The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMN
SARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASIN
Sequence Info Allergen Name Length Opt Bits Score E Value
ADC80502 Pha v 3.0101 115 792 154.0 9.7e-40
XP_019446786 Lup an 3.0101 116 527 105.3 4.3e-25
ABX56711 Ara h 9.0101 116 512 102.6 2.9e-24
AAL25839 Hev b 12 116 510 102.2 3.7e-24
ADC80503 Pha v 3.0201 118 496 99.6 2.3e-23
Q0Z8V0 Rub i 3.0101 117 495 99.4 2.5e-23
Q9M5X8 Pru av 3 117 495 99.4 2.5e-23
Q4PLT6 Fra a 3.0202 117 494 99.3 2.9e-23
Q9M5X7 Mal d 3 115 493 99.1 3.2e-23
Q4PLT9 Fra a 3.0102 117 491 98.7 4.2e-23
Q8VX12 Fra a 3.0101 117 489 98.3 5.5e-23
Q4PLU0 Fra a 3.0201 117 484 97.4 1e-22
Q9M5X6 Pyr c 3 115 480 96.7 1.7e-22
AAK28533 Cor a 8 115 476 96.0 2.8e-22
P82534 Pru d 3 91 470 94.9 4.6e-22
P81651 Pru ar 3 91 456 92.3 2.7e-21
A0A161AT60 Pis s 3.0101 120 445 90.3 1.5e-20
CAB96876 Pru p 3 91 438 89.0 2.7e-20
A0AT29 Len c 3.0101 118 440 89.3 2.8e-20
P81402 Pru p 3 91 436 88.7 3.5e-20
ABX75045 Ara h 9.0201 92 433 88.1 5.2e-20
P85894 Mor n 3.0101 91 424 86.4 1.6e-19
P93224 Sola l 3.0101 114 413 84.4 8.4e-19
AAB42069 Lyc e 3 114 413 84.4 8.4e-19
CAL07989 Pla a 3.0101 118 412 84.2 9.9e-19
ABY21307 Pla or 3.0101 118 408 83.5 1.7e-18
P19656-1 Zea m 14.0101 120 408 83.5 1.7e-18
ANC85023 Art gm 3.0102 117 407 83.3 1.9e-18
QIN55516 Art ca 3.0102 117 405 82.9 2.4e-18
ANC85022 Art gm 3.0101 117 404 82.7 2.7e-18
ACN11576 Pru du 3.0101 123 399 81.8 5.4e-18
P19656-2 Zea m 14.0102 128 398 81.6 6.5e-18
ANC85018 Art an 3.0102 117 397 81.4 6.6e-18
W0U0V5 Can s 3.0101 91 394 80.9 7.3e-18
ANC85017 Art an 3.0101 117 395 81.1 8.6e-18
ANC85021 Art ca 3.0101 117 395 81.1 8.6e-18
ANC85027 Art si 3.0102 116 392 80.5 1.2e-17
ANC85020 Art ar 3.0102 116 392 80.5 1.2e-17
ACE07187 Art v 3.0202 116 392 80.5 1.2e-17
ACV04796 Api g 2 118 388 79.8 2.1e-17
A0A059SSZ0 Pun g 1.0201 120 378 78.0 7.7e-17
EU564845 Art v 3.0201 114 374 77.2 1.2e-16
ANC85019 Art ar 3.0101 116 374 77.2 1.2e-16
ANC85024 Art la 3.0101 116 374 77.2 1.2e-16
A0A059ST23 Pun g 1.0301 120 372 76.9 1.6e-16
ANC85025 Art la 3.0102 115 371 76.7 1.8e-16
A0A510A9S3 Ara h 17.0101 93 369 76.3 1.8e-16
A0A059STC4 Pun g 1.0101 120 371 76.7 1.9e-16
EU564847 Art v 3.0301 117 366 75.8 3.4e-16
ANC85026 Art si 3.0101 116 365 75.6 3.9e-16
AAA32970 Hor v 1 117 360 74.7 7.4e-16
CAA42832 Hor v 1 134 356 73.9 1.4e-15
CAH69206 Tri tu 14.0101 115 343 71.5 6.3e-15
NP_001316123 Sola l 7.0101 115 337 70.4 1.3e-14
ABU95411 Sin a 3.0101 92 335 70.1 1.4e-14
19846220 Tri a 14.0101 90 329 69.0 2.8e-14
P82007 Hel a 3.0101 116 305 64.6 8e-13
O04004 Amb a 6 118 214 47.9 8.7e-08
O04403 Par j 2 133 184 42.3 4.5e-06
Q40905 Par j 1 138 174 40.5 1.7e-05
P55958 Par j 2 133 173 40.3 1.8e-05
P43217 Par j 1 139 171 39.9 2.5e-05
O04404 Par j 1 176 172 40.1 2.8e-05
CAI94601 Par j 1.0103 139 169 39.6 3.2e-05
P0C088 Art v 3.0101 37 139 34.3 0.00033
CAA54587 Par j 1.0101 133 150 36.1 0.00034
P80274 Vit v 1 37 133 33.2 0.00071
10998016 Cas s 8 36 129 32.5 0.0011
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pha v 3.0101 Sequence ID: ADC80502

 Score = 154.0 bits 792,  Expect = 1e-39
 Identities = 115/115 100%, Positives = 115/115 100%, Gaps = 0/115 0%
Query  1    MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMN 60
            MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMN
Sbjct  1    MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMN 60
Query  61   SARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASIN 115
            SARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASIN
Sbjct  61   SARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASIN 115

Sequence Alignment: 2. Allergen Name: Lup an 3.0101 Sequence ID: XP_019446786

 Score = 105.3 bits 527,  Expect = 4e-25
 Identities = 72/111 64%, Positives = 89/111 80%, Gaps = 0/111 0%
Query  4    VKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSAR 63
            VK+AC V++CMVVV A   + +TCGQV +NL  C+ +L++GG VPA CCNG++NI+N A+
Sbjct  5    VKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPAPCCNGIKNILNLAK 64
Query  64   STADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            +T DRR  CNCLK AA    GLNP+NA +LPGKCGVNIPYKISTSTNCASI
Sbjct  65   TTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGVNIPYKISTSTNCASI 115

Sequence Alignment: 3. Allergen Name: Ara h 9.0101 Sequence ID: ABX56711

 Score = 102.6 bits 512,  Expect = 3e-24
 Identities = 69/114 60%, Positives = 88/114 77%, Gaps = 0/114 0%
Query  1    MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMN 60
            MAS+KFA V+++CM +VGA     ++CGQV S L PC+ FL  GG  P  CC+GVR ++ 
Sbjct  1    MASLKFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLTKGGAPPPACCSGVRGLLG 60
Query  61   SARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            + R+TADR+  CNCLK AAG++RGLN  NA ALPG+CGV+IPYKISTSTNCA+I
Sbjct  61   ALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGVSIPYKISTSTNCATI 114

Sequence Alignment: 4. Allergen Name: Hev b 12 Sequence ID: AAL25839

 Score = 102.2 bits 510,  Expect = 4e-24
 Identities = 71/114 62%, Positives = 88/114 77%, Gaps = 1/114 0%
Query  1    MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP-AGCCNGVRNIM 59
            MA++K    +VLCM+V    TAQ +TCGQVQS LVPC+++L+  G  P A CCNGVR I 
Sbjct  1    MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPATCCNGVRTIN 60
Query  60   NSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            N+A++TADRR  C CLK+AAG+V+GLNP     LPGKCGVNIPYKIS STNCA++
Sbjct  61   NAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGVNIPYKISLSTNCATV 115

Sequence Alignment: 5. Allergen Name: Pha v 3.0201 Sequence ID: ADC80503

 Score = 99.6 bits 496,  Expect = 2e-23
 Identities = 71/114 62%, Positives = 93/114 81%, Gaps = 2/114 1%
Query  1    MASVKFACVV-VLCMVVVGAHTAQG-MTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNI 58
            MA++  ACVV VLC+VV+ A TA+  ++CGQV S+L  C+ FL  GG VPA CC+GVR++
Sbjct  1    MATLNSACVVAVLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGGPVPASCCSGVRSL 60
Query  59   MNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
              +A++T DR+ +CNCLK+AAGA+ G+N NNA  LPGKCGV+IPYKISTSTNCA+I
Sbjct  61   NAAAKTTPDRQAVCNCLKSAAGAIPGFNANNAGILPGKCGVSIPYKISTSTNCATI 116

Sequence Alignment: 6. Allergen Name: Rub i 3.0101 Sequence ID: Q0Z8V0

 Score = 99.4 bits 495,  Expect = 3e-23
 Identities = 67/112 59%, Positives = 88/112 78%, Gaps = 1/112 0%
Query  2    ASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNS 61
            A +K+A V +LC +VV    AQ +TCGQV  N+ PC  +++NGG VPA CCNGVRN+ + 
Sbjct  5    AVMKLALVALLC-IVVAVPVAQAITCGQVTQNVAPCFNYVKNGGAVPAACCNGVRNLNSQ 63
Query  62   ARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            A++TADR+  CNCLK AAG++ GLNP+ A  LPGKCGV++PYKISTSTNCA++
Sbjct  64   AKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKCGVSVPYKISTSTNCATV 116

Sequence Alignment: 7. Allergen Name: Pru av 3 Sequence ID: Q9M5X8

 Score = 99.4 bits 495,  Expect = 3e-23
 Identities = 69/112 61%, Positives = 85/112 75%, Gaps = 1/112 0%
Query  2    ASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNS 61
            A  K+A VV LCMVV     AQ +TCGQV SNL PC+ +++ GG VP  CCNG+RNI N 
Sbjct  5    AMTKLALVVALCMVV-SVPIAQALTCGQVSSNLAPCIAYVRGGGAVPPACCNGIRNINNL 63
Query  62   ARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            A++TADR+  CNCLK  + +V G+N NNA ALPGKCGVN+PYKIS STNCA++
Sbjct  64   AKTTADRQTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATV 116

Sequence Alignment: 8. Allergen Name: Fra a 3.0202 Sequence ID: Q4PLT6

 Score = 99.3 bits 494,  Expect = 3e-23
 Identities = 65/111 58%, Positives = 92/111 82%, Gaps = 1/111 0%
Query  3    SVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSA 62
            ++K++ V +LC +VV    AQ +TCGQV S++ PCV ++++GG VPA CCNG+R++ ++A
Sbjct  6    AMKLSLVALLC-IVVALPIAQAITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSAA 64
Query  63   RSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            ++TADR+  CNCLK A+GA++GLNPN A  LPGKCGVN+PYKISTSTNCA++
Sbjct  65   KTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCGVNVPYKISTSTNCAAV 116

Sequence Alignment: 9. Allergen Name: Mal d 3 Sequence ID: Q9M5X7

 Score = 99.1 bits 493,  Expect = 3e-23
 Identities = 68/110 61%, Positives = 85/110 77%, Gaps = 3/110 2%
Query  2    ASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNS 61
            A  K+A VV LCM V  AH    +TCGQV S+L PC+ ++++GG VP  CCNG+R I   
Sbjct  5    AVTKLALVVALCMAVSVAHA---ITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGL 61
Query  62   ARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            AR+TADR+  CNCLK  AG++ G+NPNNA  LPGKCGVN+PYKISTSTNCA++
Sbjct  62   ARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATV 114

Sequence Alignment: 10. Allergen Name: Fra a 3.0102 Sequence ID: Q4PLT9

 Score = 98.7 bits 491,  Expect = 4e-23
 Identities = 65/111 58%, Positives = 90/111 81%, Gaps = 1/111 0%
Query  3    SVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSA 62
            ++K++ V +LC +VV    AQ +TCGQV SN+ PCVT++++GG VPA CC+G+RN+   A
Sbjct  6    AMKLSLVALLC-IVVALPIAQAITCGQVASNISPCVTYVKSGGAVPAPCCSGIRNLNGMA 64
Query  63   RSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            ++TADR+  CNCLK AAG ++GLNPN A  LPGKCGV++PYKIST+TNCA++
Sbjct  65   KTTADRQATCNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAV 116

Sequence Alignment: 11. Allergen Name: Fra a 3.0101 Sequence ID: Q8VX12

 Score = 98.3 bits 489,  Expect = 5e-23
 Identities = 64/111 57%, Positives = 90/111 81%, Gaps = 1/111 0%
Query  3    SVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSA 62
            ++K++ V +LC +VV    AQ +TCGQV SN+ PC+T++++GG VPA CC+G+RN+   A
Sbjct  6    AMKLSLVALLC-IVVALPIAQAITCGQVASNISPCLTYVKSGGAVPAACCSGIRNLNGMA 64
Query  63   RSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            ++TADR+  CNCLK AAG ++GLNPN A  LPGKCGV++PYKIST+TNCA++
Sbjct  65   KTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAV 116

Sequence Alignment: 12. Allergen Name: Fra a 3.0201 Sequence ID: Q4PLU0

 Score = 97.4 bits 484,  Expect = 1e-22
 Identities = 63/111 56%, Positives = 92/111 82%, Gaps = 1/111 0%
Query  3    SVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSA 62
            ++K++ V +LC +VV    AQ +TCGQV S++ PCV ++++GG VPA CCNG+R++ ++A
Sbjct  6    AMKLSLVALLC-IVVALPIAQAITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSAA 64
Query  63   RSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            ++TADR+  CNCLK A+GA++GLNP+ A  LPGKCGV++PYKISTSTNCA++
Sbjct  65   KTTADRQATCNCLKQASGAIKGLNPSLAAGLPGKCGVSVPYKISTSTNCAAV 116

Sequence Alignment: 13. Allergen Name: Pyr c 3 Sequence ID: Q9M5X6

 Score = 96.7 bits 480,  Expect = 2e-22
 Identities = 64/110 58%, Positives = 85/110 77%, Gaps = 3/110 2%
Query  2    ASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNS 61
            A +K+A VV LCM V  AH    +TC QV +NL PC+ ++++GG VP  CCNG++ I   
Sbjct  5    AVIKLALVVALCMAVSVAHA---ITCSQVSANLAPCINYVRSGGAVPPACCNGIKTINGL 61
Query  62   ARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            A++T DR+  CNCLK  AG+V G+NP NA++LPGKCGVN+PYKISTSTNCA++
Sbjct  62   AKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVNVPYKISTSTNCATV 114

Sequence Alignment: 14. Allergen Name: Cor a 8 Sequence ID: AAK28533

 Score = 96.0 bits 476,  Expect = 3e-22
 Identities = 61/114 53%, Positives = 81/114 71%, Gaps = 0/114 0%
Query  1    MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMN 60
            M S+K+ C V+LCM+V        +TC Q++ NL PCV +L+NGG +P  CC GVR + +
Sbjct  1    MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND 60
Query  61   SARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            ++R+T+DR+  CNCLK  A  + GLNPN A  LPGKCGVNIPYKIS STNC ++
Sbjct  61   ASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNV 114

Sequence Alignment: 15. Allergen Name: Pru d 3 Sequence ID: P82534

 Score = 94.9 bits 470,  Expect = 5e-22
 Identities = 59/90 65%, Positives = 74/90 82%, Gaps = 0/90 0%
Query  25   MTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRG 84
            +TCGQV SNL PC+ +++ GG VP  CCNG+RN+ N AR+TADRR  CNCLK  +G++ G
Sbjct  1    ITCGQVSSNLAPCINYVKGGGAVPPACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPG 60
Query  85   LNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            +NPNNA ALPGKCGVN+PYKIS STNCA++
Sbjct  61   VNPNNAAALPGKCGVNVPYKISASTNCATV 90

Sequence Alignment: 16. Allergen Name: Pru ar 3 Sequence ID: P81651

 Score = 92.3 bits 456,  Expect = 3e-21
 Identities = 58/90 64%, Positives = 73/90 81%, Gaps = 0/90 0%
Query  25   MTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRG 84
            +TCGQV S+L PC+ +++ GG VP  CCNG+RN+ N AR+T DRR  CNCLK  +G++ G
Sbjct  1    ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISG 60
Query  85   LNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            +NPNNA ALPGKCGVNIPYKIS STNCA++
Sbjct  61   VNPNNAAALPGKCGVNIPYKISASTNCATV 90

Sequence Alignment: 17. Allergen Name: Pis s 3.0101 Sequence ID: A0A161AT60

 Score = 90.3 bits 445,  Expect = 2e-20
 Identities = 61/112 54%, Positives = 84/112 75%, Gaps = 3/112 2%
Query  3    SVKFACV-VVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQ--NGGFVPAGCCNGVRNIM 59
            S+K+ACV +V+CMVV+       ++CG V +++ PCVT+LQ  N    P  CC GV+ ++
Sbjct  4    SMKLACVALVICMVVIAPMAEAALSCGTVSADMAPCVTYLQAPNNASPPPPCCAGVKKLL 63
Query  60   NSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
             +A +T DR+  CNCLK+AAG++  LN NNA ALPGKCGV+IPYKISTSTNC ++
Sbjct  64   AAATTTPDRQAACNCLKSAAGSIPKLNTNNAAALPGKCGVSIPYKISTSTNCNTV 118

Sequence Alignment: 18. Allergen Name: Pru p 3 Sequence ID: CAB96876

 Score = 89.0 bits 438,  Expect = 3e-20
 Identities = 56/90 62%, Positives = 72/90 80%, Gaps = 0/90 0%
Query  25   MTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRG 84
            +TCGQV S+L PC+ +++ GG VP  CCNG+RN+ N AR+T DR+  CNCLK  + +V G
Sbjct  1    ITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  85   LNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            +NPNNA ALPGKCGV+IPYKIS STNCA++
Sbjct  61   VNPNNAAALPGKCGVSIPYKISASTNCATV 90

Sequence Alignment: 19. Allergen Name: Len c 3.0101 Sequence ID: A0AT29

 Score = 89.3 bits 440,  Expect = 3e-20
 Identities = 60/111 54%, Positives = 81/111 72%, Gaps = 1/111 0%
Query  4    VKFACVV-VLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSA 62
            +K+ACVV V+CMVV+       ++CG V S+L PC+T+L  G      CC GV+ ++ +A
Sbjct  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAA 64
Query  63   RSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
             +T DR+  CNCLK+AAG++  LN NNA ALPGKCGVNIPYKIST+TNC ++
Sbjct  65   NTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTV 116

Sequence Alignment: 20. Allergen Name: Pru p 3 Sequence ID: P81402

 Score = 88.7 bits 436,  Expect = 4e-20
 Identities = 56/90 62%, Positives = 71/90 78%, Gaps = 0/90 0%
Query  25   MTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRG 84
            +TCGQV S L PC+ +++ GG VP  CCNG+RN+ N AR+T DR+  CNCLK  + +V G
Sbjct  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  85   LNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            +NPNNA ALPGKCGV+IPYKIS STNCA++
Sbjct  61   VNPNNAAALPGKCGVHIPYKISASTNCATV 90

Sequence Alignment: 21. Allergen Name: Ara h 9.0201 Sequence ID: ABX75045

 Score = 88.1 bits 433,  Expect = 5e-20
 Identities = 59/89 66%, Positives = 75/89 84%, Gaps = 2/89 2%
Query  25   MTCGQVQSNLVPCVTFLQNGGFVPAG-CCNGVRNIMNSARSTADRRGICNCLKTAAGAVR 83
            ++CGQV S L PC+TFL  GG VP+G CC+GVR ++ +A++TADR+  CNCLK AAG++ 
Sbjct  1    LSCGQVNSALAPCITFLTKGG-VPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLH 59
Query  84   GLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            GLN  NA ALPG+CGV+IPYKISTSTNCA+I
Sbjct  60   GLNQGNAAALPGRCGVSIPYKISTSTNCATI 90

Sequence Alignment: 22. Allergen Name: Mor n 3.0101 Sequence ID: P85894

 Score = 86.4 bits 424,  Expect = 2e-19
 Identities = 54/90 60%, Positives = 73/90 81%, Gaps = 0/90 0%
Query  25   MTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRG 84
            +TCGQV S+L PC+ +L+ GG VPA CCNGVR++ N+A++TADR+  CNCLK+A  +++G
Sbjct  1    ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKG 60
Query  85   LNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            LN N A  LPGKCGV++PYKIS ST+C S+
Sbjct  61   LNLNLAAGLPGKCGVSVPYKISPSTDCKSV 90

Sequence Alignment: 23. Allergen Name: Sola l 3.0101 Sequence ID: P93224

 Score = 84.4 bits 413,  Expect = 8e-19
 Identities = 53/108 49%, Positives = 79/108 73%, Gaps = 2/108 1%
Query  5    KFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSARS 64
            K AC VV+CMVVV  H A+ ++CG+V S L PC+ +L+  G +  GCC GV+ ++ +A++
Sbjct  6    KIACFVVFCMVVVAPH-AESLSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLLGAAKT 63
Query  65   TADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
              DR+  C CLK+AA +++G++   A  LPG CGVNIPYKIS ST+C+++
Sbjct  64   PEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTV 113

Sequence Alignment: 24. Allergen Name: Lyc e 3 Sequence ID: AAB42069

 Score = 84.4 bits 413,  Expect = 8e-19
 Identities = 53/108 49%, Positives = 79/108 73%, Gaps = 2/108 1%
Query  5    KFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSARS 64
            K AC VV+CMVVV  H A+ ++CG+V S L PC+ +L+  G +  GCC GV+ ++ +A++
Sbjct  6    KIACFVVFCMVVVAPH-AESLSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLLGAAKT 63
Query  65   TADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
              DR+  C CLK+AA +++G++   A  LPG CGVNIPYKIS ST+C+++
Sbjct  64   PEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTV 113

Sequence Alignment: 25. Allergen Name: Pla a 3.0101 Sequence ID: CAL07989

 Score = 84.2 bits 412,  Expect = 1e-18
 Identities = 52/110 47%, Positives = 76/110 69%, Gaps = 0/110 0%
Query  5    KFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSARS 64
            K+AC+++ CMV    H    +TCG V + L PC+TFL++GG V   CCNGV+ + N A++
Sbjct  8    KLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAVAPACCNGVKALNNDAKT 67
Query  65   TADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            T DR+  C CLKTA+ ++ G+   NA +L GKCGVN+PYKIS + +C+ +
Sbjct  68   TPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKV 117

Sequence Alignment: 26. Allergen Name: Pla or 3.0101 Sequence ID: ABY21307

 Score = 83.5 bits 408,  Expect = 2e-18
 Identities = 51/110 46%, Positives = 76/110 69%, Gaps = 0/110 0%
Query  5    KFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSARS 64
            K+AC+++ CMV    H    +TCG V + L PC+T+L++GG V   CCNGV+ + N A++
Sbjct  8    KLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKT 67
Query  65   TADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            T DR+  C CLKTA+ ++ G+   NA +L GKCGVN+PYKIS + +C+ +
Sbjct  68   TPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKV 117

Sequence Alignment: 27. Allergen Name: Zea m 14.0101 Sequence ID: P19656-1

 Score = 83.5 bits 408,  Expect = 2e-18
 Identities = 56/109 51%, Positives = 78/109 71%, Gaps = 1/109 0%
Query  7    ACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP-AGCCNGVRNIMNSARST 65
            A  VV  +++  A +   ++CGQV S + PC+++ +  G  P AGCC+GVR++ N+AR+T
Sbjct  11   ATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTT 70
Query  66   ADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASIN 115
            ADRR  CNCLK AA  V GLN  NA ++P KCGV+IPY ISTST+C+ +N
Sbjct  71   ADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN 120

Sequence Alignment: 28. Allergen Name: Art gm 3.0102 Sequence ID: ANC85023

 Score = 83.3 bits 407,  Expect = 2e-18
 Identities = 53/114 46%, Positives = 77/114 67%, Gaps = 0/114 0%
Query  1    MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMN 60
            M  +K  CV+V+CMVV  ++    +TC  V + + PC++FL+ GG VPA CC GV+ + +
Sbjct  3    MKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCLSFLKQGGEVPADCCTGVKGLND 62
Query  61   SARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            +A++T DR+  CNCLKT+  + + L  +NA  LP KCGVNIPYKIS  T+C  +
Sbjct  63   AAKTTPDRQTACNCLKTSFKSNKDLKSDNAVVLPSKCGVNIPYKISLETDCNKV 116

Sequence Alignment: 29. Allergen Name: Art ca 3.0102 Sequence ID: QIN55516

 Score = 82.9 bits 405,  Expect = 2e-18
 Identities = 51/114 44%, Positives = 77/114 67%, Gaps = 0/114 0%
Query  1    MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMN 60
            M  +K  CV+++CMVV+ ++    +TC  V + + PC++FL+ GG VPA CC GV+ + +
Sbjct  3    MKMMKVFCVMIVCMVVLSSYAEAALTCSDVSNKITPCLSFLKQGGEVPADCCTGVKGLND 62
Query  61   SARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            +A++  DR+  CNCLKT   + + L  +NA  LP KCGVNIPYKIS  T+C ++
Sbjct  63   AAKTGPDRQKACNCLKTTFKSNKDLKSDNAVVLPSKCGVNIPYKISLETDCNTV 116

Sequence Alignment: 30. Allergen Name: Art gm 3.0101 Sequence ID: ANC85022

 Score = 82.7 bits 404,  Expect = 3e-18
 Identities = 52/114 45%, Positives = 76/114 66%, Gaps = 0/114 0%
Query  1    MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMN 60
            M  +K  CV+V+CMVV  ++    +TC  V + + PC +FL+ GG VPA CC GV+ + +
Sbjct  3    MKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCTSFLKQGGEVPADCCTGVKGLND 62
Query  61   SARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            +A++T DR+  CNCLKT+  + + +  +NA  LP KCGVNIPYKIS  T+C  +
Sbjct  63   AAKTTPDRQTACNCLKTSFKSNKDFKSDNAAVLPSKCGVNIPYKISLETDCNKV 116

Sequence Alignment: 31. Allergen Name: Pru du 3.0101 Sequence ID: ACN11576

 Score = 81.8 bits 399,  Expect = 5e-18
 Identities = 56/111 50%, Positives = 76/111 68%, Gaps = 4/111 3%
Query  4    VKFACVVVL--CMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNS 61
            +K+ C+V +  CM V G      ++CGQV +NL PC+ ++ NGG +   CC GVR++ + 
Sbjct  8    LKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANGGALNPSCCTGVRSLYSL 67
Query  62   ARSTADRRGICNCLKTAAGAVRGLNPNN--AQALPGKCGVNIPYKISTSTNCASI 114
            A++TADR+ ICNCLK A   +   N N   A  LPGKCGVNIPYKIS ST+C +I
Sbjct  68   AQTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTDCKTI 122

Sequence Alignment: 32. Allergen Name: Zea m 14.0102 Sequence ID: P19656-2

 Score = 81.6 bits 398,  Expect = 6e-18
 Identities = 55/106 51%, Positives = 76/106 71%, Gaps = 1/106 0%
Query  7    ACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP-AGCCNGVRNIMNSARST 65
            A  VV  +++  A +   ++CGQV S + PC+++ +  G  P AGCC+GVR++ N+AR+T
Sbjct  11   ATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTT 70
Query  66   ADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCA 112
            ADRR  CNCLK AA  V GLN  NA ++P KCGV+IPY ISTST+C+
Sbjct  71   ADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCS 117

Sequence Alignment: 33. Allergen Name: Art an 3.0102 Sequence ID: ANC85018

 Score = 81.4 bits 397,  Expect = 7e-18
 Identities = 51/114 44%, Positives = 72/114 63%, Gaps = 0/114 0%
Query  1    MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMN 60
            M  +K  CV+V+CMVV  ++    +TC  V   + PC +FL+ GG VP  CC GV+ + +
Sbjct  3    MKMMKVFCVMVVCMVVTSSYAEAALTCNDVTKKISPCTSFLEKGGEVPVDCCTGVKGLND 62
Query  61   SARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            +A++T DR+  CNCLKT+  +   +   NA  LP KCGVNIPYKIS  T+C  +
Sbjct  63   AAKTTPDRQAACNCLKTSFKSSNNFKEENAAVLPSKCGVNIPYKISLETDCNKV 116

Sequence Alignment: 34. Allergen Name: Can s 3.0101 Sequence ID: W0U0V5

 Score = 80.9 bits 394,  Expect = 7e-18
 Identities = 49/90 54%, Positives = 72/90 80%, Gaps = 0/90 0%
Query  25   MTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRG 84
            +TCGQV S+L PC+++L+ GG VP GCCN ++++  +A++ ADR+  C CLK+AA +++G
Sbjct  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
Query  85   LNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            +N N A  LPGKCGV+IPYKIS ST+C+S+
Sbjct  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSV 90

Sequence Alignment: 35. Allergen Name: Art an 3.0101 Sequence ID: ANC85017

 Score = 81.1 bits 395,  Expect = 9e-18
 Identities = 51/114 44%, Positives = 75/114 65%, Gaps = 0/114 0%
Query  1    MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMN 60
            M  +K  CV+V+CMVV  ++    +TC  V + ++PC +FL+ GG V A CC GV+ + +
Sbjct  3    MKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVSADCCTGVKGLND 62
Query  61   SARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            +A++T DR+  CNCLKT   + + +  +NA  LP KCGVNIPYKIS  T+C  +
Sbjct  63   AAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCGVNIPYKISLETDCNKV 116

Sequence Alignment: 36. Allergen Name: Art ca 3.0101 Sequence ID: ANC85021

 Score = 81.1 bits 395,  Expect = 9e-18
 Identities = 51/114 44%, Positives = 75/114 65%, Gaps = 0/114 0%
Query  1    MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMN 60
            M  +K  CV+V+CMVV  ++    +TC  V + ++PC +FL+ GG V A CC GV+ + +
Sbjct  3    MKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVSADCCTGVKGLND 62
Query  61   SARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            +A++T DR+  CNCLKT   + + +  +NA  LP KCGVNIPYKIS  T+C  +
Sbjct  63   AAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCGVNIPYKISLETDCNKV 116

Sequence Alignment: 37. Allergen Name: Art si 3.0102 Sequence ID: ANC85027

 Score = 80.5 bits 392,  Expect = 1e-17
 Identities = 51/113 45%, Positives = 78/113 69%, Gaps = 1/113 0%
Query  1    MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMN 60
            M  +KF C +V+CMV+  ++ A+ +TC  V + + PC+ +L+ GG VPA CC GV+ + +
Sbjct  3    MKMMKFFCAMVVCMVLSSSY-AEALTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLND 61
Query  61   SARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            +A++T DR+  CNCLKT+  + + L  + A +LP KCGVNIPYKIS  T+C  +
Sbjct  62   AAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKV 115

Sequence Alignment: 38. Allergen Name: Art ar 3.0102 Sequence ID: ANC85020

 Score = 80.5 bits 392,  Expect = 1e-17
 Identities = 51/113 45%, Positives = 78/113 69%, Gaps = 1/113 0%
Query  1    MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMN 60
            M  +KF C +V+CMV+  ++ A+ +TC  V + + PC+ +L+ GG VPA CC GV+ + +
Sbjct  3    MKMMKFFCAMVVCMVLSSSY-AEALTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLND 61
Query  61   SARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            +A++T DR+  CNCLKT+  + + L  + A +LP KCGVNIPYKIS  T+C  +
Sbjct  62   AAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKV 115

Sequence Alignment: 39. Allergen Name: Art v 3.0202 Sequence ID: ACE07187

 Score = 80.5 bits 392,  Expect = 1e-17
 Identities = 51/113 45%, Positives = 78/113 69%, Gaps = 1/113 0%
Query  1    MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMN 60
            M  +KF C +V+CMV+  ++ A+ +TC  V + + PC+ +L+ GG VPA CC GV+ + +
Sbjct  3    MKMMKFFCAMVVCMVLSSSY-AEALTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLND 61
Query  61   SARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            +A++T DR+  CNCLKT+  + + L  + A +LP KCGVNIPYKIS  T+C  +
Sbjct  62   AAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKV 115

Sequence Alignment: 40. Allergen Name: Api g 2 Sequence ID: ACV04796

 Score = 79.8 bits 388,  Expect = 2e-17
 Identities = 54/107 50%, Positives = 74/107 69%, Gaps = 2/107 1%
Query  9    VVVLCMVVVGAHTA--QGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSARSTA 66
            V V+ MVVV  H A  +G+TCGQV   L  C+ +L+ GG+    CC GV+ + + A++ A
Sbjct  10   VAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYPSPACCGGVKGLNSLAKTPA 69
Query  67   DRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASIN 115
            DR+  C CLKT AG+V+G+N   A ALPGKCG+ IPY IS ST+C+ +N
Sbjct  70   DRKQACACLKTLAGSVKGINYGAASALPGKCGIRIPYPISPSTDCSRVN 118

Sequence Alignment: 41. Allergen Name: Pun g 1.0201 Sequence ID: A0A059SSZ0

 Score = 78.0 bits 378,  Expect = 8e-17
 Identities = 56/114 49%, Positives = 78/114 68%, Gaps = 5/114 4%
Query  1    MASVKFACVVV----LCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP-AGCCNGV 55
            MAS +F   +V    LCMVV  +     +TCGQV S+L PC+ + +     P A CC+GV
Sbjct  1    MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVAAPSAACCSGV 60
Query  56   RNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            R++ N+A++T DR+  CNCLK  A ++ G+N     ALPGKCGV+IPYKIS ST+C+ +
Sbjct  61   RSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPGKCGVSIPYKISPSTDCSRV 119

Sequence Alignment: 42. Allergen Name: Art v 3.0201 Sequence ID: EU564845

 Score = 77.2 bits 374,  Expect = 1e-16
 Identities = 49/113 43%, Positives = 76/113 67%, Gaps = 1/113 0%
Query  1    MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMN 60
            M  +KF C +V+CMVV  ++ A+ + C  V + +  C+++L+ GG VPA CC GV+ + +
Sbjct  1    MKMMKFFCAMVVCMVVSSSY-AEALKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLND 59
Query  61   SARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            +A++T DR+  CNCLKT   + + +  + A +LP KCGVNIPYKIS  T+C  +
Sbjct  60   AAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKV 113

Sequence Alignment: 43. Allergen Name: Art ar 3.0101 Sequence ID: ANC85019

 Score = 77.2 bits 374,  Expect = 1e-16
 Identities = 49/113 43%, Positives = 76/113 67%, Gaps = 1/113 0%
Query  1    MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMN 60
            M  +KF C +V+CMVV  ++ A+ + C  V + +  C+++L+ GG VPA CC GV+ + +
Sbjct  3    MKMMKFFCAMVVCMVVSSSY-AEALKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLND 61
Query  61   SARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            +A++T DR+  CNCLKT   + + +  + A +LP KCGVNIPYKIS  T+C  +
Sbjct  62   AAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKV 115

Sequence Alignment: 44. Allergen Name: Art la 3.0101 Sequence ID: ANC85024

 Score = 77.2 bits 374,  Expect = 1e-16
 Identities = 49/113 43%, Positives = 76/113 67%, Gaps = 1/113 0%
Query  1    MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMN 60
            M  +KF C +V+CMVV  ++ A+ + C  V + +  C+++L+ GG VPA CC GV+ + +
Sbjct  3    MKMMKFFCAMVVCMVVSSSY-AEALKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLND 61
Query  61   SARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            +A++T DR+  CNCLKT   + + +  + A +LP KCGVNIPYKIS  T+C  +
Sbjct  62   AAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKV 115

Sequence Alignment: 45. Allergen Name: Pun g 1.0301 Sequence ID: A0A059ST23

 Score = 76.9 bits 372,  Expect = 2e-16
 Identities = 53/114 46%, Positives = 79/114 69%, Gaps = 5/114 4%
Query  1    MAS---VKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQ-NG-GFVPAGCCNGV 55
            MAS   +++A  V++CM V       G+TCGQV S+L  C+ + + NG G VP  CCNG+
Sbjct  1    MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGI 60
Query  56   RNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            R++ ++A++T DR+  C CLK+ A ++ G+N       PGKCGV+IPYKI+ STNC ++
Sbjct  61   RSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNV 119

Sequence Alignment: 46. Allergen Name: Art la 3.0102 Sequence ID: ANC85025

 Score = 76.7 bits 371,  Expect = 2e-16
 Identities = 46/114 40%, Positives = 74/114 64%, Gaps = 0/114 0%
Query  1    MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMN 60
            M  +K  CV+V+CMVV  ++    +TC  V + + PC+++L+ GG VPA CC GV+ + +
Sbjct  1    MKMMKVFCVMVVCMVVKSSYAEAALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLND 60
Query  61   SARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            + ++T DR+  CNCLK +  + + L  + A  LP KCG+N+PYK+S  T+C  +
Sbjct  61   ATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKV 114

Sequence Alignment: 47. Allergen Name: Ara h 17.0101 Sequence ID: A0A510A9S3

 Score = 76.3 bits 369,  Expect = 2e-16
 Identities = 48/90 53%, Positives = 70/90 77%, Gaps = 1/90 1%
Query  25   MTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRG 84
            + C  V  ++ PC  +L++GG V   CC+G++NI  +A++T+DR+ +CNCLK+AA ++  
Sbjct  2    IQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGS 61
Query  85   -LNPNNAQALPGKCGVNIPYKISTSTNCASI 114
             +NPNNA +LPGKCGV+IPYKISTS NC+SI
Sbjct  62   QINPNNAASLPGKCGVSIPYKISTSINCSSI 92

Sequence Alignment: 48. Allergen Name: Pun g 1.0101 Sequence ID: A0A059STC4

 Score = 76.7 bits 371,  Expect = 2e-16
 Identities = 51/110 46%, Positives = 74/110 67%, Gaps = 2/110 1%
Query  5    KFACVV-VLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQN-GGFVPAGCCNGVRNIMNSA 62
            K+AC V  + +V     T   +TCGQV S+L PC+ + ++ GG VP  CC+G++ +   A
Sbjct  8    KLACAVFAVALVAAPIATEAAVTCGQVASSLAPCIPYARSAGGAVPPACCSGIKTLDGMA 67
Query  63   RSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            R+T DR+  C CLK+A+ ++ G+N     +LP KCGVNIPYKIS ST+CA +
Sbjct  68   RTTPDRQATCKCLKSASTSISGINYGLVASLPAKCGVNIPYKISPSTDCARV 119

Sequence Alignment: 49. Allergen Name: Art v 3.0301 Sequence ID: EU564847

 Score = 75.8 bits 366,  Expect = 3e-16
 Identities = 44/111 39%, Positives = 73/111 65%, Gaps = 0/111 0%
Query  4    VKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSAR 63
            +K  C++V+CMVV  ++    +TC  V + + PC+++L+ GG VPA CC GV+ + ++ +
Sbjct  6    MKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATK 65
Query  64   STADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            +T DR+  CNCLK +  + + L  + A  LP KCG+N+PYK+S  T+C  +
Sbjct  66   TTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKV 116

Sequence Alignment: 50. Allergen Name: Art si 3.0101 Sequence ID: ANC85026

 Score = 75.6 bits 365,  Expect = 4e-16
 Identities = 48/113 42%, Positives = 73/113 64%, Gaps = 1/113 0%
Query  1    MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMN 60
            M  +K  CV+V+CMVV  ++ A+ +TC  V + + PC+ +L+ GG VPA CC GV+ + +
Sbjct  3    MKMMKVFCVMVVCMVVSSSY-AEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLND 61
Query  61   SARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            +A++T DR+  C CLK +    + L  + A  LP KCGV IPYK+S  T+C  +
Sbjct  62   AAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKV 115

Sequence Alignment: 51. Allergen Name: Hor v 1 Sequence ID: AAA32970

 Score = 74.7 bits 360,  Expect = 7e-16
 Identities = 50/112 44%, Positives = 72/112 64%, Gaps = 2/112 1%
Query  2    ASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG-CCNGVRNIMN 60
            A V +    ++ M+      A  + CGQV S + PC+T++Q GG  P+G CCNGVR++ N
Sbjct  4    AQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQ-GGPGPSGECCNGVRDLHN 62
Query  61   SARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
             A+S+ DR+ +CNCLK  A  +  LN NNA ++P KC VN+PY IS   +C+ I
Sbjct  63   QAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRI 116

Sequence Alignment: 52. Allergen Name: Hor v 1 Sequence ID: CAA42832

 Score = 73.9 bits 356,  Expect = 1e-15
 Identities = 49/110 44%, Positives = 71/110 64%, Gaps = 2/110 1%
Query  2    ASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG-CCNGVRNIMN 60
            A V +    ++ M+      A  + CGQV S + PC+T++Q GG  P+G CCNGVR++ N
Sbjct  4    AQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQ-GGPGPSGECCNGVRDLHN 62
Query  61   SARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCA 112
             A+S+ DR+ +CNCLK  A  +  LN NNA ++P KC VN+PY IS   +C+
Sbjct  63   QAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCS 114

Sequence Alignment: 53. Allergen Name: Tri tu 14.0101 Sequence ID: CAH69206

 Score = 71.5 bits 343,  Expect = 6e-15
 Identities = 52/111 46%, Positives = 77/111 69%, Gaps = 6/111 5%
Query  1    MASVKFACVVVLCMV--VVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP-AGCCNGVRN 57
            MA    A VV++ +V  ++ A T   ++CGQV S L PC+++ +  G  P A CC+GVR+
Sbjct  1    MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASPSAACCSGVRS 60
Query  58   IMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            + +SARSTAD++  C C+K+AA    GLN   A  +P KCGV++PY IS+S +C+ I
Sbjct  61   LASSARSTADKQAACKCIKSAAA---GLNAGKAAGIPTKCGVSVPYAISSSVDCSKI 114

Sequence Alignment: 54. Allergen Name: Sola l 7.0101 Sequence ID: NP_001316123

 Score = 70.4 bits 337,  Expect = 1e-14
 Identities = 49/107 45%, Positives = 70/107 65%, Gaps = 5/107 4%
Query  9    VVVLCMVVVG----AHTAQG-MTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSAR 63
            + +L +VV+     A  A+G +TCGQV +NL PCV FL  GG   A CC+GVR +  + +
Sbjct  4    IAILVLVVLAVFQLAMVARGAITCGQVDANLAPCVPFLTQGGEPGAACCSGVRTLNGNTQ 63
Query  64   STADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASIN 115
            S+ DRR  CNC+K AA     L  + AQ+LP KCG+++   IS + NC +I+
Sbjct  64   SSDDRRTACNCVKAAANRYPNLKDDAAQSLPSKCGISLTVPISRTVNCDTIS 115

Sequence Alignment: 55. Allergen Name: Sin a 3.0101 Sequence ID: ABU95411

 Score = 70.1 bits 335,  Expect = 1e-14
 Identities = 47/90 52%, Positives = 57/90 63%, Gaps = 0/90 0%
Query  25   MTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRG 84
            ++CG V SNL  C+ +L     +P GCC GV N+ N AR+T DR+  C CL  AA +   
Sbjct  2    LSCGTVNSNLAACIGYLTQNAPLPKGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPS 61
Query  85   LNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            LN   A ALP  CGVNIPYKIS STNC S+
Sbjct  62   LNAARAAALPKACGVNIPYKISKSTNCNSV 91

Sequence Alignment: 56. Allergen Name: Tri a 14.0101 Sequence ID: 19846220

 Score = 69.0 bits 329,  Expect = 3e-14
 Identities = 43/89 48%, Positives = 66/89 74%, Gaps = 2/89 2%
Query  25   MTCGQVQSNLVPCVTFLQNGGFVPAG-CCNGVRNIMNSARSTADRRGICNCLKTAAGAVR 83
            + CG+V S + PC++++Q GG  P+G CC+GV+N+ N ARS +DR+  CNCLK  A  + 
Sbjct  1    IDCGHVDSLVRPCLSYVQ-GGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
Query  84   GLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
             LN +NA+++P KCGVN+PY IS + +C+ +
Sbjct  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90

Sequence Alignment: 57. Allergen Name: Hel a 3.0101 Sequence ID: P82007

 Score = 64.6 bits 305,  Expect = 8e-13
 Identities = 41/105 39%, Positives = 65/105 61%, Gaps = 4/105 3%
Query  9    VVVLCMVVVG---AHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSARST 65
            V +L M+V+     H +  +TC  V  NL PC+ +L++GG     CC G + ++ + R+ 
Sbjct  8    VAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPTPACCAGAKKLLGATRTQ 67
Query  66   ADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114
            ADRR  C C KTAA  ++ + P+ A +LPGKCG++    I+ + NC +I
Sbjct  68   ADRRTACKCAKTAAPQLK-VRPDMASSLPGKCGISTSIPINPNVNCNTI 115

Sequence Alignment: 58. Allergen Name: Amb a 6 Sequence ID: O04004

 Score = 47.9 bits 214,  Expect = 9e-08
 Identities = 37/105 35%, Positives = 54/105 51%, Gaps = 11/105 10%
Query  8    CVVVLCMVVVG--------AHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIM 59
            C+ +L  V VG           A   TC  VQ+ L PC  FL  G      CC GV N+ 
Sbjct  3    CIRILWSVAVGLLLVSWRPTMFAASPTCDTVQNILAPCAGFL-TGQEPSKACCTGVNNLN 61
Query  60   NSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYK-ISTSTNCASI 114
            NS ++ ADR  +CNC+K    ++   +P     L  KCGV   +  +  + +C+ +
Sbjct  62   NSRKTKADRVAVCNCIKELTKSI-AYDPKRMPLLSTKCGVKPDFPAVDKNLDCSKL 116

Sequence Alignment: 59. Allergen Name: Par j 2 Sequence ID: O04403

 Score = 42.3 bits 184,  Expect = 5e-06
 Identities = 30/113 26%, Positives = 60/113 53%, Gaps = 12/113 10%
Query  1    MASVKFACVVVLCMVVVGAHTAQGMT--------CGQVQSNLVPCVTFLQNGGFVPA-GC 51
            M +V  A +VV+   +    +A+  +        CG+V  +++PC+ F++     P+  C
Sbjct  1    MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSC 60
Query  52   CNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVN--IPYKISTST 109
            C+G + +    ++T  +R  C C+  A   + G+       +P KCG+   +P  I+   
Sbjct  61   CSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLP-PITADF 119
Query  110  NCASI 114
            +C+ I
Sbjct  120  DCSKI 124

Sequence Alignment: 60. Allergen Name: Par j 1 Sequence ID: Q40905

 Score = 40.5 bits 174,  Expect = 2e-05
 Identities = 25/88 28%, Positives = 45/88 51%, Gaps = 5/88 5%
Query  26   TCGQVQSNLVPCVTFLQNGGFVPA-GCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRG 84
            TCG V   L+PC+ F+Q     P+ GCC+G + +    ++   R   C C++TA      
Sbjct  39   TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 98
Query  85   LNPNNAQALPGKCGV---NIPYKISTSTNCASI 114
            ++      +P  CG+    +P  I  + +C ++
Sbjct  99   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 130

Sequence Alignment: 61. Allergen Name: Par j 2 Sequence ID: P55958

 Score = 40.3 bits 173,  Expect = 2e-05
 Identities = 29/113 25%, Positives = 58/113 51%, Gaps = 12/113 10%
Query  1    MASVKFACVVVLCMVVVGAHTAQGM--------TCGQVQSNLVPCVTFLQNGGFVPAG-C 51
            M +V  A +VV+   +    +A+           CG+V  +++PC+ F++     P+  C
Sbjct  1    MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKEC 60
Query  52   CNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVN--IPYKISTST 109
            C+G + +    ++T  +R  C C+  A   + G+       +P KC +   +P  I+   
Sbjct  61   CSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLP-PITADF 119
Query  110  NCASI 114
            +C+ I
Sbjct  120  DCSKI 124

Sequence Alignment: 62. Allergen Name: Par j 1 Sequence ID: P43217

 Score = 39.9 bits 171,  Expect = 2e-05
 Identities = 24/88 27%, Positives = 45/88 51%, Gaps = 5/88 5%
Query  26   TCGQVQSNLVPCVTFLQNGGFVPA-GCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRG 84
            TCG +   L+PC+ F+Q     P+ GCC+G + +    ++   R   C C++TA      
Sbjct  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
Query  85   LNPNNAQALPGKCGV---NIPYKISTSTNCASI 114
            ++      +P  CG+    +P  I  + +C ++
Sbjct  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94

Sequence Alignment: 63. Allergen Name: Par j 1 Sequence ID: O04404

 Score = 40.1 bits 172,  Expect = 3e-05
 Identities = 25/88 28%, Positives = 45/88 51%, Gaps = 5/88 5%
Query  26   TCGQVQSNLVPCVTFLQNGGFVPA-GCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRG 84
            TCG V   L+PC+ F+Q     P+ GCC+G + +    ++   R   C C++TA      
Sbjct  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
Query  85   LNPNNAQALPGKCGV---NIPYKISTSTNCASI 114
            ++      +P  CG+    +P  I  + +C ++
Sbjct  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 131

Sequence Alignment: 64. Allergen Name: Par j 1.0103 Sequence ID: CAI94601

 Score = 39.6 bits 169,  Expect = 3e-05
 Identities = 24/88 27%, Positives = 45/88 51%, Gaps = 5/88 5%
Query  26   TCGQVQSNLVPCVTFLQNGGFVPA-GCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRG 84
            TCG +   L+PC+ F+Q     P+ GCC+G + +    ++   R   C C++TA      
Sbjct  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
Query  85   LNPNNAQALPGKCGV---NIPYKISTSTNCASI 114
            ++      +P  CG+    +P  I  + +C ++
Sbjct  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 94

Sequence Alignment: 65. Allergen Name: Art v 3.0101 Sequence ID: P0C088

 Score = 34.3 bits 139,  Expect = 0.0003
 Identities = 15/34 44%, Positives = 24/34 70%, Gaps = 0/34 0%
Query  25   MTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNI 58
            +TC  V + + PC+++L+ GG VPA CC GV+ +
Sbjct  2    LTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGL 35

Sequence Alignment: 66. Allergen Name: Par j 1.0101 Sequence ID: CAA54587

 Score = 36.1 bits 150,  Expect = 0.0003
 Identities = 21/80 26%, Positives = 41/80 51%, Gaps = 5/80 6%
Query  34   LVPCVTFLQNGGFVPA-GCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQA 92
            L+PC+ F+Q     P+ GCC+G + +    ++   R   C C++TA      ++      
Sbjct  5    LMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSE 64
Query  93   LPGKCGV---NIPYKISTSTNCASI 114
            +P  CG+    +P  I  + +C ++
Sbjct  65   VPKHCGIVDSKLP-PIDVNMDCKTV 88

Sequence Alignment: 67. Allergen Name: Vit v 1 Sequence ID: P80274

 Score = 33.2 bits 133,  Expect = 0.0007
 Identities = 18/28 64%, Positives = 21/28 75%, Gaps = 1/28 3%
Query  25   MTCGQVQSNLVPCVTFLQNGGFVPAG-CC 52
            +TCGQV S L PC+ +LQ  G VPAG CC
Sbjct  2    VTCGQVASALSPCIDYLQKDGAVPAGSCC 30

Sequence Alignment: 68. Allergen Name: Cas s 8 Sequence ID: 10998016

 Score = 32.5 bits 129,  Expect = 0.001
 Identities = 18/32 56%, Positives = 25/32 78%, Gaps = 2/32 6%
Query  25   MTCGQVQSNLVPCVTFLQ-NGGFVPAG-CCNGVR 56
            +TC QV  +L+PC+T+L+ NGG  P G CC GV+
Sbjct  2    ITCTQVSKSLMPCLTYLKSNGGSPPPGTCCQGVK 35

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.