.3e-64
AAK96255 Cyn d 1.0201 244 1194 233.7 4.8e-63
AAF80379 Cyn d 1.0204 244 1191 233.1 7.1e-63
QCX36431 Zoy m 1.0101 272 1188 232.6 1.2e-62
O04701 Cyn d 1 246 1149 225.2 1.7e-60
ABC58726 Sor h 1.0101 239 1144 224.3 3.2e-60
AAF72984 Ory s 1 268 988 194.9 2.5e-51
AAF72987 Ory s 1 275 973 192.1 1.8e-50
AAD10496 Tri a ps93 271 954 188.5 2.2e-49
AAF72989 Ory s 1 271 930 184.0 5e-48
AAF72985 Ory s 1 286 927 183.4 7.7e-48
AAB61710 Ory s 1 261 922 182.4 1.4e-47
Q07154 Zea m 1 191 895 177.3 3.4e-46
AAF72988 Ory s 1 327 799 159.3 1.6e-40
AAA50175 Gly m 2 277 759 151.7 2.5e-38
AAF72986 Ory s 1 275 754 150.8 4.8e-38
CAB37496 Ara t expansin 265 463 96.0 1.5e-21
AAG13596 Ory s 1 275 399 83.9 6.5e-18
BAA85432 Ory s 1 284 359 76.4 1.2e-15
CAA10346 Cyn d 2 122 281 61.7 1.4e-11
CAA10345 Dac g 2 122 277 60.9 2.4e-11
CAA10348 Poa p 2 122 277 60.9 2.4e-11
P43214 Phl p 2 122 277 60.9 2.4e-11
P14947 Lol p 2 97 266 58.8 8.2e-11
P93124 Dac g 3 96 259 57.5 2e-10
2JNZ_A Phl p 3.0101 108 248 55.4 9.6e-10
CAA51775 Lol p 2 88 245 54.9 1.2e-09
Q7M1X8 Dac g 1.0101 34 217 49.6 1.8e-08
P14948 Lol p 3 97 223 50.7 2.3e-08
AAP80171 Cyn d 15 112 215 49.2 7.4e-08
CAA90746 Tri a 3 118 203 47.0 3.7e-07
Q7M1X6 Ant o 1.0101 32 189 44.3 6.5e-07
A0A077B2S0 Sor h 2.0201 121 171 40.9 2.5e-05
A0A077B7S9 Sor h 2.0101 119 170 40.8 2.8e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 356.1 bits 1844,  Expect = 7e-100
 Identities = 267/267 100%, Positives = 267/267 100%, Gaps = 0/267 0%
Query  1    MASSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDN 60
            MASSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDN
Sbjct  1    MASSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDN 60
Query  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
            GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND
Sbjct  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
Query  121  EPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 180
            EPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP
Sbjct  121  EPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 180
Query  181  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 240
            NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG
Sbjct  181  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 240
Query  241  GEKIIAEDAIPDGWKADSVYKSNVQAK 267
            GEKIIAEDAIPDGWKADSVYKSNVQAK
Sbjct  241  GEKIIAEDAIPDGWKADSVYKSNVQAK 267

Sequence Alignment: 2. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 313.0 bits 1615,  Expect = 7e-87
 Identities = 219/265 82%, Positives = 243/265 91%, Gaps = 0/265 0%
Query  1    MASSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDN 60
            MASS LLLACVV AAMVSAVSCGPPKVPPGPNIT +YG +WLEA+ TWYG PKGAGP DN
Sbjct  1    MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDN 60
Query  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
            GGACGYKD+DKAPFLGMNSCGNDPIFKDGKGCGSCFE+KCSKPEACSDKP +IH+TDMN 
Sbjct  61   GGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNT 120
Query  121  EPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 180
            EPIAAYHFDLSG AFGAMAK+GKDEELRKAGIID QFRRV+CKYP +TK+TFH+EK SNP
Sbjct  121  EPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNP 180
Query  181  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 240
            NY+A+LVKYV GDGDVV+VE+KEKGSEEWK L ESWGAIWRIDTPKPLKGPFS+RVTTE 
Sbjct  181  NYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTES 240
Query  241  GEKIIAEDAIPDGWKADSVYKSNVQ 265
             +K++A D IPD WKA+++YKS +Q
Sbjct  241  DQKLVANDVIPDNWKANALYKSEIQ 265

Sequence Alignment: 3. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 301.9 bits 1556,  Expect = 2e-83
 Identities = 234/263 88%, Positives = 239/263 90%, Gaps = 4/263 1%
Query  1    MASSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDN 60
            MASSSLLLACVVVAAMVS    G PKVPPGPNITTSYGDKWLEA+      P+   PKDN
Sbjct  1    MASSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDN 60
Query  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
            GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND
Sbjct  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
Query  121  EPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 180
            EPIAAYHFDLSGLA   MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP
Sbjct  121  EPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 177
Query  181  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 240
            NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG
Sbjct  178  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 237
Query  241  GEKIIAEDAIPDGWKADSVYKSNVQAK 267
              +  AEDAIPD  +   V + NVQAK
Sbjct  238  ARRSSAEDAIPDPGRRQRV-QVNVQAK 263

Sequence Alignment: 4. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 265.7 bits 1364,  Expect = 1e-72
 Identities = 187/262 71%, Positives = 220/262 83%, Gaps = 0/262 0%
Query  1    MASSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDN 60
            MASSS +L  V + A+    + G PKVPPGPNIT +YGDKWL+AK+TWYG P  AGPKDN
Sbjct  1    MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYGKPTAAGPKDN 60
Query  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
            GGACGYKDVDK PF GM  CGN PIFK G+GCGSCFEIKC+KPEACS +P ++H+TD N+
Sbjct  61   GGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNE 120
Query  121  EPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 180
            EPIAAYHFDLSG+AFG+MAK G +++LR AG ++ QFRRVKCKYP  TK+TFH+EK SNP
Sbjct  121  EPIAAYHFDLSGIAFGSMAKKGDEQKLRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNP 180
Query  181  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 240
            NYLALLVK+VAGDGDVV V+IKEKG ++W ALKESWGAIWRIDTP+ LKGPF+VR TTEG
Sbjct  181  NYLALLVKFVAGDGDVVAVDIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEG 240
Query  241  GEKIIAEDAIPDGWKADSVYKS 262
            G K  A+D IP+GWKAD+ Y+S
Sbjct  241  GTKGEAKDVIPEGWKADTAYES 262

Sequence Alignment: 5. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 264.8 bits 1359,  Expect = 2e-72
 Identities = 188/262 71%, Positives = 216/262 82%, Gaps = 0/262 0%
Query  1    MASSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDN 60
            MASSS +L  VV+ A+    + G PKVPPGPNIT +YGDKWL+AK+TWYG P GAGPKDN
Sbjct  1    MASSSSVLLVVVLFAVFLGSAYGIPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
            GGACGYKDVDK PF GM  CGN PIFK G+GCGSCFEIKC+KPEACS +P ++H+TD N+
Sbjct  61   GGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNE 120
Query  121  EPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 180
            EPIA YHFDLSG AFGAMAK G +++LR AG ++ QFRRVKCKYP  TK+TFH+EK SNP
Sbjct  121  EPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNP 180
Query  181  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 240
            NYLALLVKYV GDGDVV V+IKEKG ++W  LKESWGAIWRIDTP  L GPF+VR TTEG
Sbjct  181  NYLALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEG 240
Query  241  GEKIIAEDAIPDGWKADSVYKS 262
            G K  AED IP+GWKAD+ Y+S
Sbjct  241  GTKTEAEDVIPEGWKADTSYES 262

Sequence Alignment: 6. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 261.8 bits 1343,  Expect = 2e-71
 Identities = 182/262 69%, Positives = 218/262 83%, Gaps = 0/262 0%
Query  1    MASSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDN 60
            MASSSL+L  V + A+    + G  KVPPGPNIT +YGDKWL+AK+TWYG P GAGPKDN
Sbjct  1    MASSSLVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
            GGACGYKDVDK PF GM  CGN PIFK G+GCGSCFEIKC+KPE+CS +P ++H+TD N+
Sbjct  61   GGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPIVVHITDDNE 120
Query  121  EPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 180
            EPIAAYH+DLSG AFGAMAK G++++LR AG ++ +FRRVKC+YP  TK+TFH+EK SNP
Sbjct  121  EPIAAYHLDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPKGTKVTFHVEKGSNP 180
Query  181  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 240
            NYLALLVKYV GDGDVV V+IKEKG ++W  LKESWGA+WR+DTP  L GPF+VR TTEG
Sbjct  181  NYLALLVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEG 240
Query  241  GEKIIAEDAIPDGWKADSVYKS 262
            G K+ AED IP+GWKAD+ Y+S
Sbjct  241  GTKVEAEDVIPEGWKADTAYES 262

Sequence Alignment: 7. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 261.6 bits 1342,  Expect = 2e-71
 Identities = 184/262 70%, Positives = 216/262 82%, Gaps = 0/262 0%
Query  1    MASSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDN 60
            MASSS +L  V + A+    + G  KVPPGPNIT +YGDKWL+AK+TWYG P GAGPKDN
Sbjct  1    MASSSSVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
            GGACGYKDVDKAPF GM  CGN PIFK G+GCGSCFEIKC+KPE+CS +P L+H+TD N+
Sbjct  61   GGACGYKDVDKAPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPVLVHITDDNE 120
Query  121  EPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 180
            EPIAAYHFDLSG AFGAMAK G++++LR AG ++ +FRRVKC+YP  TK+TFH+EK SNP
Sbjct  121  EPIAAYHFDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPEGTKVTFHVEKGSNP 180
Query  181  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 240
            NYLALLVKYV GDGDVV V+IKEKG ++W  LKESWG+IWR+DTP  L GPF+VR TTEG
Sbjct  181  NYLALLVKYVTGDGDVVAVDIKEKGKDKWIELKESWGSIWRVDTPDKLTGPFTVRYTTEG 240
Query  241  GEKIIAEDAIPDGWKADSVYKS 262
            G K  AED IP+GWKAD+ Y S
Sbjct  241  GTKGEAEDVIPEGWKADTAYAS 262

Sequence Alignment: 8. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 255.7 bits 1311,  Expect = 1e-69
 Identities = 182/256 71%, Positives = 209/256 81%, Gaps = 1/256 0%
Query  2    ASSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDNG 61
            +SSSLL+   ++A  V +   G  KVPPGPNIT  YGDKWL+AK+TWYG P GAGPKDNG
Sbjct  9    SSSSLLVVAALLAVFVGSAQ-GIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNG 67
Query  62   GACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDE 121
            GACGYKDVDKAPF GM  CGN PIFKDG+GCGSCFE+KCSKPE+CS +P  +H+TD N+E
Sbjct  68   GACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFELKCSKPESCSGEPITVHITDDNEE 127
Query  122  PIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPN 181
            PIA YHFDLSG AFG+MAK G++E +R AG ++ QFRRVKCKYP  TK TFH+EK SNPN
Sbjct  128  PIAPYHFDLSGHAFGSMAKKGEEENVRGAGELELQFRRVKCKYPDGTKPTFHVEKGSNPN 187
Query  182  YLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGG 241
            YLALLVKYV GDGDVV V+IKEKG ++W  LKESWGAIWRIDTP  L GPF+VR TTEGG
Sbjct  188  YLALLVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGG 247
Query  242  EKIIAEDAIPDGWKADS 258
             K   ED IP+GWKAD+
Sbjct  248  TKAEFEDVIPEGWKADT 264

Sequence Alignment: 9. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 255.0 bits 1307,  Expect = 2e-69
 Identities = 180/261 68%, Positives = 214/261 81%, Gaps = 4/261 1%
Query  1    MASSS---LLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGP 57
            MASSS   LLL   + A  + +   G  KVPPGPNIT +YGD+WL+AK+TWYG P GAGP
Sbjct  1    MASSSRSVLLLVAALFAVFLGSAH-GIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGP 59
Query  58   KDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTD 117
            KDNGGACGYKDVDK PF GM  CGN PIFKDG+GCGSCFEIKC+KPE+CS +P  +H+TD
Sbjct  60   KDNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEPVTVHITD 119
Query  118  MNDEPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKA 177
             N+EPIA YHFDLSG AFG+MAK G++++LR AG ++ +FRRVKCKYP  TK TFH+EK 
Sbjct  120  DNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKG 179
Query  178  SNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVT 237
            SNPNYLALLVKY+ GDGDVV V+IKEKG ++W  LKESWGA+WR+DTP  L GPF+VR T
Sbjct  180  SNPNYLALLVKYIDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYT 239
Query  238  TEGGEKIIAEDAIPDGWKADSVYKS 262
            TEGG K  AED IP+GWKAD+ Y++
Sbjct  240  TEGGTKGEAEDVIPEGWKADTAYEA 264

Sequence Alignment: 10. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 254.0 bits 1302,  Expect = 4e-69
 Identities = 181/262 69%, Positives = 211/262 80%, Gaps = 0/262 0%
Query  1    MASSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDN 60
            MASSS +L  V + A+    + G  KVPPGPNIT  YGDKWL+AK+TWYG P GAGPKDN
Sbjct  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
            GGACGYKDVDKAPF GM  CGN PIFKDG+GCGSCFEIKC+KPE+CS +   + +TD N+
Sbjct  61   GGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
Query  121  EPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 180
            EPIA YHFDLSG AFG+MAK G++++LR AG ++ QFRRVKCKYP  TK TFH+EKASNP
Sbjct  121  EPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNP 180
Query  181  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 240
            NYLA+LVKYV GDGDVV V+IKEKG ++W  LKESWGA+WRIDTP  L GPF+VR TTEG
Sbjct  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
Query  241  GEKIIAEDAIPDGWKADSVYKS 262
            G K   ED IP+GWKAD+ Y +
Sbjct  241  GTKSEVEDVIPEGWKADTSYSA 262

Sequence Alignment: 11. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 253.5 bits 1299,  Expect = 6e-69
 Identities = 180/262 68%, Positives = 211/262 80%, Gaps = 0/262 0%
Query  1    MASSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDN 60
            MASSS +L  V + A+    + G  KVPPGPNIT  YGDKWL+AK+TWYG P GAGPKDN
Sbjct  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
            GGACGYK+VDKAPF GM  CGN PIFKDG+GCGSCFEIKC+KPE+CS +   + +TD N+
Sbjct  61   GGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
Query  121  EPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 180
            EPIA YHFDLSG AFG+MAK G+++ +R AG ++ QFRRVKCKYP DTK TFH+EKASNP
Sbjct  121  EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNP 180
Query  181  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 240
            NYLA+LVKYV GDGDVV V+IKEKG ++W  LKESWGA+WRIDTP  L GPF+VR TTEG
Sbjct  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
Query  241  GEKIIAEDAIPDGWKADSVYKS 262
            G K   ED IP+GWKAD+ Y +
Sbjct  241  GTKSEFEDVIPEGWKADTSYSA 262

Sequence Alignment: 12. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 253.1 bits 1297,  Expect = 7e-69
 Identities = 180/262 68%, Positives = 211/262 80%, Gaps = 0/262 0%
Query  1    MASSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDN 60
            MASSS +L  V + A+    + G  KVPPGPNIT  YGDKWL+AK+TWYG P GAGPKDN
Sbjct  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
            GGACGYK+VDKAPF GM  CGN PIFKDG+GCGSCFEIKC+KPE+CS +   + +TD N+
Sbjct  61   GGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
Query  121  EPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 180
            EPIA YHFDLSG AFG+MAK G+++ +R AG ++ QFRRVKCKYP DTK TFH+EKASNP
Sbjct  121  EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNP 180
Query  181  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 240
            NYLA+LVKYV GDGDVV V+IKEKG ++W  LKESWGA+WRIDTP  L GPF+VR TTEG
Sbjct  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
Query  241  GEKIIAEDAIPDGWKADSVYKS 262
            G K   ED IP+GWKAD+ Y +
Sbjct  241  GTKSEFEDVIPEGWKADTSYSA 262

Sequence Alignment: 13. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 252.0 bits 1291,  Expect = 2e-68
 Identities = 172/240 71%, Positives = 202/240 84%, Gaps = 0/240 0%
Query  23   GPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDNGGACGYKDVDKAPFLGMNSCGN 82
            G  KVPPGPNIT +YGD+WL+AK+TWYG P GAGPKDNGGACGYKDVDK PF GM  CGN
Sbjct  8    GIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGN 67
Query  83   DPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKDG 142
             PIFKDG+GCGSCFEIKCSKPE+CS +P  +H+TD N+EPIA YHFDLSG AFG+MAK G
Sbjct  68   TPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKG 127
Query  143  KDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIK 202
            ++++LR AG ++ +FRRVKCKYP  TK TFH+EK SNPNYLALLVKY+ GDGDVV V+IK
Sbjct  128  EEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIK 187
Query  203  EKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDAIPDGWKADSVYKS 262
            EKG ++W  LKESWGA+WR+DTP  L GPF+VR TTEGG K  AED IP+GWKAD+ Y++
Sbjct  188  EKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEA 247

Sequence Alignment: 14. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 248.6 bits 1273,  Expect = 2e-67
 Identities = 172/240 71%, Positives = 198/240 82%, Gaps = 0/240 0%
Query  23   GPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDNGGACGYKDVDKAPFLGMNSCGN 82
            G  KVPPGPNIT  YGDKWL+AK+TWYG P GAGPKDNGGACGYKDVDKAPF GM  CGN
Sbjct  12   GIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFNGMTGCGN 71
Query  83   DPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKDG 142
             PIFKDG+GCGSCFEIKC+KPE+CS +   + +TD N+EPIA YHFDLSG AFG+MAK G
Sbjct  72   TPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKG 131
Query  143  KDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIK 202
            +++ +R AG ++ QFRRVKCKYP DTK TFH+EK SNPNYLA+LVKYV GDGDVV V+IK
Sbjct  132  EEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKGSNPNYLAILVKYVDGDGDVVAVDIK 191
Query  203  EKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDAIPDGWKADSVYKS 262
            EKG ++W  LKESWGA+WRIDTP  L GPF+VR TTEGG K   ED IP+GWKAD+ Y +
Sbjct  192  EKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYSA 251

Sequence Alignment: 15. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 246.9 bits 1264,  Expect = 6e-67
 Identities = 168/263 63%, Positives = 210/263 79%, Gaps = 0/263 0%
Query  3    SSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDNGG 62
            +++++LA  VVAA+V   SCGPPKVPPGPNITT+Y   WL A+ATWYG P G+G  DNGG
Sbjct  5    TTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGSTDNGG 64
Query  63   ACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEP 122
            ACG K+V+  P+ GM SCGN PIFKDG+GCGSC+E+KC +P ACS +P  + +TDMN EP
Sbjct  65   ACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEP 124
Query  123  IAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNY 182
            I+AYHFD+SG AFGAMA  GK+ ELRKAGIID QFRRV+CKYP   K+TFH+EK SNPNY
Sbjct  125  ISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNY 184
Query  183  LALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGE 242
            LA+LVK+VA DGDV++++++E G   W+ +K SWGAIWR+DT  PLK PFS+RVTTE G+
Sbjct  185  LAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGK 244
Query  243  KIIAEDAIPDGWKADSVYKSNVQ 265
             +IA+D IP  W  D++Y SNVQ
Sbjct  245  SLIAKDVIPVNWMPDAIYVSNVQ 267

Sequence Alignment: 16. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 243.5 bits 1246,  Expect = 6e-66
 Identities = 172/263 65%, Positives = 210/263 79%, Gaps = 3/263 1%
Query  1    MASSSLLLACV-VVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKD 59
            M S + ++A   V+AA+V+  SCGPPKVPPGPNITT+Y  KWL AKATWYG P GAGP D
Sbjct  1    MGSLAKIVAVAAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLPAKATWYGQPNGAGPDD 60
Query  60   NGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMN 119
            NGGACG K+V+  P+ G  +CGN PIFKDGKGCGSC+EI+C+KPE CS +P  + +TDMN
Sbjct  61   NGGACGIKNVNLPPYNGFTACGNPPIFKDGKGCGSCYEIRCNKPE-CSGQPVTVFITDMN 119
Query  120  DEPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASN 179
             EPIA YHFDLSG AFGAMAK G +++LR  GI D +FRRV+CKY    KI FH+EK SN
Sbjct  120  YEPIAPYHFDLSGKAFGAMAKPGLNDKLRHYGIFDLEFRRVRCKYQGGQKIVFHVEKGSN 179
Query  180  PNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTE 239
            PNYLA+LVK+VA DGD+V +E+KEK S+ WK +K SWGAIWR+DTPK L  PFS+R+T+E
Sbjct  180  PNYLAMLVKFVADDGDIVLMELKEKSSD-WKPMKLSWGAIWRMDTPKALVPPFSIRLTSE 238
Query  240  GGEKIIAEDAIPDGWKADSVYKSNVQ 265
             G+K+IA+D IP  WK D+VY SNVQ
Sbjct  239  SGKKVIAQDVIPVNWKPDTVYNSNVQ 264

Sequence Alignment: 17. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 242.9 bits 1243,  Expect = 9e-66
 Identities = 164/262 62%, Positives = 209/262 79%, Gaps = 0/262 0%
Query  4    SSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDNGGA 63
            +++++   V+AA+V+  SCGPPKVPPGPNITT+Y  KWL A+ATWYG P GAG  DNGGA
Sbjct  6    NNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAPDNGGA 65
Query  64   CGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPI 123
            CG K+V+  P+ GM +CGN PIFKDGKGCGSC+E++C +   CS  P  +++TDMN EPI
Sbjct  66   CGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDMNYEPI 125
Query  124  AAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYL 183
            A YHFDLSG AFG++AK G ++++R  GI+D +FRRV+CKYPA  KI FHIEK  NPNYL
Sbjct  126  APYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYL 185
Query  184  ALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEK 243
            A+LVKYVA DGD+V +EI++K S EWK +K SWGAIWR+DT K LKGPFS+R+T+E G+K
Sbjct  186  AVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKK 245
Query  244  IIAEDAIPDGWKADSVYKSNVQ 265
            +IA+D IP  W+ D+VY SNVQ
Sbjct  246  VIAKDVIPANWRPDAVYTSNVQ 267

Sequence Alignment: 18. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 241.2 bits 1234,  Expect = 2e-65
 Identities = 164/226 72%, Positives = 194/226 85%, Gaps = 0/226 0%
Query  40   KWLEAKATWYGAPKGAGPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIK 99
            KWL+AKATWYG P GAGP DNGGACGYKDV+KAPF  M +CGN PIFKDG GCGSC+EIK
Sbjct  3    KWLDAKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNPPIFKDGLGCGSCYEIK 62
Query  100  CSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRR 159
            C KP  CS +P ++H+TD N EPIAAYHFDL+G AFGAMAK G++E+LRKAGIID QFRR
Sbjct  63   CDKPAECSGEPVIVHITDQNYEPIAAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQFRR 122
Query  160  VKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAI 219
            VKCKYPA+TKI FH+EK  NPNY+ALL+KY AGDGD+V V+IKEKGSEE+  LK SWGAI
Sbjct  123  VKCKYPANTKIAFHVEKGCNPNYFALLIKYAAGDGDIVAVDIKEKGSEEFIPLKHSWGAI 182
Query  220  WRIDTPKPLKGPFSVRVTTEGGEKIIAEDAIPDGWKADSVYKSNVQ 265
            WRID+PKP+KGP +VR+T+EGG  ++ +DAIP+GWKAD+VY S +Q
Sbjct  183  WRIDSPKPIKGPIAVRLTSEGGTTLVQDDAIPEGWKADTVYTSKLQ 228

Sequence Alignment: 19. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 240.3 bits 1229,  Expect = 5e-65
 Identities = 171/259 66%, Positives = 208/259 80%, Gaps = 2/259 0%
Query  6    LLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGA-PKGAGPKDNGGAC 64
            L +  VV+A+MV    C      PGPNIT +YGDKWL+AKAT+YG+ P+GA P D+GGAC
Sbjct  2    LAVVAVVLASMVGGALCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  65   GYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIA 124
            GYKDVDKAPF GM  CGN+PIFKDG  CGSC+EIKC +P  CS +P LI +TD N E IA
Sbjct  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  125  AYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLA 184
            AYHFDLSG AFGAMAK G++++LRKAG +  QFRRVKC+YP+DTKI FH+EK SNPNYLA
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  185  LLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKI 244
            LLVKY AGDG++V V+IK KGS+E+  +K+SWGAIWRID PKPLKGPF++R+T+E G  +
Sbjct  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
Query  245  IAEDAIPDGWKADSVYKSNVQ 265
              ED IP+ WK D+VYKS +Q
Sbjct  241  EQEDVIPEDWKPDTVYKSKIQ 261

Sequence Alignment: 20. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 240.3 bits 1229,  Expect = 5e-65
 Identities = 171/259 66%, Positives = 208/259 80%, Gaps = 2/259 0%
Query  6    LLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGA-PKGAGPKDNGGAC 64
            L +  VV+A+MV    C      PGPNIT +YGDKWL+AKAT+YG+ P+GA P D+GGAC
Sbjct  2    LAVVAVVLASMVGGALCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  65   GYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIA 124
            GYKDVDKAPF  M  CGN+PIFKDG GCGSC+EIKC +P  CS +P LI +TD N E IA
Sbjct  61   GYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  125  AYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLA 184
            AYHFDLSG AFGAMAK G++++LRKAG +  QFRRVKC+YP+DTKI FH+EK SNPNYLA
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  185  LLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKI 244
            LLVKY AGDG++V V+IK KGS+E+  +K+SWGAIWRID PKPLKGPF++R+T+E G  +
Sbjct  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
Query  245  IAEDAIPDGWKADSVYKSNVQ 265
              ED IP+ WK D+VYKS +Q
Sbjct  241  EQEDVIPEDWKPDTVYKSKIQ 261

Sequence Alignment: 21. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 240.3 bits 1229,  Expect = 5e-65
 Identities = 171/259 66%, Positives = 208/259 80%, Gaps = 2/259 0%
Query  6    LLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGA-PKGAGPKDNGGAC 64
            L +  VV+A+MV    C      PGPNIT +YGDKWL+AKAT+YG+ P+GA P D+GGAC
Sbjct  2    LAVVAVVLASMVGGALCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  65   GYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIA 124
            GYKDVDKAPF  M  CGN+PIFKDG GCGSC+EIKC +P  CS +P LI +TD N E IA
Sbjct  61   GYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  125  AYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLA 184
            AYHFDLSG AFGAMAK G++++LRKAG +  QFRRVKC+YP+DTKI FH+EK SNPNYLA
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  185  LLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKI 244
            LLVKY AGDG++V V+IK KGS+E+  +K+SWGAIWRID PKPLKGPF++R+T+E G  +
Sbjct  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
Query  245  IAEDAIPDGWKADSVYKSNVQ 265
              ED IP+ WK D+VYKS +Q
Sbjct  241  EQEDVIPEDWKPDTVYKSKIQ 261

Sequence Alignment: 22. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 237.3 bits 1213,  Expect = 4e-64
 Identities = 169/254 66%, Positives = 206/254 81%, Gaps = 2/254 0%
Query  11   VVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGA-PKGAGPKDNGGACGYKDV 69
            VV+A+MV    C      PGPNIT +YGDKWL+AKAT+YG+ P+GA P D+GGACGYKDV
Sbjct  7    VVLASMVGGAWCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDV 65
Query  70   DKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFD 129
            DKAPF GM  CGN+PIFKDG GCGSC+EIKC +P  CS +P LI +TD N E IAAYHFD
Sbjct  66   DKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFD 125
Query  130  LSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKY 189
            LSG AFGAMAK G++++LRKAG +  QFRRVKC+YP+DTKITFH+EK S+PNYLALLVKY
Sbjct  126  LSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKY 185
Query  190  VAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDA 249
             AGDG++V V+IK KGS+ +  +K SWGAIWR+D PKPLKGPF++R+T+E G  +  ED 
Sbjct  186  AAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQEDV 245
Query  250  IPDGWKADSVYKSNVQ 265
            IP+ WK D+VYKS +Q
Sbjct  246  IPEDWKPDTVYKSKIQ 261

Sequence Alignment: 23. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 233.7 bits 1194,  Expect = 5e-63
 Identities = 162/237 68%, Positives = 198/237 83%, Gaps = 1/237 0%
Query  29   PGPNITTSYGDKWLEAKATWYGA-PKGAGPKDNGGACGYKDVDKAPFLGMNSCGNDPIFK 87
            PGPNIT +YGDKWL+AKAT+YG+ P+GA P D+GGACGYKDVDKAPF GM  CGN+PIFK
Sbjct  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
Query  88   DGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKDGKDEEL 147
            DG  CGSC+EIKC +P  CS +P LI +TD N E IAAYHFDLSG AFGAMAK G++++L
Sbjct  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
Query  148  RKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSE 207
            RKAG +  QFRRVKC+YP+DTKI FH+EK S+PNYLALLVKY AGDG++V V+IK KGS+
Sbjct  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
Query  208  EWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDAIPDGWKADSVYKSNVQ 265
            E+  +K+SWGAIWRID PKPLKGPF++R+T+E G  +  +D IP+ WK D+VYKS +Q
Sbjct  186  EFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQ 243

Sequence Alignment: 24. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 233.1 bits 1191,  Expect = 7e-63
 Identities = 161/237 67%, Positives = 198/237 83%, Gaps = 1/237 0%
Query  29   PGPNITTSYGDKWLEAKATWYGA-PKGAGPKDNGGACGYKDVDKAPFLGMNSCGNDPIFK 87
            PGPNIT +YGDKWL+AKAT+YG+ P+GA P D+GGACGYKDVDKAPF GM  CGN+PIFK
Sbjct  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
Query  88   DGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKDGKDEEL 147
            DG  CGSC+EIKC +P  CS +P LI +TD N E IAAYHFDLSG AFGAMAK G++++L
Sbjct  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
Query  148  RKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSE 207
            RKAG +  QFRRVKC+YP+DTKI FH+EK S+PNYLALLVKY AGDG++V V+IK KGS+
Sbjct  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
Query  208  EWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDAIPDGWKADSVYKSNVQ 265
            E+  +K+SWGAIWR+D PKPLKGPF++R+T+E G  +  +D IP+ WK D+VYKS +Q
Sbjct  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQ 243

Sequence Alignment: 25. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 232.6 bits 1188,  Expect = 1e-62
 Identities = 170/264 64%, Positives = 209/264 79%, Gaps = 8/264 3%
Query  1    MASSS------LLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGA-PK 53
            MASSS      L    V+++AMV +  C      PGPNIT +Y ++W +AKAT+YG+ P+
Sbjct  1    MASSSARRQAQLAAVAVLLSAMVGSALCEIGD-KPGPNITATYNEEWQDAKATFYGSNPR 59
Query  54   GAGPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALI 113
            GA P D+GGACGYK+VDKAPF+GM  CGN+PIFKDG GCGSCFEIKC +P  CSDKP LI
Sbjct  60   GAAPDDDGGACGYKNVDKAPFFGMTGCGNEPIFKDGLGCGSCFEIKCKEPAECSDKPVLI 119
Query  114  HVTDMNDEPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFH 173
             +TD N E IAAYHFDLSG AFG+MAK G+++ LRKAG +  QFRRVKC+YP+ TKITFH
Sbjct  120  RITDKNYEHIAAYHFDLSGKAFGSMAKQGQEDNLRKAGELTLQFRRVKCEYPSKTKITFH 179
Query  174  IEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFS 233
            +EK  N NYLALLV+Y AGDGD+V V+IK KGS+E+  +K SWGAIWRID  KPLKGPF+
Sbjct  180  VEKGCNDNYLALLVEYAAGDGDIVAVDIKPKGSDEFLPMKPSWGAIWRIDPKKPLKGPFT 239
Query  234  VRVTTEGGEKIIAEDAIPDGWKADSVYKSNVQ 265
            VR+T+E G K++ ED IP  WK ++ Y SN+Q
Sbjct  240  VRLTSESGAKLVQEDVIPADWKPNTAYTSNLQ 271

Sequence Alignment: 26. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 225.2 bits 1149,  Expect = 2e-60
 Identities = 157/237 66%, Positives = 193/237 81%, Gaps = 1/237 0%
Query  29   PGPNITTSYGDKWLEAKATWYGA-PKGAGPKDNGGACGYKDVDKAPFLGMNSCGNDPIFK 87
            PGPNIT +YG KWLEA+AT+YG+ P+GA P D+GGACGYKDVDK PF GM +CGN+PIFK
Sbjct  6    PGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFK 65
Query  88   DGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKDGKDEEL 147
            DG GC +C+EIKC +P  CS +P L+ +TD N E IAAYHFDLSG AFGAMAK G++++L
Sbjct  66   DGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL 125
Query  148  RKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSE 207
            RKAG +  QFRRVKCKYP+ TKITFHIEK SN +YLALLVKY AGDG++V V+IK + S+
Sbjct  126  RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD 185
Query  208  EWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDAIPDGWKADSVYKSNVQ 265
            E+  +K SWGAIWRID  KPLKGPFS+R+T+EGG  ++ +D IP  WK D+VY S +Q
Sbjct  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQ 243

Sequence Alignment: 27. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 224.3 bits 1144,  Expect = 3e-60
 Identities = 161/234 68%, Positives = 189/234 80%, Gaps = 5/234 2%
Query  24   PPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDNGGACGYKDVDKAPFLGMNSCGND 83
            PPKV  G NIT +YG  WLE KATWYG P GAGP DNGGACGYKDV+KAPF  M +CGN 
Sbjct  1    PPKVAKGKNITETYGSDWLERKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNL 60
Query  84   PIFKDGKGCGSCFEIKCSKPEA--CSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKD 141
            PIFKDG  CGSCFEIKC KP+   CS +  ++H+TDMN E IAAYHFDL+G AFGAMAK 
Sbjct  61   PIFKDGL-CGSCFEIKCDKPKPAECSGEAVVVHITDMNYEQIAAYHFDLAGHAFGAMAKK 119
Query  142  GKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEI 201
            G++E+L KAGIID +FRRVKCKY    K+TFH+EK SNPNYLALLVKYV GDGD+V V+I
Sbjct  120  GQEEKLAKAGIIDMKFRRVKCKY--GEKVTFHVEKGSNPNYLALLVKYVDGDGDIVGVDI 177
Query  202  KEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDAIPDGWKADSVY 260
            KEKG + ++ LK SWGAIWR D+P P+K P +V++TTEGG K   +D IP+GWKAD+ Y
Sbjct  178  KEKGGDAYQPLKHSWGAIWRKDSPDPIKFPVTVQITTEGGTKTAYDDVIPEGWKADTTY 236

Sequence Alignment: 28. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 194.9 bits 988,  Expect = 3e-51
 Identities = 134/252 53%, Positives = 181/252 71%, Gaps = 4/252 1%
Query  13   VAAMVS--AVSCGPPKVPPGPNITTSYGD-KWLEAKATWYGAPKGAGPKDNGGACGYKDV 69
            VAA+ S   V+C     P   + +    D  W  A+ATWYGAP GAGP D+GGACG+K+ 
Sbjct  11   VAALFSFLVVTCVAGARPGNFSASDFTADPNWEVARATWYGAPTGAGPDDDGGACGFKNT 70
Query  70   DKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFD 129
            ++ PF  M SCGN+PIFKDGKGCGSC++I+C    ACS  P  + +TDMN  P++ YHFD
Sbjct  71   NQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKYHFD 130
Query  130  LSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKY 189
            LSG AFGAMAK G++++LR AGIID QF+RV C +P   K+TFH+E+ SNP Y+A+LV+Y
Sbjct  131  LSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPG-LKVTFHVEEGSNPVYFAVLVEY 189
Query  190  VAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDA 249
              GDGDVV+V++ E  S+ W  ++ESWG+IWR+D+   L  PFS+R+T E G++++A   
Sbjct  190  EDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVASQV 249
Query  250  IPDGWKADSVYKSNVQ 265
            IP  W   +VY+S VQ
Sbjct  250  IPANWAPMAVYRSFVQ 265

Sequence Alignment: 29. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 192.1 bits 973,  Expect = 2e-50
 Identities = 133/253 52%, Positives = 182/253 71%, Gaps = 7/253 2%
Query  12   VVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDNGGACGYKDVDK 71
            +++ +V   SC    V    +  ++YG  WL A+ATWYGAP GAGP DNGGACG+K+V++
Sbjct  15   ILSVLVVHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPDDNGGACGFKNVNQ 74
Query  72   APFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLS 131
             PF  M SCGN+PIFKDGKGCGSC++I+C+K  +CS     + +TDMN  P+A YHFDLS
Sbjct  75   YPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYYPVARYHFDLS 134
Query  132  GLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVA 191
            G AFGAMAK G +++LR +GIID QFRRV C YP   KI FH+E+ SNP Y+A+LV+Y  
Sbjct  135  GTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPG-LKINFHVEEGSNPVYFAVLVEYED 193
Query  192  GDGDVVEVEIKEKGSEE------WKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKII 245
             DGDVV+V++ E  S        W  ++ESWG+IWR+D+   L+ PFS+R+ ++ G+ ++
Sbjct  194  LDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIRSDSGKTLV 253
Query  246  AEDAIPDGWKADSVYKSNVQ 265
            A + IP  W  +S Y+S VQ
Sbjct  254  ANNVIPANWSPNSNYRSIVQ 273

Sequence Alignment: 30. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 188.5 bits 954,  Expect = 2e-49
 Identities = 127/232 54%, Positives = 175/232 75%, Gaps = 7/232 3%
Query  33   ITTSYGDKWLEAKATWYGAPKGAGPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGC 92
            +  SY   WL AKATWYGAP GAGP DNGGACG+K+V++ P   M +CGN+PIF  G+GC
Sbjct  32   VARSYTSGWLPAKATWYGAPNGAGPDDNGGACGFKNVNQYPISSMGACGNEPIFAGGEGC 91
Query  93   GSCFEIKC--SKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKDGKDEELRKA 150
            G C+EIKC  S   +CS +P  I +TDMN  P+A YH+DLSG AFG+MAK G ++ LR A
Sbjct  92   GMCYEIKCEYSNNPSCSGQPRRIVITDMNYYPVARYHLDLSGTAFGSMAKYGLNDRLRHA 151
Query  151  GIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKE----KGS 206
            GIID QFRRV C +P   K+TFH+++ SNPNYLA+LV+YV  DG VV +E+ +    + +
Sbjct  152  GIIDMQFRRVPCNFPG-MKVTFHVQRGSNPNYLAVLVEYVNVDGTVVRMELMQTMNGRPT 210
Query  207  EEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDAIPDGWKADSVYKSNVQ 265
              W+ ++ SWG++WR+DT +P++GPFS+R+T++ G+ ++A +AIP  W+ D  Y SN+Q
Sbjct  211  GYWQDMRRSWGSVWRMDTNRPVQGPFSIRITSDTGKTLVANNAIPAYWQQDHAYWSNLQ 269

Sequence Alignment: 31. Allergen Name: Ory s 1 Sequence ID: AAF72989

 Score = 184.0 bits 930,  Expect = 5e-48
 Identities = 117/224 52%, Positives = 167/224 74%, Gaps = 3/224 1%
Query  41   WLEAKATWYGAPKGAGPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKC 100
            W  AKATWYG P GAG  DNGGACG+K V++ PF+GM SCGN P++K GKGCGSC+ ++C
Sbjct  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRC 102
Query  101  SKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRV 160
            ++  ACS     + +TDMN  P++ YHFDLSG+AFG +AK G+ ++LR+AGIID QF RV
Sbjct  103  NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARV 162
Query  161  KCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSE--EWKALKESWGA 218
             C++P   K+ FH+E+ S+P YLA+LV+Y  GDGDV +V++KE G+    W  ++ESWG+
Sbjct  163  PCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGS 221
Query  219  IWRIDTPKPLKGPFSVRVTTEGGEKIIAEDAIPDGWKADSVYKSNVQ 265
            +WR+D+   L+ PFS+R+ ++ G+ ++A D IP  W  ++ Y+S VQ
Sbjct  222  VWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQ 268

Sequence Alignment: 32. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 183.4 bits 927,  Expect = 8e-48
 Identities = 119/228 52%, Positives = 170/228 74%, Gaps = 7/228 3%
Query  37   YGDKWLEAKATWYGAPKGAGPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCF 96
            Y   W +A+ATWYG P GAGP DNGGACG+K  ++ PF+ M SCGN P+FKDGKGCGSC+
Sbjct  51   YWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSCY 110
Query  97   EIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQ 156
            +I+C+K ++CS +   + +TDMN  P+A +HFDLSG AFG +AK G +++LR +GIID +
Sbjct  111  KIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIIDIE 170
Query  157  FRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSE------EWK 210
            F RV C++P   KI FH+E+ SNP Y+A+LV+Y  GDGDVV+V++ E  +       +W 
Sbjct  171  FTRVPCEFPG-LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWT 229
Query  211  ALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDAIPDGWKADSVYKSNVQ 265
             ++ESWG+IWR+DT   L+ PFS+R+  E G+ ++A + IP  W+ ++ Y+S VQ
Sbjct  230  PMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQ 284

Sequence Alignment: 33. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 182.4 bits 922,  Expect = 1e-47
 Identities = 120/228 52%, Positives = 166/228 72%, Gaps = 6/228 2%
Query  37   YGDKWLEAKATWYGAPKGAGPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCF 96
            Y + WL AKATWYG P GAGP DNGGACG+K+ ++ PF+ M SCGN+P+F+DGKGCG+C+
Sbjct  27   YTNDWLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACY 86
Query  97   EIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQ 156
            +I+C+   +CS +P  + +TDMN  P+A YHFDLSG AFGAMA+ G +++LR AGIID Q
Sbjct  87   QIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQ 146
Query  157  FRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKE-----KGSEEWKA 211
            FRRV C Y     + FH+E  SNP YLA+LV++   DG VV++++ E     K +  W  
Sbjct  147  FRRVPC-YHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTP 205
Query  212  LKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDAIPDGWKADSVYKSNVQ 265
            ++ SWG+IWR+D    L+GP S+R+ +E G+ +IA   IP  W+A++ Y S VQ
Sbjct  206  MRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQ 259

Sequence Alignment: 34. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 177.3 bits 895,  Expect = 3e-46
 Identities = 119/189 62%, Positives = 151/189 79%, Gaps = 0/189 0%
Query  77   MNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFG 136
            M +CGN PIFKDGKGCGSC+E++C +   CS  P  + +TDMN EPIA YHFDLSG AFG
Sbjct  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
Query  137  AMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDV 196
            ++AK G +++LR  GI+D +FRRV+CKYPA  KI FHIEK  NPNY+A+LVK+VA DGD+
Sbjct  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
Query  197  VEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDAIPDGWKA 256
            V +EI++K S EWK +K SWGAIWR+DT K LKGPFS+R+T+E G+K+IA+D IP  W+ 
Sbjct  121  VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRP 180
Query  257  DSVYKSNVQ 265
            D+VY SNVQ
Sbjct  181  DAVYTSNVQ 189

Sequence Alignment: 35. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 159.3 bits 799,  Expect = 2e-40
 Identities = 140/241 58%, Positives = 181/241 75%, Gaps = 15/241 6%
Query  24   PPKVPPGPNITTSY----GDKWLEAKATWYGAPKGAGPKDNGGACGYKDVDKAPFLGMNS 79
            PP   PG   +       G  WL A+ATWYGAP GAGP DNGGACG+K+V+  PF  M S
Sbjct  71   PPIPSPGTGSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTS 130
Query  80   CGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMA 139
            CGN+P+FKDGKGCGSC++I+C    ACS  P  + +TDMN  P++ YHFDLSG AFGAMA
Sbjct  131  CGNEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMA 190
Query  140  KDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEV 199
            KD +++ELR AGIID QFRRV C+YP  T +TFH+E+ SNP Y+A+LV+Y  GDGDVV+V
Sbjct  191  KDNRNDELRHAGIIDIQFRRVPCQYPGLT-VTFHVEQGSNPVYMAILVEYENGDGDVVQV 249
Query  200  EIKEK--------GSEE--WKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDA 249
            ++ E         G+    W  ++ESWG+IWR+DT  PL+GPFS+R+T E G+ +IA+  
Sbjct  250  DLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQV 309
Query  250  IPDGWKADSVYKSNVQ 265
            IP  W+ ++VY S VQ
Sbjct  310  IPADWQPNTVYSSIVQ 325

Sequence Alignment: 36. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 151.7 bits 759,  Expect = 3e-38
 Identities = 115/254 45%, Positives = 160/254 62%, Gaps = 9/254 3%
Query  7    LLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDNGGACGY 66
            L+A + +  ++ +    P K+      + S  D W  A ATWYG   G G +  GGACGY
Sbjct  15   LIAILSIFLVIPSFCFNPKKLYNASYYSPSSSD-WSPAVATWYGPANGDGSE--GGACGY 71
Query  67   KD-VDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTD--MNDEPI 123
             + V + PF  + S G+  I+  GKGCGSC+E+KC+   ACS  P  + +TD        
Sbjct  72   GNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECAGCGSD 131
Query  124  AAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYL 183
            A YHFDLSG AFGAMA  G+DE LR AG I+ Q RR++C YP  + I FH++  SN  Y+
Sbjct  132  AQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRS-IAFHVDSGSNQEYF 190
Query  184  ALLVKYVAGDGDVVEVEIKEK-GSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTT-EGG 241
            A LV+Y  GDGD+ +VE+KE   S  W ++++SWGA+W+ D   PL+ PFS+++TT E G
Sbjct  191  ATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLTTLESG 250
Query  242  EKIIAEDAIPDGWKADSVYKSNV 264
            + I+A + IP GW     Y+S V
Sbjct  251  QTIVANNVIPAGWTPGQTYRSIV 273

Sequence Alignment: 37. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 150.8 bits 754,  Expect = 5e-38
 Identities = 114/260 43%, Positives = 167/260 64%, Gaps = 14/260 5%
Query  1    MASSSLLLACVVVAAMVS-AVSCGPPKVPPGPNITTSYGDK--WLEAKATWYGAPKGAGP 57
            ++  ++++A +V   ++S  VS        G   T S G    W    ATWYG P+G G 
Sbjct  2    VSRGTFVFAVLVALPILSLPVSGYEQNYTAGRRSTMSLGRGYGWSSGGATWYGGPQGDGS 61
Query  58   KDNGGACGYKD-VDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVT 116
            +  GGACGY+  V + PF  M + G   +FK+GKGCGSC++IKC+   ACS +P  + +T
Sbjct  62   E--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVTVVIT 119
Query  117  DMNDEPIA---AYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFH 173
            D     +    A HFD+SG AFGAMA  G  + LR AG++  Q++RV C++  +  + F 
Sbjct  120  DSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQYKRVPCRFAMN--VAFK 177
Query  174  IEKASNPNYLALLVKYVAGDGDVVEVEI-KEKGSEEWKALKESWGAIWRID--TPKPLKG 230
            ++  SNP YLA+LV+Y  GDGD+  V I K +G   WKA+++SWGA WR++  T KPL  
Sbjct  178  VDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGKPLSP 237
Query  231  PFSVRVTTEGGEKIIAEDAIPDGWKADSVYKSNV 264
            PFS+R+T+  G+ ++A + IP GW+A   Y+S V
Sbjct  238  PFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTV 271

Sequence Alignment: 38. Allergen Name: Ara t expansin Sequence ID: CAB37496

 Score = 96.0 bits 463,  Expect = 1e-21
 Identities = 79/201 39%, Positives = 114/201 56%, Gaps = 11/201 5%
Query  60   NGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMN 119
            + GAC Y  +    F G  +     I+KDG GCG+CF+++C  P  CS K   + VTD+N
Sbjct  41   SSGACAYGSMATGFFAGHIAAALPSIYKDGSGCGACFQVRCKNPTLCSSKGTTVIVTDLN 100
Query  120  DEPIAAYHFDLSGLAFGAMAKD--GKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKA 177
                    + LS  AF AMAK   G D +L K GI+D ++RRV C Y  + K+   +E++
Sbjct  101  KT--NQTDLVLSSRAFRAMAKPVVGADRDLLKQGIVDIEYRRVPCDY-GNKKMNVRVEES 157
Query  178  S-NPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVR- 235
            S NPNYLA+ + Y  G  +VV + I + GS  W  +  S GA+W  D  K   G +  R 
Sbjct  158  SKNPNYLAIKLLYQGGQTEVVAIYIAQVGSSHWSYMTRSHGAVWVTD--KVPNGALQFRF 215
Query  236  VTTEG--GEKIIAEDAIPDGWKADSVYKSNVQ 265
            V T G  G+ + ++  +P  W+A   Y + VQ
Sbjct  216  VVTAGYDGKMVWSQRVLPANWEAGKSYDAGVQ 247

Sequence Alignment: 39. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 83.9 bits 399,  Expect = 7e-18
 Identities = 71/200 35%, Positives = 107/200 53%, Gaps = 14/200 7%
Query  60   NGGACGYKDVDKAPFLGMNSCGNDP-IFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDM 118
            N G+CGY  +  A F G +     P +F+ G GCG+CF+++C   + CS   A + VT  
Sbjct  50   NAGSCGYGSL-AASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVT-- 106
Query  119  NDEPIAAYHFDL--SGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEK 176
             DE  +    DL  S  A+ AMA+ G   +LR    +D +++RV C+Y A   ++  +E+
Sbjct  107  -DEARSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEE 165
Query  177  ASNPNY-LALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVR 235
             S P   L++   Y  G  D+V V++   GS  WK +   +G  W   T +   GP+  R
Sbjct  166  KSRPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFR 223
Query  236  VTTEGGE--KIIAEDA--IPDGWKADSVYKSNVQ 265
            V   GG   K +  D   +P  W A  VY + VQ
Sbjct  224  VVVTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257

Sequence Alignment: 40. Allergen Name: Ory s 1 Sequence ID: BAA85432

 Score = 76.4 bits 359,  Expect = 1e-15
 Identities = 80/246 32%, Positives = 121/246 49%, Gaps = 36/246 14%
Query  6    LLLACVVVAAMVSAVSCGPP-----KVPPGPNITTSYGDK-WLEAKATWYGAPKGAGPKD 59
            +L A + VA     V+ G       +  P P   T Y    W +  AT+YG P G G  D
Sbjct  11   FLAAALAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTSDWHDGSATFYGDPSGMGD-D 69
Query  60   NGGACGYKDVDKAPFLGMNSCG-NDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDM 118
             GGACGY   D   +    +   + P+F DG GCG C+E++C K   C+     + +T  
Sbjct  70   FGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPWCNPGSPSVVITGT 129
Query  119  NDEPIAAY--------------HFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKY 164
            N  P   Y              HFD++  +F  +A+       R AGI+  Q+RRV C+ 
Sbjct  130  NLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ-------RVAGIVPVQYRRVPCQR 182
Query  165  PADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSE-EWKALKESWGAIWRID 223
                +  ++     N  +L L V  V G GDV  + +K  G    W     +WG  +++ 
Sbjct  183  TGGVRFCLQ----GNHYWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVF 238
Query  224  TPKPLKGPFSVRVTTEGGEK--IIAEDAIPDGWKADSVYKSN 263
                    ++V++TT    +  II  DAI   W     Y+ +
Sbjct  239  AALDNSDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCYQGS 280

Sequence Alignment: 41. Allergen Name: Cyn d 2 Sequence ID: CAA10346

 Score = 61.7 bits 281,  Expect = 1e-11
 Identities = 41/90 45%, Positives = 61/90 67%, Gaps = 2/90 2%
Query  169  KITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPL 228
            K+TF +EK SN  +LA+LVKY  GD  + EVE++E GS+EW A+ +  G +W  D+ +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY-EGD-TMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  229  KGPFSVRVTTEGGEKIIAEDAIPDGWKADSVY 260
            KGPF+ R  TE G K + +D +P+ +   + Y
Sbjct  87   KGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 42. Allergen Name: Dac g 2 Sequence ID: CAA10345

 Score = 60.9 bits 277,  Expect = 2e-11
 Identities = 40/90 44%, Positives = 61/90 67%, Gaps = 2/90 2%
Query  169  KITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPL 228
            K+TF +EK SN  +LA+LVKY  GD  + EVE++E GS+EW A+ +  G +W  D+ +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY-EGD-TMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  229  KGPFSVRVTTEGGEKIIAEDAIPDGWKADSVY 260
            +GPF+ R  TE G K + +D +P+ +   + Y
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 43. Allergen Name: Poa p 2 Sequence ID: CAA10348

 Score = 60.9 bits 277,  Expect = 2e-11
 Identities = 40/90 44%, Positives = 61/90 67%, Gaps = 2/90 2%
Query  169  KITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPL 228
            K+TF +EK SN  +LA+LVKY  GD  + EVE++E GS+EW A+ +  G +W  D+ +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY-EGD-TMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  229  KGPFSVRVTTEGGEKIIAEDAIPDGWKADSVY 260
            +GPF+ R  TE G K + +D +P+ +   + Y
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 44. Allergen Name: Phl p 2 Sequence ID: P43214

 Score = 60.9 bits 277,  Expect = 2e-11
 Identities = 40/90 44%, Positives = 61/90 67%, Gaps = 2/90 2%
Query  169  KITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPL 228
            K+TF +EK SN  +LA+LVKY  GD  + EVE++E GS+EW A+ +  G +W  D+ +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY-EGD-TMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  229  KGPFSVRVTTEGGEKIIAEDAIPDGWKADSVY 260
            +GPF+ R  TE G K + +D +P+ +   + Y
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 45. Allergen Name: Lol p 2 Sequence ID: P14947

 Score = 58.8 bits 266,  Expect = 8e-11
 Identities = 40/91 43%, Positives = 59/91 64%, Gaps = 2/91 2%
Query  170  ITFHIEKASNPNYLALLVKYVAGDGD-VVEVEIKEKGSEEWKALKESWGAIWRIDTPKPL 228
            + F +EK S+   LAL +KY   +GD + EVE+KE GS EW ALK++   +W I + KPL
Sbjct  4    VEFTVEKGSDEKNLALSIKY-NKEGDSMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPL 62
Query  229  KGPFSVRVTTEGGEKIIAEDAIPDGWKADSVYK 261
            KGPF+ R  +E G + + +D +P  +K  + YK
Sbjct  63   KGPFNFRFVSEKGMRNVFDDVVPADFKVGTTYK 95

Sequence Alignment: 46. Allergen Name: Dac g 3 Sequence ID: P93124

 Score = 57.5 bits 259,  Expect = 2e-10
 Identities = 35/91 38%, Positives = 57/91 62%, Gaps = 1/91 1%
Query  169  KITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPL 228
            K+TF +EK S+P  L L +KY      + EVE+++ GSEEW+ L +  G +W + + KPL
Sbjct  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKPL 60
Query  229  KGPFSVRVTTEGGEKIIAEDAIPDGWKADSVY 260
             GPF+ R  ++GG + + ++ IP  +K  + Y
Sbjct  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92

Sequence Alignment: 47. Allergen Name: Phl p 3.0101 Sequence ID: 2JNZ_A

 Score = 55.4 bits 248,  Expect = 1e-09
 Identities = 33/92 35%, Positives = 56/92 60%, Gaps = 1/92 1%
Query  169  KITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPL 228
            ++TF ++K S+P  L L +KY      + EVE+++ GSEEW+ L +  G +W + + KPL
Sbjct  14   QVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPL 72
Query  229  KGPFSVRVTTEGGEKIIAEDAIPDGWKADSVYK 261
             GPF+ R  ++GG + + ++ IP  +     YK
Sbjct  73   VGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105

Sequence Alignment: 48. Allergen Name: Lol p 2 Sequence ID: CAA51775

 Score = 54.9 bits 245,  Expect = 1e-09
 Identities = 38/86 44%, Positives = 56/86 65%, Gaps = 2/86 2%
Query  172  FHIEKASNPNYLALLVKYVAGDGDVV-EVEIKEKGSEEWKALKESWGAIWRIDTPKPLKG 230
            F +EK S+   LAL +KY + +GD + EVE+KE GS EW ALK++   +W I + KPLKG
Sbjct  2    FTVEKGSDEKNLALSIKY-SKEGDAMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLKG 60
Query  231  PFSVRVTTEGGEKIIAEDAIPDGWKADS 258
            PF+ R  +E G   + +D +P  +K  +
Sbjct  61   PFNFRFVSEKGMWNVFDDVVPADFKVGT 88

Sequence Alignment: 49. Allergen Name: Dac g 1.0101 Sequence ID: Q7M1X8

 Score = 49.6 bits 217,  Expect = 2e-08
 Identities = 27/33 81%, Positives = 30/33 90%, Gaps = 0/33 0%
Query  25   PKVPPGPNITTSYGDKWLEAKATWYGAPKGAGP 57
            PKVPPGPNIT +YGDKWL+AK+TWYG P GAGP
Sbjct  2    PKVPPGPNITATYGDKWLDAKSTWYGKPTGAGP 34

Sequence Alignment: 50. Allergen Name: Lol p 3 Sequence ID: P14948

 Score = 50.7 bits 223,  Expect = 2e-08
 Identities = 31/92 33%, Positives = 53/92 57%, Gaps = 1/92 1%
Query  168  TKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKP 227
            TK+ + +EK S+   L L +KY      + EVE+++ GSEEW+ + +  G +W + + KP
Sbjct  1    TKVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKP 59
Query  228  LKGPFSVRVTTEGGEKIIAEDAIPDGWKADSVY 260
            L GP + R  ++GG K + ++ IP  +     Y
Sbjct  60   LTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTY 92

Sequence Alignment: 51. Allergen Name: Cyn d 15 Sequence ID: AAP80171

 Score = 49.2 bits 215,  Expect = 7e-08
 Identities = 35/89 39%, Positives = 61/89 68%, Gaps = 7/89 7%
Query  170  ITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLK 229
            I FH+E++S P + AL +K  A +  + +V+++E G++    + +S G  W ID  KPLK
Sbjct  22   IIFHVEESS-PKF-ALSIKDSAKE--ITQVDVREHGADNMDPMTKS-GDSWTID--KPLK 74
Query  230  GPFSVRVTTEGGEKIIAEDAIPDGWKADSVYKSNVQ 265
            GP+++R+  EGG   + +D IP+ WKA + Y + ++
Sbjct  75   GPLNIRLRAEGGGSRVQDDVIPENWKAGTDYPTKLH 110

Sequence Alignment: 52. Allergen Name: Tri a 3 Sequence ID: CAA90746

 Score = 47.0 bits 203,  Expect = 4e-07
 Identities = 29/92 31%, Positives = 52/92 56%, Gaps = 1/92 1%
Query  169  KITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPL 228
            K+ + ++K S+   LAL + Y   +  + EVE+++ GSEEW+ L +  G +W +   KPL
Sbjct  24   KVKLTVQKGSDKKKLALKIDYTRPNDSLSEVELRQYGSEEWQPLTKK-GDVWEVSCSKPL 82
Query  229  KGPFSVRVTTEGGEKIIAEDAIPDGWKADSVYK 261
             GPF+ R  ++ G K + ++     +K    Y+
Sbjct  83   VGPFNFRFLSKNGMKKVFDEVFSTDFKIGKTYE 115

Sequence Alignment: 53. Allergen Name: Ant o 1.0101 Sequence ID: Q7M1X6

 Score = 44.3 bits 189,  Expect = 6e-07
 Identities = 24/30 80%, Positives = 27/30 90%, Gaps = 0/30 0%
Query  26   KVPPGPNITTSYGDKWLEAKATWYGAPKGA 55
            KVPPGPNIT +YGDKWL+AK+TWYG P GA
Sbjct  3    KVPPGPNITATYGDKWLDAKSTWYGKPTGA 32

Sequence Alignment: 54. Allergen Name: Sor h 2.0201 Sequence ID: A0A077B2S0

 Score = 40.9 bits 171,  Expect = 2e-05
 Identities = 34/93 36%, Positives = 56/93 60%, Gaps = 6/93 6%
Query  168  TKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKA-LKESWGAIWRIDTPK 226
            T +T  + K S    L+L+   VA    + EV +K KG+ ++   LKES    + +D+ +
Sbjct  27   TTLTIEVGKDSTSTKLSLITN-VA----ISEVSVKPKGATDFTDDLKESEPKTFTLDSKE 81
Query  227  PLKGPFSVRVTTEGGEKIIAEDAIPDGWKADSVYKSNVQ 265
            P++GP + R   +GG   + ++AIP  +KA SVYK+  Q
Sbjct  82   PIEGPIAFRFLAKGGGYRVVDNAIPADFKAGSVYKTTEQ 120

Sequence Alignment: 55. Allergen Name: Sor h 2.0101 Sequence ID: A0A077B7S9

 Score = 40.8 bits 170,  Expect = 3e-05
 Identities = 35/93 37%, Positives = 53/93 56%, Gaps = 6/93 6%
Query  168  TKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKA-LKESWGAIWRIDTPK 226
            T +T+ I K S    L L+        DV EV +K+KG+ ++   LKES    +  ++ +
Sbjct  25   TLMTWTIGKDSTSTRLVLV-----ASADVSEVAVKDKGATDFSDDLKESPAKTFTYESKE 79
Query  227  PLKGPFSVRVTTEGGEKIIAEDAIPDGWKADSVYKSNVQ 265
            P+KGP+SVR   +G      +D IP  +K  SVYK+  Q
Sbjct  80   PIKGPLSVRFAVKGQGYRTTDDVIPADFKPGSVYKTKEQ 118

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.