The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN
GGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE
EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNP
NYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEG
GTKSEFEDVIPEGWKADTSYSAK
Sequence Info Allergen Name Length Opt Bits Score E Value
AAA63279 Lol p 1.0101 263 1819 376.8 4.2e-106
P14946 Lol p 1 263 1813 375.6 9.8e-106
CAB63699 Lol p 1.0103 263 1779 368.7 1.2e-103
AAA63278 Lol p 1.0102 252 1737 360.2 4e-101
Q41260 Pha a 1 269 1687 350.1 4.8e-98
P43216 Hol l 1 265 1682 349.1 9.5e-98
P43213 Phl p 1 263 1654 343.4 4.8e-96
CAA10520 Poa p a 263 1640 340.6 3.4e-95
CAA93121 Hol l 1.0102 248 1627 338.0 1.9e-94
CAA10140 Hol l 1 263 1626 337.7 2.4e-94
CAA81613 Phl p 1.0101 263 1584 329.2 8.8e-92
AAF72983 Ory s 1 267 1299 271.6 2.1e-74
AAF72991 Ory s 1 267 1239 259.4 9.3e-71
A0A4D6FZ45 Uro m 1.0101 262 1200 251.5 2.2e-68
AAL14077 Cyn d 1.0202 262 1200 251.5 2.2e-68
AAL14079 Cyn d 1.0203 262 1200 251.5 2.2e-68
AAL14078 Cyn d 1 262 1192 249.9 6.6e-68
AAK96255 Cyn d 1.0201 244 1178 247.1 4.3e-67
AAF80379 Cyn d 1.0204 244 1175 246.5 6.5e-67
ABC58726 Sor h 1.0101 239 1162 243.9 3.9e-66
A0A4D6G2J8 Uro m 1.0201 229 1152 241.9 1.5e-65
Q40638 Ory s 1 263 1146 240.6 4.2e-65
QCX36431 Zoy m 1.0101 272 1138 239.0 1.4e-64
ACA23876 Pas n 1.0101 265 1128 237.0 5.3e-64
O04701 Cyn d 1 246 1097 230.7 3.7e-62
P58738 Zea m 1 269 1090 229.3 1.1e-61
AAF72990 Ory s 1 269 1083 227.8 3e-61
AAF72987 Ory s 1 275 931 197.1 5.6e-52
AAF72984 Ory s 1 268 920 194.9 2.5e-51
AAF72985 Ory s 1 286 897 190.2 6.9e-50
AAB61710 Ory s 1 261 872 185.2 2.1e-48
AAF72989 Ory s 1 271 871 184.9 2.5e-48
AAD10496 Tri a ps93 271 856 181.9 2e-47
Q07154 Zea m 1 191 786 167.9 2.3e-43
AAF72988 Ory s 1 327 733 156.9 8.1e-40
AAA50175 Gly m 2 277 704 151.1 3.8e-38
AAF72986 Ory s 1 275 696 149.5 1.2e-37
CAB37496 Ara t expansin 265 430 95.7 1.8e-21
AAG13596 Ory s 1 275 372 83.9 6.3e-18
BAA85432 Ory s 1 284 362 81.9 2.7e-17
CAA10346 Cyn d 2 122 274 64.5 2e-12
CAA10345 Dac g 2 122 274 64.5 2e-12
CAA10348 Poa p 2 122 274 64.5 2e-12
P43214 Phl p 2 122 274 64.5 2e-12
Q7M1X8 Dac g 1.0101 34 236 57.4 7.5e-11
P14947 Lol p 2 97 239 57.5 2e-10
P93124 Dac g 3 96 237 57.1 2.6e-10
Q7M1X6 Ant o 1.0101 32 224 55.0 3.7e-10
CAA51775 Lol p 2 88 223 54.3 1.7e-09
AAP80171 Cyn d 15 112 218 53.2 4.6e-09
2JNZ_A Phl p 3.0101 108 212 52.0 1e-08
P14948 Lol p 3 97 197 49.0 7.2e-08
CAA90746 Tri a 3 118 169 43.3 4.8e-06
A0A077B7S9 Sor h 2.0101 119 134 36.2 0.00065
A0A077B2S0 Sor h 2.0201 121 124 34.2 0.0027
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 376.8 bits 1819,  Expect = 4e-106
 Identities = 263/263 100%, Positives = 263/263 100%, Gaps = 0/263 0%
Query  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
            MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN
Sbjct  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
            GGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE
Sbjct  61   GGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
Query  121  EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNP 180
            EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNP
Sbjct  121  EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNP 180
Query  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
            NYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEG
Sbjct  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
Query  241  GTKSEFEDVIPEGWKADTSYSAK 263
            GTKSEFEDVIPEGWKADTSYSAK
Sbjct  241  GTKSEFEDVIPEGWKADTSYSAK 263

Sequence Alignment: 2. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 375.6 bits 1813,  Expect = 1e-105
 Identities = 262/263 99%, Positives = 262/263 99%, Gaps = 0/263 0%
Query  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
            MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN
Sbjct  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
            GGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE
Sbjct  61   GGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
Query  121  EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNP 180
            EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNP
Sbjct  121  EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNP 180
Query  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
            NYLAILVKYVDGDGDVVAVDIKEKGKDKW ELKESWGAVWRIDTPDKLTGPFTVRYTTEG
Sbjct  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
Query  241  GTKSEFEDVIPEGWKADTSYSAK 263
            GTKSEFEDVIPEGWKADTSYSAK
Sbjct  241  GTKSEFEDVIPEGWKADTSYSAK 263

Sequence Alignment: 3. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 368.7 bits 1779,  Expect = 1e-103
 Identities = 257/263 97%, Positives = 259/263 98%, Gaps = 0/263 0%
Query  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
            MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN
Sbjct  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
            GGACGYK+VDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE
Sbjct  61   GGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
Query  121  EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNP 180
            EPIAPYHFDLSGHAFGSMAKKGEEQ +RSAGELELQFRRVKCKYPD TKPTFHVEKASNP
Sbjct  121  EPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNP 180
Query  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
            NYLAILVKYVDGDGDVVAVDIKEKGKDKW ELKESWGAVWRIDTPDKLTGPFTVRYTTEG
Sbjct  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
Query  241  GTKSEFEDVIPEGWKADTSYSAK 263
            GTKSE EDVIPEGWKADTSYSAK
Sbjct  241  GTKSEVEDVIPEGWKADTSYSAK 263

Sequence Alignment: 4. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 360.2 bits 1737,  Expect = 4e-101
 Identities = 248/252 98%, Positives = 249/252 98%, Gaps = 0/252 0%
Query  12   ALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKNVDK 71
            ALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYK+VDK
Sbjct  1    ALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDK 60
Query  72   APFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLS 131
            APFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLS
Sbjct  61   APFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLS 120
Query  132  GHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVD 191
            GHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEK SNPNYLAILVKYVD
Sbjct  121  GHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKGSNPNYLAILVKYVD 180
Query  192  GDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIP 251
            GDGDVVAVDIKEKGKDKW ELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSE EDVIP
Sbjct  181  GDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIP 240
Query  252  EGWKADTSYSAK 263
            EGWKADTSYSAK
Sbjct  241  EGWKADTSYSAK 252

Sequence Alignment: 5. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 350.1 bits 1687,  Expect = 5e-98
 Identities = 237/262 90%, Positives = 253/262 96%, Gaps = 0/262 0%
Query  2    ASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNG 61
            +SSSS+L+V AL+AVF+GSA+GIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNG
Sbjct  8    SSSSSLLVVAALLAVFVGSAQGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNG 67
Query  62   GACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEE 121
            GACGYK+VDKAPFNGMTGCGNTPIFKDGRGCGSCFE+KC+KPESCSGE +TV ITDDNEE
Sbjct  68   GACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFELKCSKPESCSGEPITVHITDDNEE 127
Query  122  PIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPN 181
            PIAPYHFDLSGHAFGSMAKKGEE+NVR AGELELQFRRVKCKYPD TKPTFHVEK SNPN
Sbjct  128  PIAPYHFDLSGHAFGSMAKKGEEENVRGAGELELQFRRVKCKYPDGTKPTFHVEKGSNPN 187
Query  182  YLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGG 241
            YLA+LVKYVDGDGDVVAVDIKEKGKDKW ELKESWGA+WRIDTPDKLTGPFTVRYTTEGG
Sbjct  188  YLALLVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGG 247
Query  242  TKSEFEDVIPEGWKADTSYSAK 263
            TK+EFEDVIPEGWKADT  ++K
Sbjct  248  TKAEFEDVIPEGWKADTHDASK 269

Sequence Alignment: 6. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 349.1 bits 1682,  Expect = 9e-98
 Identities = 242/263 92%, Positives = 252/263 95%, Gaps = 2/263 0%
Query  1    MASSS-SVLLVVA-LFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPK 58
            MASSS SVLL+VA LFAVFLGSAHGIAKVPPGPNITA YGD+WLDAKSTWYGKPTGAGPK
Sbjct  1    MASSSRSVLLLVAALFAVFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPK 60
Query  59   DNGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDD 118
            DNGGACGYK+VDK PF+GMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGE VTV ITDD
Sbjct  61   DNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEPVTVHITDD 120
Query  119  NEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKAS 178
            NEEPIAPYHFDLSGHAFGSMAKKGEEQ +RSAGELEL+FRRVKCKYPD TKPTFHVEK S
Sbjct  121  NEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGS 180
Query  179  NPNYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTT 238
            NPNYLA+LVKY+DGDGDVVAVDIKEKGKDKW ELKESWGAVWR+DTPDKLTGPFTVRYTT
Sbjct  181  NPNYLALLVKYIDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTT 240
Query  239  EGGTKSEFEDVIPEGWKADTSYSAK 263
            EGGTK E EDVIPEGWKADT+Y AK
Sbjct  241  EGGTKGEAEDVIPEGWKADTAYEAK 265

Sequence Alignment: 7. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 343.4 bits 1654,  Expect = 5e-96
 Identities = 235/263 89%, Positives = 248/263 94%, Gaps = 0/263 0%
Query  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
            MASSSSVLLVV LFAVFLGSA+GI KVPPGPNITA YGDKWLDAKSTWYGKPTGAGPKDN
Sbjct  1    MASSSSVLLVVVLFAVFLGSAYGIPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
            GGACGYK+VDK PF+GMTGCGNTPIFK GRGCGSCFEIKCTKPE+CSGE V V ITDDNE
Sbjct  61   GGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNE 120
Query  121  EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNP 180
            EPIAPYHFDLSGHAFG+MAKKG+EQ +RSAGELELQFRRVKCKYP+ TK TFHVEK SNP
Sbjct  121  EPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNP 180
Query  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
            NYLA+LVKYV+GDGDVVAVDIKEKGKDKW ELKESWGA+WRIDTPDKLTGPFTVRYTTEG
Sbjct  181  NYLALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEG 240
Query  241  GTKSEFEDVIPEGWKADTSYSAK 263
            GTK+E EDVIPEGWKADTSY +K
Sbjct  241  GTKTEAEDVIPEGWKADTSYESK 263

Sequence Alignment: 8. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 340.6 bits 1640,  Expect = 3e-95
 Identities = 233/263 88%, Positives = 248/263 94%, Gaps = 0/263 0%
Query  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
            MASSSSVLLVVALFAVFLG+AHGIAKVPPGPNITA YGDKWLDAKSTWYGKPTGAGPKDN
Sbjct  1    MASSSSVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
            GGACGYK+VDKAPF+GMTGCGNTPIFK GRGCGSCFEIKCTKPESCSGE V V ITDDNE
Sbjct  61   GGACGYKDVDKAPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPVLVHITDDNE 120
Query  121  EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNP 180
            EPIA YHFDLSG AFG+MAKKGEEQ +RSAGELEL+FRRVKC+YP+ TK TFHVEK SNP
Sbjct  121  EPIAAYHFDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPEGTKVTFHVEKGSNP 180
Query  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
            NYLA+LVKYV GDGDVVAVDIKEKGKDKW ELKESWG++WR+DTPDKLTGPFTVRYTTEG
Sbjct  181  NYLALLVKYVTGDGDVVAVDIKEKGKDKWIELKESWGSIWRVDTPDKLTGPFTVRYTTEG 240
Query  241  GTKSEFEDVIPEGWKADTSYSAK 263
            GTK E EDVIPEGWKADT+Y++K
Sbjct  241  GTKGEAEDVIPEGWKADTAYASK 263

Sequence Alignment: 9. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 338.0 bits 1627,  Expect = 2e-94
 Identities = 227/248 91%, Positives = 237/248 95%, Gaps = 0/248 0%
Query  16   VFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKNVDKAPFN 75
            VFLGSAHGIAKVPPGPNITA YGD+WLDAKSTWYGKPTGAGPKDNGGACGYK+VDK PF+
Sbjct  1    VFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFS 60
Query  76   GMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAF 135
            GMTGCGNTPIFKDGRGCGSCFEIKC+KPESCSGE VTV ITDDNEEPIAPYHFDLSGHAF
Sbjct  61   GMTGCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAF 120
Query  136  GSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGD 195
            GSMAKKGEEQ +RSAGELEL+FRRVKCKYPD TKPTFHVEK SNPNYLA+LVKY+DGDGD
Sbjct  121  GSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGD 180
Query  196  VVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWK 255
            VVAVDIKEKGKDKW ELKESWGAVWR+DTPDKLTGPFTVRYTTEGGTK E EDVIPEGWK
Sbjct  181  VVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWK 240
Query  256  ADTSYSAK 263
            ADT+Y AK
Sbjct  241  ADTAYEAK 248

Sequence Alignment: 10. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 337.7 bits 1626,  Expect = 2e-94
 Identities = 232/263 88%, Positives = 245/263 93%, Gaps = 0/263 0%
Query  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
            MASSS VLLVVALFAVFLG+AHGIAKVPPGPNITA YGDKWLDAKSTWYGKPTGAGPKDN
Sbjct  1    MASSSLVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
            GGACGYK+VDK PF+GMTGCGNTPIFK GRGCGSCFEIKCTKPESCSGE + V ITDDNE
Sbjct  61   GGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPIVVHITDDNE 120
Query  121  EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNP 180
            EPIA YH+DLSG AFG+MAKKGEEQ +RSAGELEL+FRRVKC+YP  TK TFHVEK SNP
Sbjct  121  EPIAAYHLDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPKGTKVTFHVEKGSNP 180
Query  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
            NYLA+LVKYVDGDGDVVAVDIKEKGKDKW ELKESWGAVWR+DTPDKLTGPFTVRYTTEG
Sbjct  181  NYLALLVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEG 240
Query  241  GTKSEFEDVIPEGWKADTSYSAK 263
            GTK E EDVIPEGWKADT+Y +K
Sbjct  241  GTKVEAEDVIPEGWKADTAYESK 263

Sequence Alignment: 11. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 329.2 bits 1584,  Expect = 9e-92
 Identities = 226/263 85%, Positives = 241/263 91%, Gaps = 0/263 0%
Query  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
            MASSSSVLLVVALFAVFLGSAHGI KVPPGPNITA YGDKWLDAKSTWYGKPT AGPKDN
Sbjct  1    MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYGKPTAAGPKDN 60
Query  61   GGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
            GGACGYK+VDK PF+GMTGCGNTPIFK GRGCGSCFEIKCTKPE+CSGE V V ITDDNE
Sbjct  61   GGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNE 120
Query  121  EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNP 180
            EPIA YHFDLSG AFGSMAKKG+EQ +RSAGE+E+QFRRVKCKYP+ TK TFHVEK SNP
Sbjct  121  EPIAAYHFDLSGIAFGSMAKKGDEQKLRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNP 180
Query  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
            NYLA+LVK+V GDGDVVAVDIKEKGKDKW  LKESWGA+WRIDTP+ L GPFTVRYTTEG
Sbjct  181  NYLALLVKFVAGDGDVVAVDIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEG 240
Query  241  GTKSEFEDVIPEGWKADTSYSAK 263
            GTK E +DVIPEGWKADT+Y +K
Sbjct  241  GTKGEAKDVIPEGWKADTAYESK 263

Sequence Alignment: 12. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 271.6 bits 1299,  Expect = 2e-74
 Identities = 180/262 68%, Positives = 211/262 80%, Gaps = 0/262 0%
Query  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
            MASSS +L  V + A+    + G  KVPPGPNIT  YGDKWL+AK+TWYG P GAGPKDN
Sbjct  1    MASSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDN 60
Query  61   GGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
            GGACGYK+VDKAPF GM  CGN PIFKDG+GCGSCFEIKC+KPE+CS +   + +TD N+
Sbjct  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
Query  121  EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNP 180
            EPIA YHFDLSG AFG+MAK G+++ +R AG ++ QFRRVKCKYP DTK TFH+EKASNP
Sbjct  121  EPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 180
Query  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
            NYLA+LVKYV GDGDVV V+IKEKG ++W  LKESWGA+WRIDTP  L GPF+VR TTEG
Sbjct  181  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 240
Query  241  GTKSEFEDVIPEGWKADTSYSA 262
            G K   ED IP+GWKAD+ Y +
Sbjct  241  GEKIIAEDAIPDGWKADSVYKS 262

Sequence Alignment: 13. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 259.4 bits 1239,  Expect = 9e-71
 Identities = 168/263 63%, Positives = 206/263 78%, Gaps = 0/263 0%
Query  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
            MASS  +L  V   A+    + G  KVPPGPNITA YG +WL+A+ TWYGKP GAGP DN
Sbjct  1    MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDN 60
Query  61   GGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
            GGACGYK++DKAPF GM  CGN PIFKDG+GCGSCFE+KC+KPE+CS + V + ITD N 
Sbjct  61   GGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNT 120
Query  121  EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNP 180
            EPIA YHFDLSGHAFG+MAK+G+++ +R AG +++QFRRV+CKYP +TK TFHVEK SNP
Sbjct  121  EPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNP 180
Query  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
            NY+A+LVKYV GDGDVV V++KEKG ++W  L ESWGA+WRIDTP  L GPF++R TTE 
Sbjct  181  NYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTES 240
Query  241  GTKSEFEDVIPEGWKADTSYSAK 263
              K    DVIP+ WKA+  Y ++
Sbjct  241  DQKLVANDVIPDNWKANALYKSE 263

Sequence Alignment: 14. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 251.5 bits 1200,  Expect = 2e-68
 Identities = 172/257 66%, Positives = 199/257 77%, Gaps = 2/257 0%
Query  7    VLLVVAL-FAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGAC 64
            +L VVA+ +A  +G A       PGPNITA YGDKWLDAK+T+YG  P GA P D+GGAC
Sbjct  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  65   GYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIA 124
            GYK+VDKAPF+ MTGCGN PIFKDG GCGSC+EIKC +P  CSGE V + ITD N E IA
Sbjct  61   GYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  125  PYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLA 184
             YHFDLSG AFG+MAKKGEE  +R AGEL LQFRRVKC+YP DTK  FHVEK SNPNYLA
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  185  ILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKS 244
            +LVKY  GDG++V+VDIK KG D++  +K+SWGA+WRID P  L GPFT+R T+E G   
Sbjct  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
Query  245  EFEDVIPEGWKADTSYSAK 263
            E EDVIPE WK DT Y +K
Sbjct  241  EQEDVIPEDWKPDTVYKSK 259

Sequence Alignment: 15. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 251.5 bits 1200,  Expect = 2e-68
 Identities = 172/257 66%, Positives = 199/257 77%, Gaps = 2/257 0%
Query  7    VLLVVAL-FAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGAC 64
            +L VVA+ +A  +G A       PGPNITA YGDKWLDAK+T+YG  P GA P D+GGAC
Sbjct  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  65   GYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIA 124
            GYK+VDKAPF+GMTGCGN PIFKDG  CGSC+EIKC +P  CSGE V + ITD N E IA
Sbjct  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  125  PYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLA 184
             YHFDLSG AFG+MAKKGEE  +R AGEL LQFRRVKC+YP DTK  FHVEK SNPNYLA
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  185  ILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKS 244
            +LVKY  GDG++V+VDIK KG D++  +K+SWGA+WRID P  L GPFT+R T+E G   
Sbjct  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
Query  245  EFEDVIPEGWKADTSYSAK 263
            E EDVIPE WK DT Y +K
Sbjct  241  EQEDVIPEDWKPDTVYKSK 259

Sequence Alignment: 16. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 251.5 bits 1200,  Expect = 2e-68
 Identities = 172/257 66%, Positives = 199/257 77%, Gaps = 2/257 0%
Query  7    VLLVVAL-FAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGAC 64
            +L VVA+ +A  +G A       PGPNITA YGDKWLDAK+T+YG  P GA P D+GGAC
Sbjct  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  65   GYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIA 124
            GYK+VDKAPF+ MTGCGN PIFKDG GCGSC+EIKC +P  CSGE V + ITD N E IA
Sbjct  61   GYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  125  PYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLA 184
             YHFDLSG AFG+MAKKGEE  +R AGEL LQFRRVKC+YP DTK  FHVEK SNPNYLA
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  185  ILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKS 244
            +LVKY  GDG++V+VDIK KG D++  +K+SWGA+WRID P  L GPFT+R T+E G   
Sbjct  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
Query  245  EFEDVIPEGWKADTSYSAK 263
            E EDVIPE WK DT Y +K
Sbjct  241  EQEDVIPEDWKPDTVYKSK 259

Sequence Alignment: 17. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 249.9 bits 1192,  Expect = 7e-68
 Identities = 169/254 66%, Positives = 194/254 76%, Gaps = 1/254 0%
Query  10   VVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKN 68
            V  ++A  +G A       PGPNITA YGDKWLDAK+T+YG  P GA P D+GGACGYK+
Sbjct  5    VAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKD 64
Query  69   VDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHF 128
            VDKAPF+GMTGCGN PIFKDG GCGSC+EIKC +P  CSGE V + ITD N E IA YHF
Sbjct  65   VDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHF 124
Query  129  DLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVK 188
            DLSG AFG+MAKKGEE  +R AGEL LQFRRVKC+YP DTK TFHVEK S+PNYLA+LVK
Sbjct  125  DLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVK 184
Query  189  YVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFED 248
            Y  GDG++V VDIK KG D +  +K SWGA+WR+D P  L GPFT+R T+E G   E ED
Sbjct  185  YAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQED 244
Query  249  VIPEGWKADTSYSAK 263
            VIPE WK DT Y +K
Sbjct  245  VIPEDWKPDTVYKSK 259

Sequence Alignment: 18. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 247.1 bits 1178,  Expect = 4e-67
 Identities = 163/235 69%, Positives = 187/235 79%, Gaps = 1/235 0%
Query  29   PGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFK 87
            PGPNITA YGDKWLDAK+T+YG  P GA P D+GGACGYK+VDKAPF+GMTGCGN PIFK
Sbjct  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
Query  88   DGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNV 147
            DG  CGSC+EIKC +P  CSGE V + ITD N E IA YHFDLSG AFG+MAKKGEE  +
Sbjct  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
Query  148  RSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKD 207
            R AGEL LQFRRVKC+YP DTK  FHVEK S+PNYLA+LVKY  GDG++V VDIK KG D
Sbjct  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
Query  208  KWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSYSAK 263
            ++  +K+SWGA+WRID P  L GPFT+R T+E G   E +DVIPE WK DT Y +K
Sbjct  186  EFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSK 241

Sequence Alignment: 19. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 246.5 bits 1175,  Expect = 7e-67
 Identities = 162/235 68%, Positives = 187/235 79%, Gaps = 1/235 0%
Query  29   PGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFK 87
            PGPNITA YGDKWLDAK+T+YG  P GA P D+GGACGYK+VDKAPF+GMTGCGN PIFK
Sbjct  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
Query  88   DGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNV 147
            DG  CGSC+EIKC +P  CSGE V + ITD N E IA YHFDLSG AFG+MAKKGEE  +
Sbjct  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
Query  148  RSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKD 207
            R AGEL LQFRRVKC+YP DTK  FHVEK S+PNYLA+LVKY  GDG++V VDIK KG D
Sbjct  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
Query  208  KWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSYSAK 263
            ++  +K+SWGA+WR+D P  L GPFT+R T+E G   E +DVIPE WK DT Y +K
Sbjct  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSK 241

Sequence Alignment: 20. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 243.9 bits 1162,  Expect = 4e-66
 Identities = 166/235 70%, Positives = 193/235 82%, Gaps = 5/235 2%
Query  26   KVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPI 85
            KV  G NIT  YG  WL+ K+TWYGKPTGAGP DNGGACGYK+V+KAPFN M  CGN PI
Sbjct  3    KVAKGKNITETYGSDWLERKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNLPI 62
Query  86   FKDGRGCGSCFEIKCTKPES--CSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGE 143
            FKDG  CGSCFEIKC KP+   CSGEAV V ITD N E IA YHFDL+GHAFG+MAKKG+
Sbjct  63   FKDGL-CGSCFEIKCDKPKPAECSGEAVVVHITDMNYEQIAAYHFDLAGHAFGAMAKKGQ 121
Query  144  EQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKE 203
            E+ +  AG ++++FRRVKCKY +  K TFHVEK SNPNYLA+LVKYVDGDGD+V VDIKE
Sbjct  122  EEKLAKAGIIDMKFRRVKCKYGE--KVTFHVEKGSNPNYLALLVKYVDGDGDIVGVDIKE 179
Query  204  KGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSYSAK 263
            KG D +  LK SWGA+WR D+PD +  P TV+ TTEGGTK+ ++DVIPEGWKADT+Y+AK
Sbjct  180  KGGDAYQPLKHSWGAIWRKDSPDPIKFPVTVQITTEGGTKTAYDDVIPEGWKADTTYTAK 239

Sequence Alignment: 21. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 241.9 bits 1152,  Expect = 2e-65
 Identities = 156/224 69%, Positives = 182/224 81%, Gaps = 0/224 0%
Query  40   KWLDAKSTWYGKPTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIK 99
            KWLDAK+TWYGKPTGAGP DNGGACGYK+V+KAPFN M  CGN PIFKDG GCGSC+EIK
Sbjct  3    KWLDAKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNPPIFKDGLGCGSCYEIK 62
Query  100  CTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRR 159
            C KP  CSGE V V ITD N EPIA YHFDL+G AFG+MAKKGEE+ +R AG +++QFRR
Sbjct  63   CDKPAECSGEPVIVHITDQNYEPIAAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQFRR 122
Query  160  VKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAV 219
            VKCKYP +TK  FHVEK  NPNY+A+L+KY  GDGD+VAVDIKEKG +++  LK SWGA+
Sbjct  123  VKCKYPANTKIAFHVEKGCNPNYFALLIKYAAGDGDIVAVDIKEKGSEEFIPLKHSWGAI 182
Query  220  WRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSYSAK 263
            WRID+P  + GP  VR T+EGGT    +D IPEGWKADT Y++K
Sbjct  183  WRIDSPKPIKGPIAVRLTSEGGTTLVQDDAIPEGWKADTVYTSK 226

Sequence Alignment: 22. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 240.6 bits 1146,  Expect = 4e-65
 Identities = 164/249 65%, Positives = 193/249 77%, Gaps = 3/249 1%
Query  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
            MASSS +L  V + A+   S  G  KVPPGPNIT  YGDKWL+A+     +P    PKDN
Sbjct  1    MASSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDN 60
Query  61   GGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
            GGACGYK+VDKAPF GM  CGN PIFKDG+GCGSCFEIKC+KPE+CS +   + +TD N+
Sbjct  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
Query  121  EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNP 180
            EPIA YHFDLSG A   MAK G+++ +R AG ++ QFRRVKCKYP DTK TFH+EKASNP
Sbjct  121  EPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 177
Query  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
            NYLA+LVKYV GDGDVV V+IKEKG ++W  LKESWGA+WRIDTP  L GPF+VR TTEG
Sbjct  178  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 237
Query  241  GTKSEFEDVIPE 252
              +S  ED IP+
Sbjct  238  ARRSSAEDAIPD 249

Sequence Alignment: 23. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 239.0 bits 1138,  Expect = 1e-64
 Identities = 168/262 64%, Positives = 197/262 75%, Gaps = 6/262 2%
Query  1    MASSSS-----VLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGK-PTG 54
            MASSS+     +  V  L++  +GSA       PGPNITA Y ++W DAK+T+YG  P G
Sbjct  1    MASSSARRQAQLAAVAVLLSAMVGSALCEIGDKPGPNITATYNEEWQDAKATFYGSNPRG 60
Query  55   AGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVT 114
            A P D+GGACGYKNVDKAPF GMTGCGN PIFKDG GCGSCFEIKC +P  CS + V + 
Sbjct  61   AAPDDDGGACGYKNVDKAPFFGMTGCGNEPIFKDGLGCGSCFEIKCKEPAECSDKPVLIR 120
Query  115  ITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHV 174
            ITD N E IA YHFDLSG AFGSMAK+G+E N+R AGEL LQFRRVKC+YP  TK TFHV
Sbjct  121  ITDKNYEHIAAYHFDLSGKAFGSMAKQGQEDNLRKAGELTLQFRRVKCEYPSKTKITFHV 180
Query  175  EKASNPNYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTV 234
            EK  N NYLA+LV+Y  GDGD+VAVDIK KG D++  +K SWGA+WRID    L GPFTV
Sbjct  181  EKGCNDNYLALLVEYAAGDGDIVAVDIKPKGSDEFLPMKPSWGAIWRIDPKKPLKGPFTV 240
Query  235  RYTTEGGTKSEFEDVIPEGWKADTSYSA 262
            R T+E G K   EDVIP  WK +T+Y++
Sbjct  241  RLTSESGAKLVQEDVIPADWKPNTAYTS 268

Sequence Alignment: 24. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 237.0 bits 1128,  Expect = 5e-64
 Identities = 157/260 60%, Positives = 194/260 74%, Gaps = 3/260 1%
Query  1    MASSSSVLLVVALFAVFL-GSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKD 59
            M S + ++ V A++A ++ G + G  KVPPGPNIT  Y  KWL AK+TWYG+P GAGP D
Sbjct  1    MGSLAKIVAVAAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLPAKATWYGQPNGAGPDD 60
Query  60   NGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDN 119
            NGGACG KNV+  P+NG T CGN PIFKDG+GCGSC+EI+C KPE CSG+ VTV ITD N
Sbjct  61   NGGACGIKNVNLPPYNGFTACGNPPIFKDGKGCGSCYEIRCNKPE-CSGQPVTVFITDMN 119
Query  120  EEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASN 179
             EPIAPYHFDLSG AFG+MAK G    +R  G ++L+FRRV+CKY    K  FHVEK SN
Sbjct  120  YEPIAPYHFDLSGKAFGAMAKPGLNDKLRHYGIFDLEFRRVRCKYQGGQKIVFHVEKGSN 179
Query  180  PNYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTE 239
            PNYLA+LVK+V  DGD+V +++KEK  D W  +K SWGA+WR+DTP  L  PF++R T+E
Sbjct  180  PNYLAMLVKFVADDGDIVLMELKEKSSD-WKPMKLSWGAIWRMDTPKALVPPFSIRLTSE 238
Query  240  GGTKSEFEDVIPEGWKADTSYSA 262
             G K   +DVIP  WK DT Y++
Sbjct  239  SGKKVIAQDVIPVNWKPDTVYNS 261

Sequence Alignment: 25. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 230.7 bits 1097,  Expect = 4e-62
 Identities = 152/235 64%, Positives = 181/235 77%, Gaps = 1/235 0%
Query  29   PGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFK 87
            PGPNITA YG KWL+A++T+YG  P GA P D+GGACGYK+VDK PF+GMT CGN PIFK
Sbjct  6    PGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFK 65
Query  88   DGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNV 147
            DG GC +C+EIKC +P  CSGE V V ITD N E IA YHFDLSG AFG+MAKKG+E  +
Sbjct  66   DGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL 125
Query  148  RSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKD 207
            R AGEL LQFRRVKCKYP  TK TFH+EK SN +YLA+LVKY  GDG++VAVDIK +  D
Sbjct  126  RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD 185
Query  208  KWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSYSAK 263
            ++  +K SWGA+WRID    L GPF++R T+EGG     +DVIP  WK DT Y++K
Sbjct  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSK 241

Sequence Alignment: 26. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 229.3 bits 1090,  Expect = 1e-61
 Identities = 147/257 57%, Positives = 192/257 74%, Gaps = 3/257 1%
Query  5    SSVLLVVALFAVFL-GSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGA 63
            +++++V A++A ++ G + G  KVPPGPNIT  Y  KWL A++TWYG+P GAG  DNGGA
Sbjct  6    NNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAPDNGGA 65
Query  64   CGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCT-KPESCSGEAVTVTITDDNEEP 122
            CG KNV+  P++GMT CGN PIFKDG+GCGSC+E++C  KPE CSG  VTV ITD N EP
Sbjct  66   CGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVYITDMNYEP 124
Query  123  IAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNY 182
            IAPYHFDLSG AFGS+AK G    +R  G ++++FRRV+CKYP   K  FH+EK  NPNY
Sbjct  125  IAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNY 184
Query  183  LAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGT 242
            LA+LVKYV  DGD+V ++I++K   +W  +K SWGA+WR+DT   L GPF++R T+E G 
Sbjct  185  LAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGK 244
Query  243  KSEFEDVIPEGWKADTSYSA 262
            K   +DVIP  W+ D  Y++
Sbjct  245  KVIAKDVIPANWRPDAVYTS 264

Sequence Alignment: 27. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 227.8 bits 1083,  Expect = 3e-61
 Identities = 146/257 56%, Positives = 186/257 72%, Gaps = 1/257 0%
Query  4    SSSVLLVVALFAVFLGSAH-GIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGG 62
            +++++L VA+ A ++G    G  KVPPGPNIT  Y   WL A++TWYG+P G+G  DNGG
Sbjct  5    TTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGSTDNGG 64
Query  63   ACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEP 122
            ACG KNV+  P+NGM  CGN PIFKDGRGCGSC+E+KC +P +CS + VTV ITD N EP
Sbjct  65   ACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEP 124
Query  123  IAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNY 182
            I+ YHFD+SG AFG+MA  G+E  +R AG +++QFRRV+CKYP   K TFHVEK SNPNY
Sbjct  125  ISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNY 184
Query  183  LAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGT 242
            LA+LVK+V  DGDV+ +D++E G   W  +K SWGA+WR+DT   L  PF++R TTE G 
Sbjct  185  LAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGK 244
Query  243  KSEFEDVIPEGWKADTSY 260
                +DVIP  W  D  Y
Sbjct  245  SLIAKDVIPVNWMPDAIY 262

Sequence Alignment: 28. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 197.1 bits 931,  Expect = 6e-52
 Identities = 132/253 52%, Positives = 179/253 70%, Gaps = 12/253 4%
Query  5    SSVLLVVALFAVFLGSAHGIAKVPP-GPNIT--AEYGDKWLDAKSTWYGKPTGAGPKDNG 61
            S V  ++A+++V++   HG  K  P   N++  + YG  WL A++TWYG PTGAGP DNG
Sbjct  7    SKVAAILAILSVLV--VHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPDDNG 64
Query  62   GACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEE 121
            GACG+KNV++ PF+ MT CGN PIFKDG+GCGSC++I+C K  SCSG   TV ITD N  
Sbjct  65   GACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYY 124
Query  122  PIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPN 181
            P+A YHFDLSG AFG+MAK G    +R +G +++QFRRV C YP   K  FHVE+ SNP 
Sbjct  125  PVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPG-LKINFHVEEGSNPV 183
Query  182  YLAILVKYVDGDGDVVAVDIKEK------GKDKWTELKESWGAVWRIDTPDKLTGPFTVR 235
            Y+A+LV+Y D DGDVV VD+ E           WT ++ESWG++WR+D+  +L  PF++R
Sbjct  184  YFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLR 243
Query  236  YTTEGGTKSEFEDVIPEGWKADTSY 260
              ++ G      +VIP  W  +++Y
Sbjct  244  IRSDSGKTLVANNVIPANWSPNSNY 268

Sequence Alignment: 29. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 194.9 bits 920,  Expect = 3e-51
 Identities = 126/242 52%, Positives = 171/242 70%, Gaps = 5/242 2%
Query  10   VVALFAVFLGSAHGIAKVPPGPNITAEY-GD-KWLDAKSTWYGKPTGAGPKDNGGACGYK 67
            V ALF+ ++ +   +A   PG    +++  D  W  A++TWYG PTGAGP D+GGACG+K
Sbjct  11   VAALFSFLVVTC--VAGARPGNFSASDFTADPNWEVARATWYGAPTGAGPDDDGGACGFK 68
Query  68   NVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYH 127
            N ++ PF+ MT CGN PIFKDG+GCGSC++I+C    +CSG   TV ITD N  P++ YH
Sbjct  69   NTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKYH 128
Query  128  FDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILV 187
            FDLSG AFG+MAK G+   +R AG +++QF+RV C +P   K TFHVE+ SNP Y+A+LV
Sbjct  129  FDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPG-LKVTFHVEEGSNPVYFAVLV 187
Query  188  KYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFE 247
            +Y DGDGDVV VD+ E     WT ++ESWG++WR+D+  +LT PF++R T E G +    
Sbjct  188  EYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVAS 247
Query  248  DVIPEGW 254
             VIP  W
Sbjct  248  QVIPANW 254

Sequence Alignment: 30. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 190.2 bits 897,  Expect = 7e-50
 Identities = 120/225 53%, Positives = 161/225 71%, Gaps = 7/225 3%
Query  35   AEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGS 94
            A Y   W  A++TWYG+P GAGP DNGGACG+K+ ++ PF  MT CGN P+FKDG+GCGS
Sbjct  49   AVYWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGS 108
Query  95   CFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELE 154
            C++I+CTK +SCSG + TV ITD N  P+AP+HFDLSG AFG +AK G    +R +G ++
Sbjct  109  CYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIID 168
Query  155  LQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGK------DK 208
            ++F RV C++P   K  FHVE+ SNP Y+A+LV+Y DGDGDVV VD+ E          K
Sbjct  169  IEFTRVPCEFPG-LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGK 227
Query  209  WTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSY 260
            WT ++ESWG++WR+DT  +L  PF++R   E G      +VIP  W+ +T Y
Sbjct  228  WTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFY 279

Sequence Alignment: 31. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 185.2 bits 872,  Expect = 2e-48
 Identities = 125/249 50%, Positives = 174/249 69%, Gaps = 18/249 7%
Query  2    ASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNG 61
            AS+  V ++++++A + G A G+            Y + WL AK+TWYG+P GAGP DNG
Sbjct  4    ASAKVVAMLLSVLATY-GFAAGVV-----------YTNDWLPAKATWYGQPNGAGPDDNG 51
Query  62   GACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEE 121
            GACG+KN ++ PF  MT CGN P+F+DG+GCG+C++I+CT   SCSG+  TV ITD N  
Sbjct  52   GACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNYY 111
Query  122  PIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPN 181
            P+A YHFDLSG AFG+MA+ G    +R AG +++QFRRV C Y       FHVE  SNP 
Sbjct  112  PVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRVPC-YHRGLYVNFHVEAGSNPV 170
Query  182  YLAILVKYVDGDGDVVAVDIKEK---GKDK--WTELKESWGAVWRIDTPDKLTGPFTVRY 236
            YLA+LV++ + DG VV +D+ E    GK    WT ++ SWG++WR+D   +L GP ++R 
Sbjct  171  YLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRM 230
Query  237  TTEGGTKSEFEDVIPEGWKADTSYSAK 263
             +E G       VIP  W+A+T+Y +K
Sbjct  231  VSESGQTVIAHQVIPANWRANTNYGSK 257

Sequence Alignment: 32. Allergen Name: Ory s 1 Sequence ID: AAF72989

 Score = 184.9 bits 871,  Expect = 2e-48
 Identities = 115/219 52%, Positives = 157/219 71%, Gaps = 3/219 1%
Query  41   WLDAKSTWYGKPTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKC 100
            W +AK+TWYG+P GAG  DNGGACG+K V++ PF GMT CGN P++K G+GCGSC+ ++C
Sbjct  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRC 102
Query  101  TKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRV 160
             +  +CSG A TV ITD N  P++ YHFDLSG AFG +AK G   ++R AG +++QF RV
Sbjct  103  NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARV 162
Query  161  KCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKD--KWTELKESWGA 218
             C++P   K  FHVE+ S+P YLA+LV+Y +GDGDV  VD+KE G    +WT ++ESWG+
Sbjct  163  PCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGS 221
Query  219  VWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSY 260
            VWR+D+  +L  PF++R  ++ G      DVIP  W  +T Y
Sbjct  222  VWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFY 263

Sequence Alignment: 33. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 181.9 bits 856,  Expect = 2e-47
 Identities = 123/254 48%, Positives = 172/254 67%, Gaps = 9/254 3%
Query  4    SSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGA 63
            SS+ + +VAL+++++ S    + V     +   Y   WL AK+TWYG P GAGP DNGGA
Sbjct  5    SSNAIALVALLSMLFTSVR--SAVNYDTAVARSYTSGWLPAKATWYGAPNGAGPDDNGGA 62
Query  64   CGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKC--TKPESCSGEAVTVTITDDNEE 121
            CG+KNV++ P + M  CGN PIF  G GCG C+EIKC  +   SCSG+   + ITD N  
Sbjct  63   CGFKNVNQYPISSMGACGNEPIFAGGEGCGMCYEIKCEYSNNPSCSGQPRRIVITDMNYY 122
Query  122  PIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPN 181
            P+A YH+DLSG AFGSMAK G    +R AG +++QFRRV C +P   K TFHV++ SNPN
Sbjct  123  PVARYHLDLSGTAFGSMAKYGLNDRLRHAGIIDMQFRRVPCNFPG-MKVTFHVQRGSNPN 181
Query  182  YLAILVKYVDGDGDVVAVDIKE--KGKDK--WTELKESWGAVWRIDTPDKLTGPFTVRYT 237
            YLA+LV+YV+ DG VV +++ +   G+    W +++ SWG+VWR+DT   + GPF++R T
Sbjct  182  YLAVLVEYVNVDGTVVRMELMQTMNGRPTGYWQDMRRSWGSVWRMDTNRPVQGPFSIRIT 241
Query  238  TEGGTKSEFEDVIPEGWKADTSY 260
            ++ G      + IP  W+ D +Y
Sbjct  242  SDTGKTLVANNAIPAYWQQDHAY 264

Sequence Alignment: 34. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 167.9 bits 786,  Expect = 2e-43
 Identities = 105/185 56%, Positives = 137/185 74%, Gaps = 2/185 1%
Query  77   MTGCGNTPIFKDGRGCGSCFEIKCT-KPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAF 135
            MT CGN PIFKDG+GCGSC+E++C  KPE CSG  VTV ITD N EPIAPYHFDLSG AF
Sbjct  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVFITDMNYEPIAPYHFDLSGKAF 59
Query  136  GSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGD 195
            GS+AK G    +R  G ++++FRRV+CKYP   K  FH+EK  NPNY+A+LVK+V  DGD
Sbjct  60   GSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGD 119
Query  196  VVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWK 255
            +V ++I++K   +W  +K SWGA+WR+DT   L GPF++R T+E G K   +D+IP  W+
Sbjct  120  IVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWR 179
Query  256  ADTSYSA 262
             D  Y++
Sbjct  180  PDAVYTS 186

Sequence Alignment: 35. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 156.9 bits 733,  Expect = 8e-40
 Identities = 127/224 56%, Positives = 163/224 72%, Gaps = 11/224 4%
Query  38   GDKWLDAKSTWYGKPTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFE 97
            G  WL+A++TWYG P GAGP DNGGACG+KNV+  PF+ MT CGN P+FKDG+GCGSC++
Sbjct  89   GGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQ 148
Query  98   IKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQF 157
            I+C    +CSG   TV ITD N  P++ YHFDLSG AFG+MAK      +R AG +++QF
Sbjct  149  IRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQF 208
Query  158  RRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEK-----GKDK---- 208
            RRV C+YP  T  TFHVE+ SNP Y+AILV+Y +GDGDVV VD+ E      G D     
Sbjct  209  RRVPCQYPGLTV-TFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTG 267
Query  209  -WTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSYSA 262
             WT ++ESWG++WR+DT   L GPF++R T E G     + VIP  W+ +T YS+
Sbjct  268  VWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSS 322

Sequence Alignment: 36. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 151.1 bits 704,  Expect = 4e-38
 Identities = 108/252 42%, Positives = 157/252 62%, Gaps = 12/252 4%
Query  5    SSVLLVVALFAVFL---GSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNG 61
            S +L ++A++++FL          K+      +    D W  A +TWYG   G G +  G
Sbjct  10   SELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSD-WSPAVATWYGPANGDGSE--G 66
Query  62   GACGYKN-VDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
            GACGY N V + PF+ +   G+  I+  G+GCGSC+E+KCT   +CSG  V V ITD+  
Sbjct  67   GACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECA 126
Query  121  E--PIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKAS 178
                 A YHFDLSG+AFG+MA  G+++N+R+AG++ +Q RR++C YP  +   FHV+  S
Sbjct  127  GCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRSI-AFHVDSGS 185
Query  179  NPNYLAILVKYVDGDGDVVAVDIKEK-GKDKWTELKESWGAVWRIDTPDKLTGPFTVRYT 237
            N  Y+A LV+Y DGDGD+  V++KE      W  +++SWGAVW+ D    L  PF+++ T
Sbjct  186  NQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLT 245
Query  238  T-EGGTKSEFEDVIPEGWKADTSY 260
            T E G      +VIP GW    +Y
Sbjct  246  TLESGQTIVANNVIPAGWTPGQTY 269

Sequence Alignment: 37. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 149.5 bits 696,  Expect = 1e-37
 Identities = 103/219 47%, Positives = 144/219 65%, Gaps = 11/219 5%
Query  38   GDKWLDAKSTWYGKPTGAGPKDNGGACGYKN-VDKAPFNGMTGCGNTPIFKDGRGCGSCF 96
            G  W    +TWYG P G G +  GGACGY++ V + PF+ M   G   +FK+G+GCGSC+
Sbjct  42   GYGWSSGGATWYGGPQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCY 99
Query  97   EIKCTKPESCSGEAVTVTITDDNEEPIA---PYHFDLSGHAFGSMAKKGEEQNVRSAGEL 153
            +IKCT   +CSG  VTV ITD     +      HFD+SG AFG+MA +G    +RSAG L
Sbjct  100  QIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVL 159
Query  154  ELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDI-KEKGKDKWTEL 212
            ++Q++RV C++  +    F V+  SNP YLAILV+Y +GDGD+ AV I K +G   W  +
Sbjct  160  KIQYKRVPCRFAMNV--AFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAM 217
Query  213  KESWGAVWRID--TPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSY 260
            ++SWGA WR++  T   L+ PF++R T+  G      +VIP GW+A  +Y
Sbjct  218  QQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTY 267

Sequence Alignment: 38. Allergen Name: Ara t expansin Sequence ID: CAB37496

 Score = 95.7 bits 430,  Expect = 2e-21
 Identities = 74/197 37%, Positives = 112/197 56%, Gaps = 13/197 6%
Query  60   NGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDN 119
            + GAC Y ++    F G        I+KDG GCG+CF+++C  P  CS +  TV +TD N
Sbjct  41   SSGACAYGSMATGFFAGHIAAALPSIYKDGSGCGACFQVRCKNPTLCSSKGTTVIVTDLN 100
Query  120  EEPIAPYHFDLSGHAFGSMAKK--GEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKA 177
            +       + LS  AF +MAK   G ++++   G +++++RRV C Y  + K    VE++
Sbjct  101  KT--NQTDLVLSSRAFRAMAKPVVGADRDLLKQGIVDIEYRRVPCDY-GNKKMNVRVEES 157
Query  178  S-NPNYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRID-TPDKLTGPFTVR 235
            S NPNYLAI + Y  G  +VVA+ I + G   W+ +  S GAVW  D  P+   G +  R
Sbjct  158  SKNPNYLAIKLLYQGGQTEVVAIYIAQVGSSHWSYMTRSHGAVWVTDKVPN---GALQFR 214
Query  236  YTTEGGTKSEF---EDVIPEGWKADTSYSA 262
            +    G   +    + V+P  W+A  SY A
Sbjct  215  FVVTAGYDGKMVWSQRVLPANWEAGKSYDA 244

Sequence Alignment: 39. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 83.9 bits 372,  Expect = 6e-18
 Identities = 63/199 31%, Positives = 101/199 50%, Gaps = 10/199 5%
Query  60   NGGACGYKNVDKAPFNGMTGCGNTP-IFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDD 118
            N G+CGY ++  A FNG      +P +F+ G GCG+CF+++C   + CS     V +TD+
Sbjct  50   NAGSCGYGSL-AASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDE 108
Query  119  NEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKAS 178
                     + LS  A+ +MA+ G    +R+   ++++++RV C+Y      +  VE+ S
Sbjct  109  ARST-NRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKS 167
Query  179  NPNY-LAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYT 237
             P   L+I   Y  G  D+VAVD+   G   W  +   +G  W   T     GP+  R  
Sbjct  168  RPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFRVV 225
Query  238  TEGGTKSEFE----DVIPEGWKADTSYSA 262
              GG   ++     +V+P  W A   Y A
Sbjct  226  VTGGYDGKWVWADGEVLPRRWTAGRVYDA 254

Sequence Alignment: 40. Allergen Name: Ory s 1 Sequence ID: BAA85432

 Score = 81.9 bits 362,  Expect = 3e-17
 Identities = 78/218 35%, Positives = 116/218 53%, Gaps = 35/218 16%
Query  29   PGPNITAEYGDK-WLDAKSTWYGKPTGAGPKDNGGACGYKNVDKAP-FNGMTGCGNTPIF 86
            P P     Y    W D  +T+YG P+G G  D GGACGY + D    ++  T   +TP+F
Sbjct  39   PAPGAVTPYKTSDWHDGSATFYGDPSGMGD-DFGGACGYVSNDIVSLYSTKTAALSTPLF 97
Query  87   KDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPY--------------HFDLSG 132
             DG GCG C+E++C K   C+  + +V IT  N  P   Y              HFD++ 
Sbjct  98   ADGNGCGQCYELRCVKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAP 157
Query  133  HAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDG 192
             +F  +A+       R AG + +Q+RRV C+     +  F ++   N  +L + V  V G
Sbjct  158  PSFLKLAQ-------RVAGIVPVQYRRVPCQRTGGVR--FCLQ--GNHYWLLLYVMNVGG 206
Query  193  DGDVVAVDIKEKGKD-KWTELKESWGAVWRI----DTPDKLTGPFTVRYTTEGGTKSEFE 247
             GDV ++ +K  G    W +   +WG  +++    D  D LT  +T  Y+T   T     
Sbjct  207  AGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTT-YSTPQQTII-VS 264
Query  248  DVIPEGWKADTSY 260
            D I   W     Y
Sbjct  265  DAISPWWITGLCY 277

Sequence Alignment: 41. Allergen Name: Cyn d 2 Sequence ID: CAA10346

 Score = 64.5 bits 274,  Expect = 2e-12
 Identities = 41/90 45%, Positives = 60/90 66%, Gaps = 4/90 4%
Query  169  KPTFHVEKASNPNYLAILVKYVDGDGDVVA-VDIKEKGKDKWTELKESWGAVWRIDTPDK 227
            K TF VEK SN  +LA+LVKY   +GD +A V+++E G D+W  + +  G VW  D+ + 
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEP 85
Query  228  LTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSYS 261
            L GPF  R+ TE G K+ F+DV+PE +    +Y+
Sbjct  86   LKGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYA 119

Sequence Alignment: 42. Allergen Name: Dac g 2 Sequence ID: CAA10345

 Score = 64.5 bits 274,  Expect = 2e-12
 Identities = 41/90 45%, Positives = 60/90 66%, Gaps = 4/90 4%
Query  169  KPTFHVEKASNPNYLAILVKYVDGDGDVVA-VDIKEKGKDKWTELKESWGAVWRIDTPDK 227
            K TF VEK SN  +LA+LVKY   +GD +A V+++E G D+W  + +  G VW  D+ + 
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEP 85
Query  228  LTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSYS 261
            L GPF  R+ TE G K+ F+DV+PE +    +Y+
Sbjct  86   LQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYA 119

Sequence Alignment: 43. Allergen Name: Poa p 2 Sequence ID: CAA10348

 Score = 64.5 bits 274,  Expect = 2e-12
 Identities = 41/90 45%, Positives = 60/90 66%, Gaps = 4/90 4%
Query  169  KPTFHVEKASNPNYLAILVKYVDGDGDVVA-VDIKEKGKDKWTELKESWGAVWRIDTPDK 227
            K TF VEK SN  +LA+LVKY   +GD +A V+++E G D+W  + +  G VW  D+ + 
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEP 85
Query  228  LTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSYS 261
            L GPF  R+ TE G K+ F+DV+PE +    +Y+
Sbjct  86   LQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYA 119

Sequence Alignment: 44. Allergen Name: Phl p 2 Sequence ID: P43214

 Score = 64.5 bits 274,  Expect = 2e-12
 Identities = 41/90 45%, Positives = 60/90 66%, Gaps = 4/90 4%
Query  169  KPTFHVEKASNPNYLAILVKYVDGDGDVVA-VDIKEKGKDKWTELKESWGAVWRIDTPDK 227
            K TF VEK SN  +LA+LVKY   +GD +A V+++E G D+W  + +  G VW  D+ + 
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEP 85
Query  228  LTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSYS 261
            L GPF  R+ TE G K+ F+DV+PE +    +Y+
Sbjct  86   LQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYA 119

Sequence Alignment: 45. Allergen Name: Dac g 1.0101 Sequence ID: Q7M1X8

 Score = 57.4 bits 236,  Expect = 8e-11
 Identities = 32/34 94%, Positives = 32/34 94%, Gaps = 0/34 0%
Query  24   IAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGP 57
            I KVPPGPNITA YGDKWLDAKSTWYGKPTGAGP
Sbjct  1    IPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGP 34

Sequence Alignment: 46. Allergen Name: Lol p 2 Sequence ID: P14947

 Score = 57.5 bits 239,  Expect = 2e-10
 Identities = 36/88 40%, Positives = 57/88 64%, Gaps = 2/88 2%
Query  172  FHVEKASNPNYLAILVKYVDGDGDVVA-VDIKEKGKDKWTELKESWGAVWRIDTPDKLTG 230
            F VEK S+   LA+ +KY + +GD +A V++KE G ++W  LK++   VW I +   L G
Sbjct  6    FTVEKGSDEKNLALSIKY-NKEGDSMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLKG 64
Query  231  PFTVRYTTEGGTKSEFEDVIPEGWKADTSY 260
            PF  R+ +E G ++ F+DV+P  +K  T+Y
Sbjct  65   PFNFRFVSEKGMRNVFDDVVPADFKVGTTY 94

Sequence Alignment: 47. Allergen Name: Dac g 3 Sequence ID: P93124

 Score = 57.1 bits 237,  Expect = 3e-10
 Identities = 35/91 38%, Positives = 59/91 64%, Gaps = 3/91 3%
Query  169  KPTFHVEKASNPNYLAILVKYVDGDGDVVA-VDIKEKGKDKWTELKESWGAVWRIDTPDK 227
            K TF VEK S+P  L + +KY    GD +A V++++ G ++W  L +  G +W + +   
Sbjct  2    KVTFKVEKGSDPKKLVLDIKYTR-PGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKP 59
Query  228  LTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSYS 261
            LTGPF  R+ ++GG ++ F++VIP  +K  T+Y+
Sbjct  60   LTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYT 93

Sequence Alignment: 48. Allergen Name: Ant o 1.0101 Sequence ID: Q7M1X6

 Score = 55.0 bits 224,  Expect = 4e-10
 Identities = 31/32 96%, Positives = 31/32 96%, Gaps = 0/32 0%
Query  24   IAKVPPGPNITAEYGDKWLDAKSTWYGKPTGA 55
            IAKVPPGPNITA YGDKWLDAKSTWYGKPTGA
Sbjct  1    IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA 32

Sequence Alignment: 49. Allergen Name: Lol p 2 Sequence ID: CAA51775

 Score = 54.3 bits 223,  Expect = 2e-09
 Identities = 35/86 40%, Positives = 53/86 61%, Gaps = 2/86 2%
Query  172  FHVEKASNPNYLAILVKYVDGDGDVVA-VDIKEKGKDKWTELKESWGAVWRIDTPDKLTG 230
            F VEK S+   LA+ +KY   +GD +A V++KE G ++W  LK++   VW I +   L G
Sbjct  2    FTVEKGSDEKNLALSIKY-SKEGDAMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLKG 60
Query  231  PFTVRYTTEGGTKSEFEDVIPEGWKADT 258
            PF  R+ +E G  + F+DV+P  +K  T
Sbjct  61   PFNFRFVSEKGMWNVFDDVVPADFKVGT 88

Sequence Alignment: 50. Allergen Name: Cyn d 15 Sequence ID: AAP80171

 Score = 53.2 bits 218,  Expect = 5e-09
 Identities = 38/85 44%, Positives = 52/85 61%, Gaps = 7/85 8%
Query  172  FHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGP 231
            FHVE+ S+P + A+ +K  D   ++  VD++E G D    + +S G  W ID P  L GP
Sbjct  24   FHVEE-SSPKF-ALSIK--DSAKEITQVDVREHGADNMDPMTKS-GDSWTIDKP--LKGP 76
Query  232  FTVRYTTEGGTKSEFEDVIPEGWKADTSYSAK 263
            + +R   EGG     +DVIPE WKA T Y  K
Sbjct  77   LNIRLRAEGGGSRVQDDVIPENWKAGTDYPTK 108

Sequence Alignment: 51. Allergen Name: Phl p 3.0101 Sequence ID: 2JNZ_A

 Score = 52.0 bits 212,  Expect = 1e-08
 Identities = 28/89 31%, Positives = 51/89 57%, Gaps = 1/89 1%
Query  171  TFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTG 230
            TF V+K S+P  L + +KY      +  V++++ G ++W  L +  G VW + +   L G
Sbjct  16   TFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPLVG 74
Query  231  PFTVRYTTEGGTKSEFEDVIPEGWKADTSY 260
            PF  R+ ++GG ++ F++VIP  +    +Y
Sbjct  75   PFNFRFMSKGGMRNVFDEVIPTAFSIGKTY 104

Sequence Alignment: 52. Allergen Name: Lol p 3 Sequence ID: P14948

 Score = 49.0 bits 197,  Expect = 7e-08
 Identities = 30/92 32%, Positives = 55/92 59%, Gaps = 3/92 3%
Query  168  TKPTFHVEKASNPNYLAILVKYVDGDGDVVA-VDIKEKGKDKWTELKESWGAVWRIDTPD 226
            TK  + VEK S+   L + +KY    GD +A V++++ G ++W  + +  G +W + +  
Sbjct  1    TKVDLTVEKGSDAKTLVLNIKYTR-PGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAK 58
Query  227  KLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSYS 261
             LTGP   R+ ++GG K+ F++VIP  +    +Y+
Sbjct  59   PLTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYT 93

Sequence Alignment: 53. Allergen Name: Tri a 3 Sequence ID: CAA90746

 Score = 43.3 bits 169,  Expect = 5e-06
 Identities = 25/91 27%, Positives = 47/91 51%, Gaps = 1/91 1%
Query  169  KPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKL 228
            K  + V+K S+   LA+ + Y   +  +  V++++ G ++W  L +  G VW +     L
Sbjct  24   KVKLTVQKGSDKKKLALKIDYTRPNDSLSEVELRQYGSEEWQPLTKK-GDVWEVSCSKPL 82
Query  229  TGPFTVRYTTEGGTKSEFEDVIPEGWKADTSY 260
             GPF  R+ ++ G K  F++V    +K   +Y
Sbjct  83   VGPFNFRFLSKNGMKKVFDEVFSTDFKIGKTY 114

Sequence Alignment: 54. Allergen Name: Sor h 2.0101 Sequence ID: A0A077B7S9

 Score = 36.2 bits 134,  Expect = 0.0007
 Identities = 28/88 31%, Positives = 48/88 54%, Gaps = 6/88 6%
Query  171  TFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKDKWTE-LKESWGAVWRIDTPDKLT 229
            T+ + K S    L +LV       DV  V +K+KG   +++ LKES    +  ++ + + 
Sbjct  28   TWTIGKDSTSTRL-VLV----ASADVSEVAVKDKGATDFSDDLKESPAKTFTYESKEPIK 82
Query  230  GPFTVRYTTEGGTKSEFEDVIPEGWKADTSYSAK 263
            GP++VR+  +G      +DVIP  +K  + Y  K
Sbjct  83   GPLSVRFAVKGQGYRTTDDVIPADFKPGSVYKTK 116

Sequence Alignment: 55. Allergen Name: Sor h 2.0201 Sequence ID: A0A077B2S0

 Score = 34.2 bits 124,  Expect = 0.003
 Identities = 25/85 29%, Positives = 43/85 50%, Gaps = 6/85 7%
Query  171  TFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKDKWTE-LKESWGAVWRIDTPDKLT 229
            T  V K S    L+++         +  V +K KG   +T+ LKES    + +D+ + + 
Sbjct  30   TIEVGKDSTSTKLSLITNVA-----ISEVSVKPKGATDFTDDLKESEPKTFTLDSKEPIE 84
Query  230  GPFTVRYTTEGGTKSEFEDVIPEGWKADTSY 260
            GP   R+  +GG     ++ IP  +KA + Y
Sbjct  85   GPIAFRFLAKGGGYRVVDNAIPADFKAGSVY 115

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.