The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MATQCYDPENSASRYTLLPDQPDSGHRKSLKIISGIFLSVFLLLSVAFFPILNNQSPDLQ
IDSRSPAPPSRGVSQGVSDKTFRDVAGASHVSYAWSNAMLSWQRTAYHFQPQKNWMNDPN
GPLYHKGWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGS
ATILPDGQIIMLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKFKANPVLVPPPGIGVKDF
RDPITAWTGPQNGQWLLTIGSKIGKTGVALVCETSNFTSFKLLDGVLHAVPGTGMWECVD
FYPVSTKKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLGKNKWTPDNPELDCGI
GLRLDYGKYYASKTFYDPKRERRVLWGWIGETDSESADLQKGWASVQSIPRTVLYDKKTG
THLLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEVDKVALQGIIE
ADHVGFSCSTSGGAASRGILGPFGVIVIADQTLSELTPVYFYISKGADGRAETHFCADQT
RSSEAPGVGKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGA
ARLFVFNNATGASVTASVKIWSLESANIQSFPLQDL
Sequence Info Allergen Name Length Opt Bits Score E Value
Q8RVW4 Sola l 2.0201 636 4348 997.3 0
AAL75450 Lyc e 2.0102 636 4348 997.3 0
AAB30874 Lyc e 2.0102 636 4281 982.0 0
Q547Q0 Sola l 2.0101 553 3714 852.8 0
AAL75449 Lyc e 2.0101 553 3714 852.8 0
BAA01954 Lyc e 2.0101 461 3107 714.5 4e-207
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Sola l 2.0201 Sequence ID: Q8RVW4

 Score = 997.3 bits 4348,  Expect = 0
 Identities = 636/636 100%, Positives = 636/636 100%, Gaps = 0/636 0%
Query  1    MATQCYDPENSASRYTLLPDQPDSGHRKSLKIISGIFLSVFLLLSVAFFPILNNQSPDLQ 60
            MATQCYDPENSASRYTLLPDQPDSGHRKSLKIISGIFLSVFLLLSVAFFPILNNQSPDLQ
Sbjct  1    MATQCYDPENSASRYTLLPDQPDSGHRKSLKIISGIFLSVFLLLSVAFFPILNNQSPDLQ 60
Query  61   IDSRSPAPPSRGVSQGVSDKTFRDVAGASHVSYAWSNAMLSWQRTAYHFQPQKNWMNDPN 120
            IDSRSPAPPSRGVSQGVSDKTFRDVAGASHVSYAWSNAMLSWQRTAYHFQPQKNWMNDPN
Sbjct  61   IDSRSPAPPSRGVSQGVSDKTFRDVAGASHVSYAWSNAMLSWQRTAYHFQPQKNWMNDPN 120
Query  121  GPLYHKGWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGS 180
            GPLYHKGWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGS
Sbjct  121  GPLYHKGWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGS 180
Query  181  ATILPDGQIIMLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKFKANPVLVPPPGIGVKDF 240
            ATILPDGQIIMLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKFKANPVLVPPPGIGVKDF
Sbjct  181  ATILPDGQIIMLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKFKANPVLVPPPGIGVKDF 240
Query  241  RDPITAWTGPQNGQWLLTIGSKIGKTGVALVCETSNFTSFKLLDGVLHAVPGTGMWECVD 300
            RDPITAWTGPQNGQWLLTIGSKIGKTGVALVCETSNFTSFKLLDGVLHAVPGTGMWECVD
Sbjct  241  RDPITAWTGPQNGQWLLTIGSKIGKTGVALVCETSNFTSFKLLDGVLHAVPGTGMWECVD 300
Query  301  FYPVSTKKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLGKNKWTPDNPELDCGI 360
            FYPVSTKKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLGKNKWTPDNPELDCGI
Sbjct  301  FYPVSTKKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLGKNKWTPDNPELDCGI 360
Query  361  GLRLDYGKYYASKTFYDPKRERRVLWGWIGETDSESADLQKGWASVQSIPRTVLYDKKTG 420
            GLRLDYGKYYASKTFYDPKRERRVLWGWIGETDSESADLQKGWASVQSIPRTVLYDKKTG
Sbjct  361  GLRLDYGKYYASKTFYDPKRERRVLWGWIGETDSESADLQKGWASVQSIPRTVLYDKKTG 420
Query  421  THLLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEVDKVALQGIIE 480
            THLLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEVDKVALQGIIE
Sbjct  421  THLLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEVDKVALQGIIE 480
Query  481  ADHVGFSCSTSGGAASRGILGPFGVIVIADQTLSELTPVYFYISKGADGRAETHFCADQT 540
            ADHVGFSCSTSGGAASRGILGPFGVIVIADQTLSELTPVYFYISKGADGRAETHFCADQT
Sbjct  481  ADHVGFSCSTSGGAASRGILGPFGVIVIADQTLSELTPVYFYISKGADGRAETHFCADQT 540
Query  541  RSSEAPGVGKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGA 600
            RSSEAPGVGKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGA
Sbjct  541  RSSEAPGVGKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGA 600
Query  601  ARLFVFNNATGASVTASVKIWSLESANIQSFPLQDL 636
            ARLFVFNNATGASVTASVKIWSLESANIQSFPLQDL
Sbjct  601  ARLFVFNNATGASVTASVKIWSLESANIQSFPLQDL 636

Sequence Alignment: 2. Allergen Name: Lyc e 2.0102 Sequence ID: AAL75450

 Score = 997.3 bits 4348,  Expect = 0
 Identities = 636/636 100%, Positives = 636/636 100%, Gaps = 0/636 0%
Query  1    MATQCYDPENSASRYTLLPDQPDSGHRKSLKIISGIFLSVFLLLSVAFFPILNNQSPDLQ 60
            MATQCYDPENSASRYTLLPDQPDSGHRKSLKIISGIFLSVFLLLSVAFFPILNNQSPDLQ
Sbjct  1    MATQCYDPENSASRYTLLPDQPDSGHRKSLKIISGIFLSVFLLLSVAFFPILNNQSPDLQ 60
Query  61   IDSRSPAPPSRGVSQGVSDKTFRDVAGASHVSYAWSNAMLSWQRTAYHFQPQKNWMNDPN 120
            IDSRSPAPPSRGVSQGVSDKTFRDVAGASHVSYAWSNAMLSWQRTAYHFQPQKNWMNDPN
Sbjct  61   IDSRSPAPPSRGVSQGVSDKTFRDVAGASHVSYAWSNAMLSWQRTAYHFQPQKNWMNDPN 120
Query  121  GPLYHKGWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGS 180
            GPLYHKGWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGS
Sbjct  121  GPLYHKGWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGS 180
Query  181  ATILPDGQIIMLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKFKANPVLVPPPGIGVKDF 240
            ATILPDGQIIMLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKFKANPVLVPPPGIGVKDF
Sbjct  181  ATILPDGQIIMLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKFKANPVLVPPPGIGVKDF 240
Query  241  RDPITAWTGPQNGQWLLTIGSKIGKTGVALVCETSNFTSFKLLDGVLHAVPGTGMWECVD 300
            RDPITAWTGPQNGQWLLTIGSKIGKTGVALVCETSNFTSFKLLDGVLHAVPGTGMWECVD
Sbjct  241  RDPITAWTGPQNGQWLLTIGSKIGKTGVALVCETSNFTSFKLLDGVLHAVPGTGMWECVD 300
Query  301  FYPVSTKKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLGKNKWTPDNPELDCGI 360
            FYPVSTKKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLGKNKWTPDNPELDCGI
Sbjct  301  FYPVSTKKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLGKNKWTPDNPELDCGI 360
Query  361  GLRLDYGKYYASKTFYDPKRERRVLWGWIGETDSESADLQKGWASVQSIPRTVLYDKKTG 420
            GLRLDYGKYYASKTFYDPKRERRVLWGWIGETDSESADLQKGWASVQSIPRTVLYDKKTG
Sbjct  361  GLRLDYGKYYASKTFYDPKRERRVLWGWIGETDSESADLQKGWASVQSIPRTVLYDKKTG 420
Query  421  THLLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEVDKVALQGIIE 480
            THLLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEVDKVALQGIIE
Sbjct  421  THLLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEVDKVALQGIIE 480
Query  481  ADHVGFSCSTSGGAASRGILGPFGVIVIADQTLSELTPVYFYISKGADGRAETHFCADQT 540
            ADHVGFSCSTSGGAASRGILGPFGVIVIADQTLSELTPVYFYISKGADGRAETHFCADQT
Sbjct  481  ADHVGFSCSTSGGAASRGILGPFGVIVIADQTLSELTPVYFYISKGADGRAETHFCADQT 540
Query  541  RSSEAPGVGKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGA 600
            RSSEAPGVGKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGA
Sbjct  541  RSSEAPGVGKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGA 600
Query  601  ARLFVFNNATGASVTASVKIWSLESANIQSFPLQDL 636
            ARLFVFNNATGASVTASVKIWSLESANIQSFPLQDL
Sbjct  601  ARLFVFNNATGASVTASVKIWSLESANIQSFPLQDL 636

Sequence Alignment: 3. Allergen Name: Lyc e 2.0102 Sequence ID: AAB30874

 Score = 982.0 bits 4281,  Expect = 0
 Identities = 625/636 98%, Positives = 631/636 99%, Gaps = 0/636 0%
Query  1    MATQCYDPENSASRYTLLPDQPDSGHRKSLKIISGIFLSVFLLLSVAFFPILNNQSPDLQ 60
            MATQCYDPENSASRYTLLPDQPDSGHRKSLKIISGIFLSVFLLLSVAFFPILNNQSPDLQ
Sbjct  1    MATQCYDPENSASRYTLLPDQPDSGHRKSLKIISGIFLSVFLLLSVAFFPILNNQSPDLQ 60
Query  61   IDSRSPAPPSRGVSQGVSDKTFRDVAGASHVSYAWSNAMLSWQRTAYHFQPQKNWMNDPN 120
            IDSRSPAPPSRGVSQGVSDKTFRDVAGASHVSYAWSNAMLSWQRTAYHFQPQKNWMNDPN
Sbjct  61   IDSRSPAPPSRGVSQGVSDKTFRDVAGASHVSYAWSNAMLSWQRTAYHFQPQKNWMNDPN 120
Query  121  GPLYHKGWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGS 180
            GPLYHKGWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGS
Sbjct  121  GPLYHKGWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGS 180
Query  181  ATILPDGQIIMLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKFKANPVLVPPPGIGVKDF 240
            ATILPDGQI+MLYTGDTDDYVQVQNLAYPANLSDPLLLDWVK+K NPVLVPPPGIGVKDF
Sbjct  181  ATILPDGQIMMLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKLKGNPVLVPPPGIGVKDF 240
Query  241  RDPITAWTGPQNGQWLLTIGSKIGKTGVALVCETSNFTSFKLLDGVLHAVPGTGMWECVD 300
            RDP T WTGPQNGQWLLTIGSKIGKTGVALV ETSNFTSFKLLDGVLHAVPGTGMWECVD
Sbjct  241  RDPTTRWTGPQNGQWLLTIGSKIGKTGVALVYETSNFTSFKLLDGVLHAVPGTGMWECVD 300
Query  301  FYPVSTKKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLGKNKWTPDNPELDCGI 360
            FYPVSTKKTNGL+TSYNGPGVKHVLKASLDDNKQDHYAIGTYDLGKNKWTPDNPELDCGI
Sbjct  301  FYPVSTKKTNGLETSYNGPGVKHVLKASLDDNKQDHYAIGTYDLGKNKWTPDNPELDCGI 360
Query  361  GLRLDYGKYYASKTFYDPKRERRVLWGWIGETDSESADLQKGWASVQSIPRTVLYDKKTG 420
            GLRLDYGKYYASKTFYDPK+ERRVLWGWIGETDSESADLQKGWASVQSIPRTVLYDKKTG
Sbjct  361  GLRLDYGKYYASKTFYDPKKERRVLWGWIGETDSESADLQKGWASVQSIPRTVLYDKKTG 420
Query  421  THLLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEVDKVALQGIIE 480
            THLLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEVDKVALQGIIE
Sbjct  421  THLLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEVDKVALQGIIE 480
Query  481  ADHVGFSCSTSGGAASRGILGPFGVIVIADQTLSELTPVYFYISKGADGRAETHFCADQT 540
            ADHVGFSCSTSGGAASRGILGPFGVIVIADQTLS++TPVYFYISKGADGRAETHFCADQT
Sbjct  481  ADHVGFSCSTSGGAASRGILGPFGVIVIADQTLSDVTPVYFYISKGADGRAETHFCADQT 540
Query  541  RSSEAPGVGKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGA 600
            RSSEAPGVGKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGA
Sbjct  541  RSSEAPGVGKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAVNGA 600
Query  601  ARLFVFNNATGASVTASVKIWSLESANIQSFPLQDL 636
            ARLFVFNNATGASVTASVKIWSLES NIQSFPLQDL
Sbjct  601  ARLFVFNNATGASVTASVKIWSLESVNIQSFPLQDL 636

Sequence Alignment: 4. Allergen Name: Sola l 2.0101 Sequence ID: Q547Q0

 Score = 852.8 bits 3714,  Expect = 0
 Identities = 536/541 99%, Positives = 538/541 99%, Gaps = 0/541 0%
Query  1    MATQCYDPENSASRYTLLPDQPDSGHRKSLKIISGIFLSVFLLLSVAFFPILNNQSPDLQ 60
            MATQCYDPENSASRYTLLPDQPDSGHRKSLKIISGIFLSVFLLLSVAFFPILNNQSPDLQ
Sbjct  1    MATQCYDPENSASRYTLLPDQPDSGHRKSLKIISGIFLSVFLLLSVAFFPILNNQSPDLQ 60
Query  61   IDSRSPAPPSRGVSQGVSDKTFRDVAGASHVSYAWSNAMLSWQRTAYHFQPQKNWMNDPN 120
            IDSRSPAPPSRGVSQGVSDKTFRDVAGASHVSYAWSNAMLSWQRTAYHFQPQKNWMNDPN
Sbjct  61   IDSRSPAPPSRGVSQGVSDKTFRDVAGASHVSYAWSNAMLSWQRTAYHFQPQKNWMNDPN 120
Query  121  GPLYHKGWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGS 180
            GPLYHKGWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGS
Sbjct  121  GPLYHKGWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGS 180
Query  181  ATILPDGQIIMLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKFKANPVLVPPPGIGVKDF 240
            ATILPDGQI+MLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKFK NPVLVPPPGIGVKDF
Sbjct  181  ATILPDGQIMMLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKFKGNPVLVPPPGIGVKDF 240
Query  241  RDPITAWTGPQNGQWLLTIGSKIGKTGVALVCETSNFTSFKLLDGVLHAVPGTGMWECVD 300
            RDP TAWTGPQNGQWLLTIGSKIGKTGVALV ETSNFTSFKLLDGVLHAVPGTGMWECVD
Sbjct  241  RDPTTAWTGPQNGQWLLTIGSKIGKTGVALVYETSNFTSFKLLDGVLHAVPGTGMWECVD 300
Query  301  FYPVSTKKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLGKNKWTPDNPELDCGI 360
            FYPVSTKKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLGKNKWTPDNPELDCGI
Sbjct  301  FYPVSTKKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLGKNKWTPDNPELDCGI 360
Query  361  GLRLDYGKYYASKTFYDPKRERRVLWGWIGETDSESADLQKGWASVQSIPRTVLYDKKTG 420
            GLRLDYGKYYASKTFYDPK+ERRVLWGWIGETDSESADLQKGWASVQSIPRTVLYDKKTG
Sbjct  361  GLRLDYGKYYASKTFYDPKKERRVLWGWIGETDSESADLQKGWASVQSIPRTVLYDKKTG 420
Query  421  THLLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEVDKVALQGIIE 480
            THLLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEVDKVALQGIIE
Sbjct  421  THLLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEVDKVALQGIIE 480
Query  481  ADHVGFSCSTSGGAASRGILGPFGVIVIADQTLSELTPVYFYISKGADGRAETHFCADQT 540
            ADHVGFSCSTSGGAASRGILGPFGVIVIADQTLSELTPVYFYISKGADGRAETHFCADQT
Sbjct  481  ADHVGFSCSTSGGAASRGILGPFGVIVIADQTLSELTPVYFYISKGADGRAETHFCADQT 540
Query  541  R 541
            R
Sbjct  541  R 541

Sequence Alignment: 5. Allergen Name: Lyc e 2.0101 Sequence ID: AAL75449

 Score = 852.8 bits 3714,  Expect = 0
 Identities = 536/541 99%, Positives = 538/541 99%, Gaps = 0/541 0%
Query  1    MATQCYDPENSASRYTLLPDQPDSGHRKSLKIISGIFLSVFLLLSVAFFPILNNQSPDLQ 60
            MATQCYDPENSASRYTLLPDQPDSGHRKSLKIISGIFLSVFLLLSVAFFPILNNQSPDLQ
Sbjct  1    MATQCYDPENSASRYTLLPDQPDSGHRKSLKIISGIFLSVFLLLSVAFFPILNNQSPDLQ 60
Query  61   IDSRSPAPPSRGVSQGVSDKTFRDVAGASHVSYAWSNAMLSWQRTAYHFQPQKNWMNDPN 120
            IDSRSPAPPSRGVSQGVSDKTFRDVAGASHVSYAWSNAMLSWQRTAYHFQPQKNWMNDPN
Sbjct  61   IDSRSPAPPSRGVSQGVSDKTFRDVAGASHVSYAWSNAMLSWQRTAYHFQPQKNWMNDPN 120
Query  121  GPLYHKGWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGS 180
            GPLYHKGWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGS
Sbjct  121  GPLYHKGWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGS 180
Query  181  ATILPDGQIIMLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKFKANPVLVPPPGIGVKDF 240
            ATILPDGQI+MLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKFK NPVLVPPPGIGVKDF
Sbjct  181  ATILPDGQIMMLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKFKGNPVLVPPPGIGVKDF 240
Query  241  RDPITAWTGPQNGQWLLTIGSKIGKTGVALVCETSNFTSFKLLDGVLHAVPGTGMWECVD 300
            RDP TAWTGPQNGQWLLTIGSKIGKTGVALV ETSNFTSFKLLDGVLHAVPGTGMWECVD
Sbjct  241  RDPTTAWTGPQNGQWLLTIGSKIGKTGVALVYETSNFTSFKLLDGVLHAVPGTGMWECVD 300
Query  301  FYPVSTKKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLGKNKWTPDNPELDCGI 360
            FYPVSTKKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLGKNKWTPDNPELDCGI
Sbjct  301  FYPVSTKKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLGKNKWTPDNPELDCGI 360
Query  361  GLRLDYGKYYASKTFYDPKRERRVLWGWIGETDSESADLQKGWASVQSIPRTVLYDKKTG 420
            GLRLDYGKYYASKTFYDPK+ERRVLWGWIGETDSESADLQKGWASVQSIPRTVLYDKKTG
Sbjct  361  GLRLDYGKYYASKTFYDPKKERRVLWGWIGETDSESADLQKGWASVQSIPRTVLYDKKTG 420
Query  421  THLLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEVDKVALQGIIE 480
            THLLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEVDKVALQGIIE
Sbjct  421  THLLQWPVEEIESLRVGDPTVKQVDLQPGSIELLRVDSAAELDIEASFEVDKVALQGIIE 480
Query  481  ADHVGFSCSTSGGAASRGILGPFGVIVIADQTLSELTPVYFYISKGADGRAETHFCADQT 540
            ADHVGFSCSTSGGAASRGILGPFGVIVIADQTLSELTPVYFYISKGADGRAETHFCADQT
Sbjct  481  ADHVGFSCSTSGGAASRGILGPFGVIVIADQTLSELTPVYFYISKGADGRAETHFCADQT 540
Query  541  R 541
            R
Sbjct  541  R 541

Sequence Alignment: 6. Allergen Name: Lyc e 2.0101 Sequence ID: BAA01954

 Score = 714.5 bits 3107,  Expect = 4e-207
 Identities = 444/449 98%, Positives = 446/449 99%, Gaps = 0/449 0%
Query  93   YAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVS 152
            YAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVS
Sbjct  1    YAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVS 60
Query  153  KDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIIMLYTGDTDDYVQVQNLAYPANL 212
            KDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQI+MLYTGDTDDYVQVQNLAYPANL
Sbjct  61   KDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYPANL 120
Query  213  SDPLLLDWVKFKANPVLVPPPGIGVKDFRDPITAWTGPQNGQWLLTIGSKIGKTGVALVC 272
            SDPLLLDWVKFK NPVLVPPPGIGVKDFRDP TAWTGPQNGQWLLTIGSKIGKTGVALV 
Sbjct  121  SDPLLLDWVKFKGNPVLVPPPGIGVKDFRDPTTAWTGPQNGQWLLTIGSKIGKTGVALVY 180
Query  273  ETSNFTSFKLLDGVLHAVPGTGMWECVDFYPVSTKKTNGLDTSYNGPGVKHVLKASLDDN 332
            ETSNFTSFKLLDGVLHAVPGTGMWECVDFYPVSTKKTNGLDTSYNGPGVKHVLKASLDDN
Sbjct  181  ETSNFTSFKLLDGVLHAVPGTGMWECVDFYPVSTKKTNGLDTSYNGPGVKHVLKASLDDN 240
Query  333  KQDHYAIGTYDLGKNKWTPDNPELDCGIGLRLDYGKYYASKTFYDPKRERRVLWGWIGET 392
            KQDHYAIGTYDLGKNKWTPDNPELDCGIGLRLDYGKYYASKTFYDPK+ERRVLWGWIGET
Sbjct  241  KQDHYAIGTYDLGKNKWTPDNPELDCGIGLRLDYGKYYASKTFYDPKKERRVLWGWIGET 300
Query  393  DSESADLQKGWASVQSIPRTVLYDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIE 452
            DSESADLQKGWASVQSIPRTVLYDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIE
Sbjct  301  DSESADLQKGWASVQSIPRTVLYDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIE 360
Query  453  LLRVDSAAELDIEASFEVDKVALQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQT 512
            LLRVDSAAELDIEASFEVDKVALQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQT
Sbjct  361  LLRVDSAAELDIEASFEVDKVALQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQT 420
Query  513  LSELTPVYFYISKGADGRAETHFCADQTR 541
            LSELTPVYFYISKGADGRAETHFCADQTR
Sbjct  421  LSELTPVYFYISKGADGRAETHFCADQTR 449

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.