The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSVSVSRSRGSGGLGGACGGAGFGSRS
LYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGFGFGGGAGIGFGLGGGAGLAG
GFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPTIQRVRAEEREQIKTLNNKFASFIDK
VRFLEQQNKVLETKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRLDSELR
GMQDLVEDFKNKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKADTLTDEINFLRA
LYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRAEAESWYQTKY
EELQVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMAL
KDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEG
VGQVNISVVQSTVSSGYGGASGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRAIGGGLS
SVGGGSSTIKYTTTSSSSRKSYKH
Sequence Info Allergen Name Length Opt Bits Score E Value
P02538 Hom s 5 564 3628 557.7 7e-160
QPB41107 Rap v 2.0101 859 210 42.6 0.00012
AAK39511 Der f 11.0101 692 175 37.4 0.0034
AAO73464 Der p 11 875 172 36.9 0.0063
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Hom s 5 Sequence ID: P02538

 Score = 557.7 bits 3628,  Expect = 7e-160
 Identities = 564/564 100%, Positives = 564/564 100%, Gaps = 0/564 0%
Query  1    MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSVSVSRSRGSGGLGGACGGAGFGSRS 60
            MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSVSVSRSRGSGGLGGACGGAGFGSRS
Sbjct  1    MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSVSVSRSRGSGGLGGACGGAGFGSRS 60
Query  61   LYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGFGFGGGAGIGFGLGGGAGLAG 120
            LYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGFGFGGGAGIGFGLGGGAGLAG
Sbjct  61   LYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGFGFGGGAGIGFGLGGGAGLAG 120
Query  121  GFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPTIQRVRAEEREQIKTLNNKFASFIDK 180
            GFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPTIQRVRAEEREQIKTLNNKFASFIDK
Sbjct  121  GFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPTIQRVRAEEREQIKTLNNKFASFIDK 180
Query  181  VRFLEQQNKVLETKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRLDSELR 240
            VRFLEQQNKVLETKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRLDSELR
Sbjct  181  VRFLEQQNKVLETKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRLDSELR 240
Query  241  GMQDLVEDFKNKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKADTLTDEINFLRA 300
            GMQDLVEDFKNKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKADTLTDEINFLRA
Sbjct  241  GMQDLVEDFKNKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKADTLTDEINFLRA 300
Query  301  LYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRAEAESWYQTKY 360
            LYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRAEAESWYQTKY
Sbjct  301  LYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRAEAESWYQTKY 360
Query  361  EELQVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMAL 420
            EELQVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMAL
Sbjct  361  EELQVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMAL 420
Query  421  KDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEG 480
            KDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEG
Sbjct  421  KDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEG 480
Query  481  VGQVNISVVQSTVSSGYGGASGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRAIGGGLS 540
            VGQVNISVVQSTVSSGYGGASGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRAIGGGLS
Sbjct  481  VGQVNISVVQSTVSSGYGGASGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRAIGGGLS 540
Query  541  SVGGGSSTIKYTTTSSSSRKSYKH 564
            SVGGGSSTIKYTTTSSSSRKSYKH
Sbjct  541  SVGGGSSTIKYTTTSSSSRKSYKH 564

Sequence Alignment: 2. Allergen Name: Rap v 2.0101 Sequence ID: QPB41107

 Score = 42.6 bits 210,  Expect = 0.0001
 Identities = 83/333 24%, Positives = 154/333 46%, Gaps = 21/333 6%
Query  135  IQEVTVNQSLLTPLNLQIDPTIQRVRAEEREQIKTLNNKFASFIDKVRFLE---QQNKVL 191
            + E+T  +S LT  N+ +   +Q + +      K  +   AS  D  R L+   +Q + L
Sbjct  190  LSELTSLKSRLTQENFDLQHQVQELDSNNAALGKARSQLQASNDDLKRQLDDETRQRQNL 249
Query  192  ETKWTLLQ-EQGTKTVRQNLEPLFEQYINNLRRQLDSIVGE----RGRLDSELRGMQDLV 246
            +   + LQ +     VR  LE   E    NLR QL  +  +    + R+D EL    + +
Sbjct  250  QVNLSALQADYDNLNVR--LEEEAETS-TNLRNQLSKVNADYSALKSRFDKELALKMEEM 306
Query  247  EDFKNKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKADTLTDEINFLRALYDAEL 306
            ED+K + +  I   T  E+    L+    +    K +L  +   +T E+   + +   +L
Sbjct  307  EDLKRRMQVRI---TELEDTCEQLRVKNSSLEKAKTKLANEIKEITIELENTQIIVQ-DL 362
Query  307  SQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRAEAESWYQTKYEELQVT 366
            ++   ++ + +  L          ++ +   KA  E+  Q+ R  + +    + + LQ  
Sbjct  363  TKRNRQLENENAGLQRRIEELTGENNTLRNEKALLEQDVQKLRV-SNAELTERNDNLQRE 421
Query  367  AGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMALKDAKNK 426
                 D LR     + + NR +  LR    +++ +  +L AA+ D E+    AL+DA+ K
Sbjct  422  NKHLSDQLREANLALKDANRELADLRQLRSQLEAERDSLAAALKDTEE----ALRDAEAK 477
Query  427  LEGLEDALQKAKQDLARLLKEY-QELMNVKLALDVEIATYRKLLEGEECRLNGE 479
            L   + AL + K D+   L+E  +E+ NV+ +    I   ++ L   E R   E
Sbjct  478  LASAQAALNQLKIDMENRLREKDEEIENVRRSSARAIEELQRTLVEVETRYKTE 531

Sequence Alignment: 3. Allergen Name: Der f 11.0101 Sequence ID: AAK39511

 Score = 37.4 bits 175,  Expect = 0.003
 Identities = 88/357 24%, Positives = 170/357 47%, Gaps = 34/357 9%
Query  135  IQEVTVNQSLLTPLNLQIDPTIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQ--NKVLE 192
            ++E+ +    +    +++    QR+  E  E IK ++ +    +D    L+ Q   ++ +
Sbjct  94   VHELNIKIEEINRTVIELTSHKQRLSQENTELIKEVH-EVKLQLDNANHLKTQIAQQLED 152
Query  193  TKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRLDSELRGMQDLVEDFKNK 252
            T+  L +E+  +   +N    +E  + +L+ QLD     R  L+ +L         +K+K
Sbjct  153  TRHRLEEEERKRASLENHAHTLEVELESLKVQLDEESEARLELERQLTKANGDAASWKSK 212
Query  253  YEDEINKRTAAENEFVTLKKDVDAAYMNKVE-LQAKADTLTDEINFLRALYDA---ELSQ 308
            YE E+        E+        + Y  ++E L  K  +L  + + L++  +    +L +
Sbjct  213  YEAELQAHADEVEELRRKMAQKISEYEEQLEALLNKCSSLEKQKSRLQSEVEVLIMDLEK 272
Query  309  MQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRAE-AE-SWYQTKYEEL--- 363
               H       ++     NLDL + + EV    E+  +  R + AE    Q +YE+L   
Sbjct  273  ATRHAQQLEKRVAQLEKINLDLKNKLEEVTMLMEQAQKELRVKIAELQKLQHEYEKLRDQ 332
Query  364  --QVT--AGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQ-RGEM 418
              Q+     +  DDL   K ++ + +R I+    EI  ++ +   L AA  +AE  R + 
Sbjct  333  RDQLARENKKLTDDLAEAKSQLNDAHRRIHEQEIEIKRLENERDELSAAYKEAETLRKQE 392
Query  419  ALKDAKNKLE------GLEDALQKAKQDLARLLKEYQ---ELMNVKLA-----LDVEIAT 464
              K+ +   E        E  L +  +++  L K+YQ   E +N++LA     L  EIA 
Sbjct  393  EAKNQRLIAELAQVRHDYEKRLAQKDEEIEALRKQYQIEIEQLNMRLAEAEAKLKTEIAR 452
Query  465  YRKLLEGE--ECRLNGEGVGQVNISVVQSTV 493
             +K  + +  E  L+ +   + NI + Q T+
Sbjct  453  LKKKYQAQITELELSLDAANKANIDL-QKTI 482

Sequence Alignment: 4. Allergen Name: Der p 11 Sequence ID: AAO73464

 Score = 36.9 bits 172,  Expect = 0.006
 Identities = 85/357 23%, Positives = 167/357 46%, Gaps = 34/357 9%
Query  135  IQEVTVNQSLLTPLNLQIDPTIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQ--NKVLE 192
            ++E+ +    +    +++    QR+  E  E IK ++ +    +D    L+QQ   ++ +
Sbjct  180  VHELNIKIEEINRTVIELTSHKQRLTQENTELIKEVH-EVKLQLDNANHLKQQIAQQLED 238
Query  193  TKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRLDSELRGMQDLVEDFKNK 252
            T+  L +E+  ++  +N    +E  + +L+ QLD     R  L+ +L         +K+K
Sbjct  239  TRHRLEEEERKRSSLENHAHTLEVELESLKVQLDDESEARLELERQLTKANGDAASWKSK 298
Query  253  YEDEINKRTAAENEFVTLKKDVDAAYMNKVE-LQAKADTLTDEINFLRALYDA---ELSQ 308
            YE E+        E+        + Y  ++E L  K  +L  + + L++  +    +L +
Sbjct  299  YEAELQAHADEVEELRRKMAQKISEYEEQLEALLNKCSSLEKQKSRLQSEVEVLIMDLEK 358
Query  309  MQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRAEAESWYQTKYEELQVTAG 368
               H       ++     NLDL   + EV    E+  +  R +     + ++E  +V   
Sbjct  359  AAAHAQQLEKRVAQLEKINLDLKDKLEEVTMLMEQAQKELRIKIGELQKLQHEYEKVRDQ 418
Query  369  RHG---------DDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQ-RGEM 418
            R           DDL   K ++ + +R I+    EI  ++ +   L AA  +AE  R + 
Sbjct  419  RDQLARENKKLTDDLAEAKSQLNDAHRRIHEQEIEIKRLENERDELSAAYKEAETLRKQE 478
Query  419  ALKDAKNKLE------GLEDALQKAKQDLARLLKEYQ---ELMNVKLA-----LDVEIAT 464
              K+ +   E        E  L +  +++  L K+YQ   E +N++LA     L  EIA 
Sbjct  479  EAKNQRLIAELAQVRHDYEKRLAQKDEEIEALRKQYQIEIEQLNMRLAEAEAKLKTEIAR 538
Query  465  YRKLLEGE--ECRLNGEGVGQVNISVVQSTV 493
             +K  + +  E  L+ +   + NI + Q T+
Sbjct  539  LKKKYQAQITELELSLDAANKANIDL-QKTI 568

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.