The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MATVEVTPAVTALPENETADEVTKPQEPQPEAAVAAPPAPAEPVTEEPEKAAPEAVEAPE
EPAATDAKDPAEVAEAEEEVVEEPQEVPEEPVAEAAAKEVEATEGKAEPTGEMKDKTPEA
TDAPEAPAAAEEPTDAPEAPAVAEEPTNAPEAPAVGEEPEAKEGKPDEAVEEASTEVPVD
KTEE
Sequence Info Allergen Name Length Opt Bits Score E Value
AAA53071 Act d a 184 1178 186.2 4.9e-49
Q39967 Hev b 5 150 303 55.5 8.7e-10
AAC49447 Hev b 5 151 303 55.5 8.8e-10
Q9XF96 Pru ar 5.0101 168 272 50.8 2.5e-08
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Act d a Sequence ID: AAA53071

 Score = 186.2 bits 1178,  Expect = 5e-49
 Identities = 184/184 100%, Positives = 184/184 100%, Gaps = 0/184 0%
Query  1    MATVEVTPAVTALPENETADEVTKPQEPQPEAAVAAPPAPAEPVTEEPEKAAPEAVEAPE 60
            MATVEVTPAVTALPENETADEVTKPQEPQPEAAVAAPPAPAEPVTEEPEKAAPEAVEAPE
Sbjct  1    MATVEVTPAVTALPENETADEVTKPQEPQPEAAVAAPPAPAEPVTEEPEKAAPEAVEAPE 60
Query  61   EPAATDAKDPAEVAEAEEEVVEEPQEVPEEPVAEAAAKEVEATEGKAEPTGEMKDKTPEA 120
            EPAATDAKDPAEVAEAEEEVVEEPQEVPEEPVAEAAAKEVEATEGKAEPTGEMKDKTPEA
Sbjct  61   EPAATDAKDPAEVAEAEEEVVEEPQEVPEEPVAEAAAKEVEATEGKAEPTGEMKDKTPEA 120
Query  121  TDAPEAPAAAEEPTDAPEAPAVAEEPTNAPEAPAVGEEPEAKEGKPDEAVEEASTEVPVD 180
            TDAPEAPAAAEEPTDAPEAPAVAEEPTNAPEAPAVGEEPEAKEGKPDEAVEEASTEVPVD
Sbjct  121  TDAPEAPAAAEEPTDAPEAPAVAEEPTNAPEAPAVGEEPEAKEGKPDEAVEEASTEVPVD 180
Query  181  KTEE 184
            KTEE
Sbjct  181  KTEE 184

Sequence Alignment: 2. Allergen Name: Hev b 5 Sequence ID: Q39967

 Score = 55.5 bits 303,  Expect = 9e-10
 Identities = 80/149 53%, Positives = 90/149 60%, Gaps = 35/149 23%
Query  2    ATVEVTPAVTALPENETADEVTKPQEPQPEAAVAAPPAPAEPVTEEPEKAAPEAVEAPEE 61
            A+VEV  A TALP+NET  EVTK +E + E   A P +  E     PEK  P A  AP E
Sbjct  1    ASVEVESAATALPKNETP-EVTKAEETKTEEPAAPPASEQETADATPEKEEPTA--APAE 57
Query  62   PAATDAKDPAEVAEAEEEVVEEPQEVPEEPVAEAAAKEVEATEGKAEPTGEMKDKTPEAT 121
            P A     PA                PE   AE    EVE  E   EP  E    TPE  
Sbjct  58   PEA-----PA----------------PETEKAE----EVEKIEKTEEPAPEADQTTPEEK 92
Query  122  DAPEAPAAAEEPTDAPEAPAVAEEPTNAPEAPAVGEEPEAKEGKP-DEAVEEASTEVPVD 180
             A   P A EEP    +     E  T AP APA GE+P A+E KP  EA E A+TEVPV+
Sbjct  93   PAEPEPVAEEEPKHETK-----ETETEAPAAPAEGEKP-AEEEKPITEAAETATTEVPVE 146
Query  181  KTEE 184
            KTEE
Sbjct  147  KTEE 150

Sequence Alignment: 3. Allergen Name: Hev b 5 Sequence ID: AAC49447

 Score = 55.5 bits 303,  Expect = 9e-10
 Identities = 81/150 54%, Positives = 91/150 60%, Gaps = 35/150 23%
Query  1    MATVEVTPAVTALPENETADEVTKPQEPQPEAAVAAPPAPAEPVTEEPEKAAPEAVEAPE 60
            MA+VEV  A TALP+NET  EVTK +E + E   A P +  E     PEK  P A  AP 
Sbjct  1    MASVEVESAATALPKNETP-EVTKAEETKTEEPAAPPASEQETADATPEKEEPTA--APA 57
Query  61   EPAATDAKDPAEVAEAEEEVVEEPQEVPEEPVAEAAAKEVEATEGKAEPTGEMKDKTPEA 120
            EP A     PA                PE   AE    EVE  E   EP  E    TPE 
Sbjct  58   EPEA-----PA----------------PETEKAE----EVEKIEKTEEPAPEADQTTPEE 92
Query  121  TDAPEAPAAAEEPTDAPEAPAVAEEPTNAPEAPAVGEEPEAKEGKP-DEAVEEASTEVPV 179
              A   P A EEP    +     E  T AP APA GE+P A+E KP  EA E A+TEVPV
Sbjct  93   KPAEPEPVAEEEPKHETK-----ETETEAPAAPAEGEKP-AEEEKPITEAAETATTEVPV 146
Query  180  DKTEE 184
            +KTEE
Sbjct  147  EKTEE 151

Sequence Alignment: 4. Allergen Name: Pru ar 5.0101 Sequence ID: Q9XF96

 Score = 50.8 bits 272,  Expect = 3e-08
 Identities = 82/159 51%, Positives = 99/159 62%, Gaps = 34/159 21%
Query  1    MATVEVTPAVTALPENETAD-EVTKPQEPQPEAAVAAPPAPAEP-----VTEEPEKAAPE 54
            MATVEV PA T L ENE    EV K +E  PE  VAA PA A P      TEEP++  P 
Sbjct  1    MATVEVAPAAT-LQENEAKTVEVIKTEEKTPEEPVAAAPA-AVPESEAATTEEPKETTPV 58
Query  55   AVEAPEE---PAATDAKDPAEVAEAEEEVVEEPQEVPEEPVAEAAAKEVEATEGKAEPTG 111
              EA  E   PAA +A+ P       +EV EEP+       AEA A+E  ATE   E T 
Sbjct  59   EAEAEAEAEAPAAPEAETPVPAEVETKEVAEEPK------AAEAEAEEPAATE--TEKTE 110
Query  112  EMKDKTPEATDAPEAPAAAEEPTDAPEAPAVAEEPTNAPEAPAVGEEPEAKEGKPDEAVE 171
            + + + P+   A E  AA  E T         EE T + E PA    P A+E    E  E
Sbjct  111  KTEAEEPKEVTAAEPVAAVAEETK--------EETTESAETPAA---PPAEE----EKAE 155
Query  172  EASTEVPVDKTEE 184
            EA+T+VPV+KTEE
Sbjct  156  EATTDVPVEKTEE 168

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.