The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATPATPATPAAVP
SGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNKAFVEGLASGYAD
QSKNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEV
KVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKF
IPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA
TATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
Sequence Info Allergen Name Length Opt Bits Score E Value
Q40237 Lol p 5 339 2048 473.3 6.3e-135
CAA52753 Phl p 5.0101 312 1372 319.2 1.4e-88
P22285 Poa p 5 333 1361 316.7 8.5e-88
P22286 Poa p 5 307 1259 293.5 7.6e-81
CAD87529 Phl p 5.0109 284 1229 286.7 7.9e-79
Q40962 Phl p 5.0102 286 1202 280.5 5.7e-77
AAC16527 Phl p 5.0107 276 1187 277.1 5.8e-76
AAC16526 Phl p 5.0106 276 1173 273.9 5.3e-75
AAC16528 Phl p 5.0108 276 1168 272.8 1.2e-74
AAC16525 Phl p 5.0105 276 1155 269.8 9.2e-74
CAB05372 Phl p 5.0104 276 1142 266.8 7.1e-73
P22284 Poa p 5 373 1130 264.0 6.9e-72
AAK25823 Phl p 5 275 1039 243.4 8.3e-66
AAK62277 Dac g 5.02 265 1018 238.6 2.2e-64
CAB10765 Hol l 5.0101 264 1014 237.7 4.1e-64
AAK62276 Dac g 5.01 265 1001 234.7 3.2e-63
AAD20386 Lol p 5 301 1000 234.4 4.4e-63
CBG76811 Sec c 5.0101 292 948 222.6 1.6e-59
Q9FPR0 Poa p 5.0101 303 902 212.1 2.4e-56
CAB10766 Hol l 5.0201 240 878 206.7 7.7e-55
P56164 Pha a 5 320 796 187.9 4.7e-49
U57845 Hor v 5.0101 313 744 176.1 1.7e-45
Q40963 Phl p 5.0201 284 741 175.4 2.4e-45
CAB05371 Phl p 5.0202 281 729 172.7 1.6e-44
AAC25996 Phl p 5.0204 265 728 172.5 1.7e-44
9249029 Phl p 5.0205 265 717 170.0 9.9e-44
P56167 Pha a 5 175 624 149.0 1.3e-37
P56165 Pha a 5 305 625 149.0 2.4e-37
Q40240 Lol p 5 308 567 135.7 2.3e-33
P56166 Pha a 5 294 472 114.1 7.3e-27
P43215 Phl p 6.0101 132 373 92.1 1.4e-20
CAA76556 Phl p 6.0102 138 367 90.7 3.9e-20
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Lol p 5 Sequence ID: Q40237

 Score = 473.3 bits 2048,  Expect = 6e-135
 Identities = 339/339 100%, Positives = 339/339 100%, Gaps = 0/339 0%
Query  1    MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATPATPATPAAVP 60
            MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATPATPATPAAVP
Sbjct  1    MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATPATPATPAAVP 60
Query  61   SGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNKAFVEGLASGYAD 120
            SGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNKAFVEGLASGYAD
Sbjct  61   SGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNKAFVEGLASGYAD 120
Query  121  QSKNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEV 180
            QSKNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEV
Sbjct  121  QSKNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEV 180
Query  181  KVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKF 240
            KVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKF
Sbjct  181  KVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKF 240
Query  241  IPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA 300
            IPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA
Sbjct  241  IPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA 300
Query  301  TATATPAAAYATATPAAATATATPAAATATPAAAGGYKV 339
            TATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
Sbjct  301  TATATPAAAYATATPAAATATATPAAATATPAAAGGYKV 339

Sequence Alignment: 2. Allergen Name: Phl p 5.0101 Sequence ID: CAA52753

 Score = 319.2 bits 1372,  Expect = 1e-88
 Identities = 237/302 78%, Positives = 259/302 85%, Gaps = 11/302 3%
Query  1    MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATPATPATPAAVP 60
            MAV+++TVALFLAVALVAGPAASYAAD GY PATP   AAPA   TPATPA PA   A P
Sbjct  1    MAVHQYTVALFLAVALVAGPAASYAADLGYGPATP---AAPAAGYTPATPAAPAE--AAP 55
Query  61   SGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNKAFVEGLAS---G 117
            +GKATTEEQKLIEKINAGFKAA+AAAA V PADKY+TFV TFG A+NKAF EGL+    G
Sbjct  56   AGKATTEEQKLIEKINAGFKAALAAAAGVQPADKYRTFVATFGAASNKAFAEGLSGEPKG 115
Query  118  YADQS-KNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPA 176
             A+ S K  LTSKLDAA KLAY+ A+GATPEAKYDAYVATL+EALR+IAGTLEVHAVKPA
Sbjct  116  AAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPA 175
Query  177  AEEVKVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYD 236
            AEEVKV  IPA E+Q+I+KVDAA++ AATAANAAPANDKFTVFE  FN+AIK S G AY+
Sbjct  176  AEEVKV--IPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYE 233
Query  237  SYKFIPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPT 296
            SYKFIP L AAVKQAYAA  ATAPEVKYTV ETALKKA+TAMSEA+K A PAAAATAT T
Sbjct  234  SYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATAT 293
Query  297  PAAATATATPAAA 309
             A   AT    AA
Sbjct  294  AAVGAATGAATAA 306

Sequence Alignment: 3. Allergen Name: Poa p 5 Sequence ID: P22285

 Score = 316.7 bits 1361,  Expect = 8e-88
 Identities = 248/328 75%, Positives = 269/328 82%, Gaps = 16/328 4%
Query  1    MAVQKHTVALFLAVALVAGPAASYAADAGY-APATPATPAAPATAATPATPATPATPAAV 59
            MAV+++TVALFLAVALVAGPAASYAAD GY APAT ATPA PA  A   TPA PA   A 
Sbjct  1    MAVHQYTVALFLAVALVAGPAASYAADVGYGAPATLATPATPAAPAAGYTPAAPA--GAA 58
Query  60   PSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNKAFVEGLAS--- 116
            P  KATT+EQKLIEKINAGFKAAVAAAA VP  DKYKTFV TFGTA+NKAF E L++   
Sbjct  59   P--KATTDEQKLIEKINAGFKAAVAAAAGVPAVDKYKTFVATFGTASNKAFAEALSTEPK 116
Query  117  GYADQSKNQ-LTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTLEVHAVKP 175
            G A  S N  LTSKLDAA KLAY++A+GATPEAKYDAYVATL+EALR+IAGTLEVHAVKP
Sbjct  117  GAAAASSNAVLTSKLDAAYKLAYKSAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKP 176
Query  176  AAEEVKVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAY 235
            A EEVK  AIPA E+Q+IDKVDAA++ AATAANAAPANDKFTVFE  FN+AIK S G AY
Sbjct  177  AGEEVK--AIPAGELQVIDKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAY 234
Query  236  DSYKFIPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATP 295
             SYKFIP L AAVKQ+YAA  ATAP VKYTV ETALKKA+TAMS+A+K A PAAA TAT 
Sbjct  235  QSYKFIPALEAAVKQSYAATVATAPAVKYTVFETALKKAITAMSQAQKAAKPAAAVTATA 294
Query  296  TPAAATATATPAAAYATATPAAATATATPAAATATPAAAGGYKV 339
            T A   AT    AA   AT AAA    T A   ATP A GGYKV
Sbjct  295  TGAVGAATGAVGAATGAAT-AAAGGYKTGA---ATPTA-GGYKV 333

Sequence Alignment: 4. Allergen Name: Poa p 5 Sequence ID: P22286

 Score = 293.5 bits 1259,  Expect = 8e-81
 Identities = 226/296 76%, Positives = 247/296 83%, Gaps = 18/296 6%
Query  1    MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATPATPATPAAVP 60
            MAVQK+TVALFL VALV GPAASYAAD  Y    PATPAAPA   TPA PA      A P
Sbjct  1    MAVQKYTVALFL-VALVVGPAASYAADLSYG--APATPAAPAAGYTPAAPA-----GAAP 52
Query  61   SGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNKAFVEGLAS---G 117
              KATT+EQK+IEKIN GFKAAVAAA  VP A+KYKTFV TFG A+NKAF E L++   G
Sbjct  53   --KATTDEQKMIEKINVGFKAAVAAAGGVPAANKYKTFVATFGAASNKAFAEALSTEPKG 110
Query  118  YA-DQSKNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPA 176
             A D SK  LTSKLDAA KLAY++A+GATPEAKYD YVATL+EALR+IAGTLEVH VKPA
Sbjct  111  AAVDSSKAALTSKLDAAYKLAYKSAEGATPEAKYDDYVATLSEALRIIAGTLEVHGVKPA 170
Query  177  AEEVKVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYD 236
            AEEVK  A PA E+Q+IDKVDAA++ AATAANAAPANDKFTVFE  FN+AIK S G AY 
Sbjct  171  AEEVK--ATPAGELQVIDKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYQ 228
Query  237  SYKFIPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPT 296
            SYKFIP L AAVKQ+YAA  ATAP VKYTV ETALKKA+TAMS+A+K A PAAAAT T T
Sbjct  229  SYKFIPALEAAVKQSYAATVATAPAVKYTVFETALKKAITAMSQAQKAAKPAAAATGTAT 288
Query  297  PA--AATATATPAA 308
             A  AAT  AT AA
Sbjct  289  AAVGAATGAATAAA 302

Sequence Alignment: 5. Allergen Name: Phl p 5.0109 Sequence ID: CAD87529

 Score = 286.7 bits 1229,  Expect = 8e-79
 Identities = 214/274 78%, Positives = 232/274 84%, Gaps = 14/274 5%
Query  26   ADAGYAPATPATPAAPATAATPATPATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAA 85
            AD GY PAT   PAAPA   TPA PA      A P+GKATTEEQKLIEKINAGFKAA+AA
Sbjct  1    ADLGYGPAT---PAAPAAGYTPAAPA-----GAEPAGKATTEEQKLIEKINAGFKAALAA 52
Query  86   AAVVPPADKYKTFVETFGTATNKAFVEGLAS---GYADQS-KNQLTSKLDAALKLAYEAA 141
            AA VPPADKY+TFV TFG A+NKAF EGL+    G A+ S K  LTSKLDAA KLAY+ A
Sbjct  53   AAGVPPADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTA 112
Query  142  QGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAYR 201
            +GATPEAKYDAYVATL+EALR+IAGTLEVHAVKPAAEEVKV  IPA E+Q+I+KVDAA++
Sbjct  113  EGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFK 170
Query  202  TAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQAYAAKQATAPE 261
             AATAANAAPANDKFTVFE  FNNAIK S G AY+SYKFIP L AAVKQAYAA  ATAPE
Sbjct  171  VAATAANAAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPE 230
Query  262  VKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAATATATPAAA 309
            VKYTV ETALKKA+TAMSEA+K A PAAAATAT T A   AT    AA
Sbjct  231  VKYTVFETALKKAITAMSEAQKAAKPAAAATATATSAVGAATGAATAA 278

Sequence Alignment: 6. Allergen Name: Phl p 5.0102 Sequence ID: Q40962

 Score = 280.5 bits 1202,  Expect = 6e-77
 Identities = 211/276 76%, Positives = 230/276 83%, Gaps = 12/276 4%
Query  26   ADAGYAPATPATPAAPATAATPATPATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAA 85
            AD GY PAT   PAAPA   TPATPA PA   A  +GKATTEEQKLIEKINAGFKAA+A 
Sbjct  1    ADLGYGPAT---PAAPAAGYTPATPAAPAGADA--AGKATTEEQKLIEKINAGFKAALAG 55
Query  86   AAVVPPADKYKTFVETFGTATNKAFVEGLAS---GYADQS-KNQLTSKLDAALKLAYEAA 141
            A V  PADKY+TFV TFG A+NKAF EGL+    G A+ S K  LTSKLDAA KLAY+ A
Sbjct  56   AGV-QPADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTA 114
Query  142  QGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAYR 201
            +GATPEAKYDAYVATL+EALR+IAGTLEVHAVKPAAEEVKV  IPA E+Q+I+KVDAA++
Sbjct  115  EGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFK 172
Query  202  TAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQAYAAKQATAPE 261
             AATAANAAPANDKFTVFE  FN+ IK S G AY+SYKFIP L AAVKQAYAA  ATAPE
Sbjct  173  VAATAANAAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPE 232
Query  262  VKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAATATATPAAA 309
            VKYTV ETALKKA+TAMSEA+K A PAAAATAT T A   AT    AA
Sbjct  233  VKYTVFETALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAA 280

Sequence Alignment: 7. Allergen Name: Phl p 5.0107 Sequence ID: AAC16527

 Score = 277.1 bits 1187,  Expect = 6e-76
 Identities = 206/258 79%, Positives = 225/258 87%, Gaps = 8/258 3%
Query  50   PATPATPA-AVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNK 108
            PATPA PA A P+GKATTEEQKLIEKIN GFKAA+AAAA VPPADKYKTFV TFG A+NK
Sbjct  8    PATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAASNK 67
Query  109  AFVEGLAS---GYADQS-KNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVI 164
            AF EGL++   G A+ S K  LTSKLDAA KLAY+ A+GATPEAKYDAYVATL+EALR+I
Sbjct  68   AFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRII 127
Query  165  AGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFN 224
            AGTLEVHAVKPAAEEVKV  IPA E+Q+I+KVD+A++ AATAANAAPANDKFTVFE  FN
Sbjct  128  AGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSAFKVAATAANAAPANDKFTVFEAAFN 185
Query  225  NAIKVSLGAAYDSYKFIPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKE 284
            NAIK S G AY+SYKFIP L AAVKQAYAA  ATAPEVKYTV ETALKKA+TAMSEA+K 
Sbjct  186  NAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKA 245
Query  285  ATPAAAATATPTPAAATAT-ATPAAA 309
            A PAAAATAT T A   AT AT AAA
Sbjct  246  AKPAAAATATATSAVGAATGATTAAA 271

Sequence Alignment: 8. Allergen Name: Phl p 5.0106 Sequence ID: AAC16526

 Score = 273.9 bits 1173,  Expect = 5e-75
 Identities = 201/258 77%, Positives = 220/258 85%, Gaps = 7/258 2%
Query  50   PATPATPA-AVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNK 108
            PATPA PA A P+GKATTEEQKLIEKIN GFKAA+AAAA VPPADKYKTFV TFG A+NK
Sbjct  8    PATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAASNK 67
Query  109  AFVEGLAS---GYADQS-KNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVI 164
            AF EGL++   G A+ S K  LTSKLDAA KLAY+ A+GATPEAKYDAYVATL+EALR+I
Sbjct  68   AFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRII 127
Query  165  AGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFN 224
            AGTLEVHAVKPAAEEVKV  IPA E+Q+I+KVD+A++ AATAANAAPANDKFTVFE  FN
Sbjct  128  AGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSAFKVAATAANAAPANDKFTVFEAAFN 185
Query  225  NAIKVSLGAAYDSYKFIPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKE 284
            NAIK S G AY+SYKFIP L AAVKQAYAA  ATAPEVKYTV ETALKKA+TAMSEA+K 
Sbjct  186  NAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKA 245
Query  285  ATPAAAATATPTPAAATATATPAAA 309
            A PA  ATAT T A   AT    AA
Sbjct  246  AKPATEATATATAAVGAATGAATAA 270

Sequence Alignment: 9. Allergen Name: Phl p 5.0108 Sequence ID: AAC16528

 Score = 272.8 bits 1168,  Expect = 1e-74
 Identities = 201/258 77%, Positives = 219/258 84%, Gaps = 7/258 2%
Query  50   PATPATPA-AVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNK 108
            PATPA PA A P+GKATTEEQKLIEKIN GFKAA+AAAA VPPADKYKTFV TFG A+NK
Sbjct  8    PATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAASNK 67
Query  109  AFVEGLAS---GYADQS-KNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVI 164
            AF EGL++   G A+ S K  LTSKLDAA KLAY+ A+GATPEAKYDAYVATL+EALR+I
Sbjct  68   AFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRII 127
Query  165  AGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFN 224
            AGTLEVHAVKPAAEEVKV  IPA E+Q+I+KVD+A++ AATAANAAPANDKFTVFE  FN
Sbjct  128  AGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSAFKVAATAANAAPANDKFTVFEAAFN 185
Query  225  NAIKVSLGAAYDSYKFIPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKE 284
            NAIK S G AY+SYKFIP L AAVKQAYAA  ATAPEVKYTV ETALKKA TAMSEA+K 
Sbjct  186  NAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAFTAMSEAQKA 245
Query  285  ATPAAAATATPTPAAATATATPAAA 309
            A PA  ATAT T A   AT    AA
Sbjct  246  AKPATEATATATAAVGAATGAATAA 270

Sequence Alignment: 10. Allergen Name: Phl p 5.0105 Sequence ID: AAC16525

 Score = 269.8 bits 1155,  Expect = 9e-74
 Identities = 199/258 77%, Positives = 218/258 84%, Gaps = 7/258 2%
Query  50   PATPATPA-AVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNK 108
            PATPA PA A P+GKATTEEQKLIEKIN GFKAA+AAAA VPPADKYKTFV TFG A+NK
Sbjct  8    PATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAASNK 67
Query  109  AFVEGLAS---GYADQS-KNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVI 164
            AF EGL++   G A+ S K  LTSKLDAA KLAY+ A+GATPEA+YDAYVATL+EALR+I
Sbjct  68   AFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAEYDAYVATLSEALRII 127
Query  165  AGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFN 224
            AGTLEVHAVKPAAEEVKV  IPA E+Q+I+KVD+A + AATAANAAPANDKFTVFE  FN
Sbjct  128  AGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSALKVAATAANAAPANDKFTVFEAAFN 185
Query  225  NAIKVSLGAAYDSYKFIPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKE 284
            NAIK S G AY+SYKFIP L AAVKQAYAA  ATAPEVKYTV ETALKKA+TA SEA+K 
Sbjct  186  NAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITATSEAQKA 245
Query  285  ATPAAAATATPTPAAATATATPAAA 309
            A PA  ATAT T A   AT    AA
Sbjct  246  AKPATEATATATAAVGAATGAATAA 270

Sequence Alignment: 11. Allergen Name: Phl p 5.0104 Sequence ID: CAB05372

 Score = 266.8 bits 1142,  Expect = 7e-73
 Identities = 197/258 76%, Positives = 218/258 84%, Gaps = 7/258 2%
Query  50   PATPATPA-AVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNK 108
            PATPA PA A P+GKATTEEQKLIEKIN GFKAA+AAAA VPPADKYKTFV TFG A+NK
Sbjct  8    PATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAASNK 67
Query  109  AFVEGLAS---GYADQS-KNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVI 164
            AF EGL++   G A+ S K  LTSKL+AA KLAY+ ++GATPEAKYDAYVATL+EALR+I
Sbjct  68   AFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATLSEALRII 127
Query  165  AGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFN 224
            AGTLEVHAVKPAAEEVKV  IPA E+Q+I+KVD+A + AATAANAA ANDKFTVFE  FN
Sbjct  128  AGTLEVHAVKPAAEEVKV--IPAGELQFIEKVDSALKVAATAANAAAANDKFTVFEAAFN 185
Query  225  NAIKVSLGAAYDSYKFIPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKE 284
            +AIK S G AY+SYKFIP L AAVKQAYAA  ATAPEVKYTV ETALKKA+TAMSEA+K 
Sbjct  186  HAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKA 245
Query  285  ATPAAAATATPTPAAATATATPAAA 309
            A PA  ATAT T A   AT    AA
Sbjct  246  AKPATEATATATAAVGAATGAATAA 270

Sequence Alignment: 12. Allergen Name: Poa p 5 Sequence ID: P22284

 Score = 264.0 bits 1130,  Expect = 7e-72
 Identities = 204/275 74%, Positives = 223/275 81%, Gaps = 14/275 5%
Query  28   AGYAPATPAT--PAAPATAATPATPATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAA 85
            AG   A PA+  PA PA      TPA PA   A P  KATT+EQKLIEKIN GFKAAVAA
Sbjct  86   AGAVKAPPASKFPAKPAPKVAAYTPAAPA--GAAP--KATTDEQKLIEKINVGFKAAVAA 141
Query  86   AAVVPPADKYKTFVETFGTATNKAFVEGLAS---GYA-DQSKNQLTSKLDAALKLAYEAA 141
            AA VP A KYKTFV TFG A+NKAF E L++   G A   SK  LTSKLDAA KLAY++A
Sbjct  142  AAGVPAASKYKTFVATFGAASNKAFAEALSTEPKGAAVASSKAVLTSKLDAAYKLAYKSA 201
Query  142  QGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAYR 201
            +GATPEAKYDAYVATL+EALR+IAGTLEVH VKPAAEEVK  AIPA E+Q+IDKVDAA++
Sbjct  202  EGATPEAKYDAYVATLSEALRIIAGTLEVHGVKPAAEEVK--AIPAGELQVIDKVDAAFK 259
Query  202  TAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQAYAAKQATAPE 261
             AATAANAAPANDKFTVFE  FN+AIK S G AY SYKFIP L AAVKQ+YAA  ATAP 
Sbjct  260  VAATAANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVKQSYAATVATAPA 319
Query  262  VKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPA--AATATATPAA 308
            VKYTV ETALKKA+TAMS+A+K A PAAA T T T A  AAT  AT AA
Sbjct  320  VKYTVFETALKKAITAMSQAQKAAKPAAAVTGTATSAVGAATGAATAAA 368
 Score = 39.9 bits 147,  Expect = 0.0002
 Identities = 34/85 40%, Positives = 54/85 63%, Gaps = 8/85 9%
Query  72   IEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNKAFVEGLASGYADQSKNQLTSKLD 131
            ++K N  +K A+ AA+ V PA+K+  F  TF    +K + EGL SG        +  KLD
Sbjct  1    MDKANGAYKTALKAASAVAPAEKFPVFQATF----DKNLKEGL-SG---PDAVGFAKKLD 52
Query  132  AALKLAYEAAQGATPEAKYDAYVATLTEALRVI 164
            A ++ +Y + + A P+ K+D +V +LTE LR +
Sbjct  53   AFIQTSYLSTKAAEPKEKFDLFVLSLTEVLRFM 85

Sequence Alignment: 13. Allergen Name: Phl p 5 Sequence ID: AAK25823

 Score = 243.4 bits 1039,  Expect = 8e-66
 Identities = 184/261 70%, Positives = 201/261 77%, Gaps = 11/261 4%
Query  43   TAATPATPATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETF 102
            TA  P  P  PATP   P  +      KL        KA     A+VPPADKY+TFV TF
Sbjct  5    TAPPPQLPRPPATPPPPPPPQLGASPYKL----GPSPKARSERPAIVPPADKYRTFVATF 60
Query  103  GTATNKAFVEGLAS----GYADQSKNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLT 158
            G A+NKAF EGL+     G    SK  LTSKLDAA KLAY+ A+GATPEAKYDAYVATL+
Sbjct  61   GAASNKAFAEGLSGEPKGGAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLS 120
Query  159  EALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTV 218
            EALR+IAGTLEVHAVKPAAEEVKV  IPA E+Q+I+KVDAA++ AATAANAAPANDKFTV
Sbjct  121  EALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAANAAPANDKFTV 178
Query  219  FENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAM 278
            FE  FNNAIK   G AY+SYKFIP L AAVKQAYAA  ATAPEVKYTV ETALKKA+TAM
Sbjct  179  FEAAFNNAIKAGTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAM 238
Query  279  SEAEKEATPAAAATATPTPAAATAT-ATPAAA 309
            SEA+K A PAAAATAT T A    T AT AAA
Sbjct  239  SEAQKAAKPAAAATATATSAVGAPTGATTAAA 270

Sequence Alignment: 14. Allergen Name: Dac g 5.02 Sequence ID: AAK62277

 Score = 238.6 bits 1018,  Expect = 2e-64
 Identities = 177/254 69%, Positives = 196/254 77%, Gaps = 7/254 2%
Query  49   TPATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNK 108
            TPA  ATPAA   GKA TEEQKLIE +NAGFKAAVAAA+  PPADK+KTF  TF TA  K
Sbjct  6    TPAAAATPAAA-GGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATF-TAACK 63
Query  109  AFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTL 168
            A +   A+         + +KLDAA  +AY+ A G TPEAKYDA+VA LTEALRVIAG L
Sbjct  64   ANIAAAATKVP-----LFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALRVIAGAL 118
Query  169  EVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFNNAIK 228
            EVHAVKPAAEEV    IPA E+Q++DK+DAAY+ AATAANAAPANDKFTVFE  FN AIK
Sbjct  119  EVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIK 178
Query  229  VSLGAAYDSYKFIPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPA 288
             S G AY+SYKFIPTL AAVKQAYAA  A APEVKY V E AL KA+TAMSEA+K ATPA
Sbjct  179  ESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPA 238
Query  289  AAATATPTPAAATATATPAAA 309
            AAAT   T AA+ AT    AA
Sbjct  239  AAATGAATAAASAATGAATAA 259

Sequence Alignment: 15. Allergen Name: Hol l 5.0101 Sequence ID: CAB10765

 Score = 237.7 bits 1014,  Expect = 4e-64
 Identities = 174/252 69%, Positives = 195/252 77%, Gaps = 7/252 2%
Query  52   TPATPAAVPSG-KATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNKAF 110
            TPA PAA  +G KATT+EQKL+E +NAGFK AVAAAA VPPADKYKTF   F TA++KA 
Sbjct  6    TPAAPAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAF-TASSKAS 64
Query  111  VEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTLEV 170
            +   A+         L  +L+AA   AY AAQGATPEAKYDA+V TLTEALRVIAG LEV
Sbjct  65   IAAAAT-----KAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRVIAGALEV 119
Query  171  HAVKPAAEEVKVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFNNAIKVS 230
            HAVKPA EEV    IPA E+Q++DK+DAA+R AATAANAAP NDKFTVFE  FN AIK S
Sbjct  120  HAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEGAFNKAIKES 179
Query  231  LGAAYDSYKFIPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAA 290
             G AY++YKFIP+L  AVKQAYAA  ATAPEVKYTV ETALKKA+TAMSEA+KEA P AA
Sbjct  180  TGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKEAKPVAA 239
Query  291  ATATPTPAAATATATPAAA 309
            AT   T AA  A     AA
Sbjct  240  ATGAATAAAGVAAGAATAA 258

Sequence Alignment: 16. Allergen Name: Dac g 5.01 Sequence ID: AAK62276

 Score = 234.7 bits 1001,  Expect = 3e-63
 Identities = 174/254 68%, Positives = 193/254 75%, Gaps = 7/254 2%
Query  49   TPATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNK 108
            TPA  ATPA    GKA TEEQ LIE +NAGFKAAVAAA+  PPADK+KTF  TF TA  K
Sbjct  6    TPAAAATPATA-GGKAMTEEQTLIEDVNAGFKAAVAAASSAPPADKFKTFEATF-TAACK 63
Query  109  AFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTL 168
            A +   A+         + +KLDAA  +AY+ A G TPEAKYDA+VA LTEALRVIAG L
Sbjct  64   ANIAAAATKVP-----LFVAKLDAAYAVAYKTATGPTPEAKYDAFVAALTEALRVIAGAL 118
Query  169  EVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFNNAIK 228
            EVHAVKPAAEEV    IPA E+Q++DK+DAAY+ AATAANAAPANDKFTVFE  FN AIK
Sbjct  119  EVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIK 178
Query  229  VSLGAAYDSYKFIPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPA 288
             S G AY+SYKFIPTL AAVKQAYAA  A APEVKY V E AL KA+TAMSEA+K ATPA
Sbjct  179  ESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPA 238
Query  289  AAATATPTPAAATATATPAAA 309
            A AT   T AA+ AT    AA
Sbjct  239  AVATGAATAAASAATGAATAA 259

Sequence Alignment: 17. Allergen Name: Lol p 5 Sequence ID: AAD20386

 Score = 234.4 bits 1000,  Expect = 4e-63
 Identities = 203/301 67%, Positives = 233/301 77%, Gaps = 19/301 6%
Query  1    MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATPATPATPAAVP 60
            MAVQK+TVALFLAVALVAGPAASYAADAGY      TPAA   AATPATPA  ATPAA  
Sbjct  1    MAVQKYTVALFLAVALVAGPAASYAADAGY------TPAA---AATPATPA--ATPAAA- 48
Query  61   SGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNKAFVEGLASGYAD 120
             GKATT+EQKL+E +NAGFKAAVAAAA  PPADK+K F   F  ++     +GL +  A 
Sbjct  49   GGKATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKIFEAAFSESS-----KGLLATSAA 103
Query  121  QSKNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEV 180
            ++   L  KLD A  +AY+AA+GATPEAKYDA+V  LTEALRVIAG LEVHAVKPA EEV
Sbjct  104  KAPG-LIPKLDTAYDVAYKAAEGATPEAKYDAFVTALTEALRVIAGALEVHAVKPATEEV 162
Query  181  KVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKF 240
                IP  E+Q++DK+DAA++ AATAANAAP NDKFTVFE+ FN A+    G AY++YKF
Sbjct  163  PAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAYETYKF 222
Query  241  IPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA 300
            IP+L AAVKQAYAA  A APEVKY V E AL KA+TAM++A+K   PAAAA AT     A
Sbjct  223  IPSLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAA-ATGAATVA 281
Query  301  TATATPAAAYATATPAAATA 320
            T  AT AA  ATA      A
Sbjct  282  TGAATAAAGAATAAAGGYKA 301

Sequence Alignment: 18. Allergen Name: Sec c 5.0101 Sequence ID: CBG76811

 Score = 222.6 bits 948,  Expect = 2e-59
 Identities = 182/281 64%, Positives = 220/281 78%, Gaps = 34/281 12%
Query  1    MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATPATPATPAAVP 60
            MAVQ++TVALFLAVALVAGPA SY     YAPA P T         P             
Sbjct  1    MAVQQYTVALFLAVALVAGPAVSYGT---YAPAAPGTQ--------P------------- 36
Query  61   SGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNKAFVEGLASGYAD 120
              KATT EQKL+E IN GFKAAV AAA V PADKYKTF  TF   +NKAF + L +  + 
Sbjct  37   --KATTPEQKLMENINNGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAASG 94
Query  121  Q------SKNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTLEVHAVK 174
            Q      S  +L++ L+++ KLAY++A+GATPE KYD YVA+LTE+LRVI+G +EVHAVK
Sbjct  95   QIPAQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVISGAFEVHAVK 154
Query  175  PAAEEVKVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAA 234
            PA+EEVK   +PA +++++D++DAAYRTAATAANAAP NDKF VFE++FN AIK + G A
Sbjct  155  PASEEVK--GVPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVFESSFNKAIKENTGGA 212
Query  235  YDSYKFIPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATAT 294
            Y SY F+P L +AVKQAYAA  A+APEVKY V + AL KA+ AM EAEK+A PAAAA AT
Sbjct  213  YASYTFVPALESAVKQAYAATVASAPEVKYAVFQAALSKAINAMVEAEKDAKPAAAAAAT 272
Query  295  PTPAAATATATPAAA 309
             T  A    A  AAA
Sbjct  273  ATATATVGAAAGAAA 287

Sequence Alignment: 19. Allergen Name: Poa p 5.0101 Sequence ID: Q9FPR0

 Score = 212.1 bits 902,  Expect = 2e-56
 Identities = 194/303 64%, Positives = 226/303 74%, Gaps = 36/303 11%
Query  1    MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATPATPATPAAVP 60
            MAVQK+TVALFL VALVAGPAASYAADAGYAPATPA   A A   TP             
Sbjct  1    MAVQKYTVALFLTVALVAGPAASYAADAGYAPATPAAAGAAAGKITP------------- 47
Query  61   SGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNKAFVEGLASGYAD 120
                 T+EQKL+E IN GFKAAVAAAA  PPADK+KTF   F +A+ +A    L +  A 
Sbjct  48   -----TQEQKLMEDINVGFKAAVAAAAGAPPADKFKTFQAAF-SASVEASAAKLNAAQAP 101
Query  121  QSKNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEV 180
               +++ +  DA     Y+AA GATPEAK+D++VA +TEALR+IAG L+VHAVKP  EE 
Sbjct  102  GFVSHVAATSDA----TYKAAVGATPEAKFDSFVAAFTEALRIIAGVLKVHAVKPITEET 157
Query  181  KVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKF 240
                IPA E Q+IDK+DAA++ AATAANAAPANDKFTVFE  FNNAIK S G AYD+YK 
Sbjct  158  GAAKIPAGEQQIIDKIDAAFKVAATAANAAPANDKFTVFEAAFNNAIKESTGGAYDTYKS 217
Query  241  IPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA 300
            IP+L AAVKQAYAA  A APEVK+ V + AL KA+TAM+E +K + P A A         
Sbjct  218  IPSLEAAVKQAYAATIAAAPEVKFAVFKAALTKAITAMAEVQKVSKPVAGA--------- 268
Query  301  TATATPAAAYATATPAAATATATPAAATATPAAAGGYKV 339
               AT AA  ATA   AAT  A  A   AT  +AGGYKV
Sbjct  269  ---ATVAAGAATAATGAATGAAGAATGAAT-VSAGGYKV 303

Sequence Alignment: 20. Allergen Name: Hol l 5.0201 Sequence ID: CAB10766

 Score = 206.7 bits 878,  Expect = 8e-55
 Identities = 152/237 64%, Positives = 181/237 76%, Gaps = 6/237 2%
Query  69   QKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNKAFVEGLASGYADQSKN-QLT 127
            QKL+E +NA FKAAVAAAA VPPADKYKTF+  F T  ++   E      A+++K  +L+
Sbjct  1    QKLLEDVNASFKAAVAAAAKVPPADKYKTFLRAF-TVLDRGSTE---QSKAEETKMPELS 56
Query  128  SKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPA 187
            SKL  A   A++A+ G T EAKYDA+V TLTEALRVIAG LEVHAVKPA EEV    IPA
Sbjct  57   SKLVDAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAKIPA 116
Query  188  AEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAA 247
             ++Q++DK+DA+++ AATAANAAPANDKFTVFE  FN A+K S G AY+SYKFIP+L AA
Sbjct  117  GDLQVVDKIDASFKIAATAANAAPANDKFTVFETAFNKALKESTGGAYESYKFIPSLEAA 176
Query  248  VKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAATATATPA 307
            VKQAYA+  A APEVKY V E AL KA+TAMS+A+K A PAAAAT   T AA  AT T A
Sbjct  177  VKQAYASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQPAAAATGAATVAAGAAT-TAA 235
Query  308  AAY 310
              Y
Sbjct  236  GGY 238

Sequence Alignment: 21. Allergen Name: Pha a 5 Sequence ID: P56164

 Score = 187.9 bits 796,  Expect = 5e-49
 Identities = 169/277 61%, Positives = 199/277 71%, Gaps = 33/277 11%
Query  1    MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATPATPATPAAVP 60
            MAVQK+T+ALFLAVALVAGPAA            P  P       TP TP  P  P    
Sbjct  1    MAVQKYTMALFLAVALVAGPAA------------PTPP-------TPRTP--PLLPPPRA 39
Query  61   SGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNKAFVEGLASGYAD 120
              KAT    + +E INA  +    A+  VPPADK+KTF +      N A V   A+    
Sbjct  40   RDKATLT-SRSVEDINAASRRPWWAS--VPPADKFKTFADHVLCVPN-ADVTSAAT---- 91
Query  121  QSKNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEV 180
                QL +KLDAA ++AYEAA+G+TPEAKYDA++A LTEALRVIAG +EVHAVKPA EEV
Sbjct  92   -KAPQLKAKLDAAYRVAYEAAEGSTPEAKYDAFIAALTEALRVIAGAFEVHAVKPATEEV 150
Query  181  KVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKF 240
               A P  E+Q++DK+DAA++ AATAAN+APANDKFTVFE  FN AIK S   AY++YKF
Sbjct  151  V--ADPVGELQIVDKIDAAFKIAATAANSAPANDKFTVFEGAFNKAIKESTAGAYETYKF 208
Query  241  IPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPT-PAA 299
            IP+L AAVKQAY A  A APEVKY V E  L KA+TAMSEA+K A P  +       P A
Sbjct  209  IPSLEAAVKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPPLSPQPPQVLPLA 268
Query  300  ATATATPAAA 309
            A   AT AAA
Sbjct  269  AGGAATVAAA 278

Sequence Alignment: 22. Allergen Name: Hor v 5.0101 Sequence ID: U57845

 Score = 176.1 bits 744,  Expect = 2e-45
 Identities = 136/200 68%, Positives = 160/200 80%, Gaps = 9/200 4%
Query  103  GTATNKAFVE---GLASGY-ADQSKN--QLTSKLDAALKLAYEAAQGATPEAKYDAYVAT 156
            G    KAF E   G A+G  A QS +  +L+S L+ + KLAY+ AQGATPEAKYDAYVAT
Sbjct  102  GREFRKAFAEVLKGAATGQIAGQSSSMAKLSSSLELSYKLAYDKAQGATPEAKYDAYVAT 161
Query  157  LTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKF 216
            LTE+LRVI+GTLEVH+VKPAAEEVK   +PA E++ ID+VDAA+RTAATAA+AAPANDKF
Sbjct  162  LTESLRVISGTLEVHSVKPAAEEVK--GVPAGELKAIDQVDAAFRTAATAADAAPANDKF 219
Query  217  TVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVT 276
            TVFE+      +   G AY+SYKFIP L AAVKQAYAA  A APEVK+TV +TAL KA+ 
Sbjct  220  TVFESLQQGPSRKPRGGAYESYKFIPALEAAVKQAYAATVAAAPEVKFTVFQTALSKAIN 279
Query  277  AMSEAEKEATPAAAATATPTPAA-ATATA 304
            AM++A K A PAAAATAT T AA A ATA
Sbjct  280  AMTQAGKVAKPAAAATATATVAAGAAATA 308

Sequence Alignment: 23. Allergen Name: Phl p 5.0201 Sequence ID: Q40963

 Score = 175.4 bits 741,  Expect = 2e-45
 Identities = 183/272 67%, Positives = 207/272 76%, Gaps = 49/272 18%
Query  19   GPAASYAADAGYAPATPATPAAPATAATPATPATPATPAAVPSGKATTEEQKLIEKINAG 78
            GP  SY ADAGYAPATPA   A A                   GKATTEEQKLIE IN G
Sbjct  13   GPGRSYTADAGYAPATPAAAGAAA-------------------GKATTEEQKLIEDINVG 53
Query  79   FKAAVAAAAVVPPADKYKTFVETFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAY 138
            FKAAVAAAA VP ADK+KTF   F T+++KA     A G        L  KLDAA  +AY
Sbjct  54   FKAAVAAAASVPAADKFKTFEAAF-TSSSKA-AAAKAPG--------LVPKLDAAYSVAY 103
Query  139  EAAQGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDA 198
            +AA GATPEAK+D++VA+LTEALRVIAG LEVHAVKP  EE  +  IPA E+Q+IDK+DA
Sbjct  104  KAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDA 163
Query  199  AYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQAYAAKQAT 258
            A++ AATAA  APA+DKFTVFE  FN AIK S G AYD+YK IP+L AAVKQAYAA  A 
Sbjct  164  AFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAA 223
Query  259  APEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAATATATPAAAYATATPAAA 318
            AP+VKY V E AL KA+TAMSE +K + PA  A            AT AA  AT    AA
Sbjct  224  APQVKYAVFEAALTKAITAMSEVQKVSQPATGA------------ATVAAGAATTAAGAA 271
Query  319  TATATPAAATATPAAAGGYKV 339
            +  AT         AAGGYKV
Sbjct  272  SGAAT--------VAAGGYKV 284

Sequence Alignment: 24. Allergen Name: Phl p 5.0202 Sequence ID: CAB05371

 Score = 172.7 bits 729,  Expect = 2e-44
 Identities = 184/272 67%, Positives = 208/272 76%, Gaps = 49/272 18%
Query  19   GPAASYAADAGYAPATPATPAAPATAATPATPATPATPAAVPSGKATTEEQKLIEKINAG 78
            GP  SYAADAGYAPATPA   A A                   GKATTEEQKLIE IN G
Sbjct  10   GPGRSYAADAGYAPATPAAAGAEA-------------------GKATTEEQKLIEDINVG 50
Query  79   FKAAVAAAAVVPPADKYKTFVETFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAY 138
            FKAAVAAAA VP  DK+KTF   F T+++KA         A      L  KLDAA  +AY
Sbjct  51   FKAAVAAAASVPAGDKFKTFEAAF-TSSSKA---------ATAKAPGLVPKLDAAYSVAY 100
Query  139  EAAQGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDA 198
            +AA GATPEAK+D++VA+LTEALRVIAG LEVHAVKP  EE  +  IPA E+Q+IDK+DA
Sbjct  101  KAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDA 160
Query  199  AYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQAYAAKQAT 258
            A++ AATAA  APA+DKFTVFE  FN AIK S G AYD+YK IP+L AAVKQAYAA  A 
Sbjct  161  AFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAA 220
Query  259  APEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAATATATPAAAYATATPAAA 318
            AP+VKY V E AL KA+TAMSE +K + PA  A            AT AA  AT      
Sbjct  221  APQVKYAVFEAALTKAITAMSEVQKVSQPATGA------------ATVAAGAAT------ 262
Query  319  TATATPAAATATPAAAGGYKV 339
              TAT AA+ A   AAGGYKV
Sbjct  263  --TATGAASGAATVAAGGYKV 281

Sequence Alignment: 25. Allergen Name: Phl p 5.0204 Sequence ID: AAC25996

 Score = 172.5 bits 728,  Expect = 2e-44
 Identities = 178/265 67%, Positives = 202/265 76%, Gaps = 49/265 18%
Query  26   ADAGYAPATPATPAAPATAATPATPATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAA 85
            ADAGYAPATPA   A A                   GKATTEEQKLIE IN GFKAAVAA
Sbjct  1    ADAGYAPATPAAAGAEA-------------------GKATTEEQKLIEDINVGFKAAVAA 41
Query  86   AAVVPPADKYKTFVETFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGAT 145
            AA VP ADK+KTF   F T+++KA         A      L  KLDAA  +AY+AA GAT
Sbjct  42   AASVPAADKFKTFEAAF-TSSSKA---------ATAKAPGLVPKLDAAYSVAYKAAVGAT 91
Query  146  PEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAYRTAAT 205
            PEAK+D++VA+LTEALRVIAG LEVHAVKP  EE  +  IPA E+Q+IDK+DAA++ AAT
Sbjct  92   PEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAAT 151
Query  206  AANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQAYAAKQATAPEVKYT 265
            AA  APA+DKFTVFE  FN AIK S G AYD+YK IP+L AAVKQAYAA  A AP+VKY 
Sbjct  152  AAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYA 211
Query  266  VSETALKKAVTAMSEAEKEATPAAAATATPTPAAATATATPAAAYATATPAAATATATPA 325
            V E AL KA+TAMSE +K + P            AT  AT AA  AT    AA+  AT  
Sbjct  212  VFEAALTKAITAMSEVQKVSQP------------ATGAATVAAGAATTAAGAASGAAT-- 257
Query  326  AATATPAAAGGYKV 339
                   AAGGYKV
Sbjct  258  ------VAAGGYKV 265

Sequence Alignment: 26. Allergen Name: Phl p 5.0205 Sequence ID: 9249029

 Score = 170.0 bits 717,  Expect = 1e-43
 Identities = 176/265 66%, Positives = 199/265 75%, Gaps = 49/265 18%
Query  26   ADAGYAPATPATPAAPATAATPATPATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAA 85
            ADAGYAPATPA   A A                   GKATTEEQKLIE IN GF AAVAA
Sbjct  1    ADAGYAPATPAAAGAEA-------------------GKATTEEQKLIEDINVGFNAAVAA 41
Query  86   AAVVPPADKYKTFVETFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGAT 145
            AA VP ADK+KTF   F T+++KA         A      L  KLDAA  +AY+AA GAT
Sbjct  42   AASVPAADKFKTFEAAF-TSSSKA---------ATAKAPGLVPKLDAAYSVAYKAAVGAT 91
Query  146  PEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAYRTAAT 205
            PEAK+D+ VA+LTEALRVIAG LEVHAVKP  EE  +  IPA E+Q+IDK+DAA++ AAT
Sbjct  92   PEAKFDSLVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAAT 151
Query  206  AANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQAYAAKQATAPEVKYT 265
            AA  APA+DKFTVFE  FN AIK S G AYD+YK IP+L AAVKQ YAA  A AP+VKY 
Sbjct  152  AAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQPYAATVAAAPQVKYA 211
Query  266  VSETALKKAVTAMSEAEKEATPAAAATATPTPAAATATATPAAAYATATPAAATATATPA 325
            V E AL KA+TAMSE +K + P            AT  AT AA  AT    AA+  AT  
Sbjct  212  VFEAALTKAITAMSEVQKVSQP------------ATGAATVAAGAATTAAGAASGAAT-- 257
Query  326  AATATPAAAGGYKV 339
                   AAGGYKV
Sbjct  258  ------VAAGGYKV 265

Sequence Alignment: 27. Allergen Name: Pha a 5 Sequence ID: P56167

 Score = 149.0 bits 624,  Expect = 1e-37
 Identities = 115/174 66%, Positives = 134/174 77%, Gaps = 19/174 10%
Query  148  AKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAYRTAATAA 207
            AKYDA++A LTEALRVIAG +EVHAVKPA EEV    IPA E+Q++DK+DAA++ AATAA
Sbjct  1    AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKIDAAFKIAATAA 60
Query  208  NAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAA-VKQAYAAKQATAPEVKYTV 266
            N+APANDKFTVFE  FN AIK   G AY++YKFIP+L A+  KQAY A  A APEVKY V
Sbjct  61   NSAPANDKFTVFEGAFNKAIKERHGGAYETYKFIPSLEASRSKQAYGATVARAPEVKYAV 120
Query  267  SETALKKAVTAMSEAEKEATPAAAATATPTPAAATATATPAAAYATATPAAATATATPAA 326
             E  L KA+TAMSEA+K A P  + TA    AAA A        ATA   AAT  A+   
Sbjct  121  FEAGLTKAITAMSEAQKVAKPVRSVTA----AAAGA--------ATAAGGAATVAAS--- 165
Query  327  ATATPAAAGGYKV 339
                P +AGGYKV
Sbjct  166  ---RPTSAGGYKV 175

Sequence Alignment: 28. Allergen Name: Pha a 5 Sequence ID: P56165

 Score = 149.0 bits 625,  Expect = 2e-37
 Identities = 178/305 58%, Positives = 210/305 68%, Gaps = 34/305 11%
Query  1    MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATPATPATPAAVP 60
            MAVQK+TVALFLAVALVAGPAA YA D GYAPATPA   A AT ATPATPA  A+P    
Sbjct  1    MAVQKYTVALFLAVALVAGPAALYAGD-GYAPATPA---ASATLATPATPA--ASPQ--- 51
Query  61   SGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNKAFVEGLASGYAD 120
               A T E  ++ K  AG+     AA      D+ K   E      NK+           
Sbjct  52   --HAGTTEYHIVRK--AGLNEEKNAAR--QTDDEQKRSDEINCPDFNKSVHCRADRLPVC 105
Query  121  QSKNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEV 180
             S +  +SK D A  L Y + QG + +   DA V +++  + VI   +EV  +    EEV
Sbjct  106  SSTSAHSSKQDVAWMLGYGSIQGFSMD---DASVGSVSSEFHVIESAIEV--ITYIGEEV 160
Query  181  KVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKF 240
            KV  IPA EV++I+KV AA+ TAATAA+ APANDKFTVF ++FN AIK + G AY  YKF
Sbjct  161  KV--IPAGEVEVINKVKAAFSTAATAADEAPANDKFTVFVSSFNKAIKETTGGAYAGYKF 218
Query  241  IPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA 300
            IPTL AAVKQAYAA  ATAPEVKY V ETALKKA++AMSEA+KEA PAAA +A  T  +A
Sbjct  219  IPTLEAAVKQAYAASSATAPEVKYAVFETALKKAISAMSEAQKEAKPAAAISAATTTISA 278
Query  301  TATATPAAAYATATPAAATATATPAAATATPAAAGGYKV 339
            + TATPAA      P     TATPAA       AGGYKV
Sbjct  279  S-TATPAAP-----PPPQLGTATPAAV------AGGYKV 305

Sequence Alignment: 29. Allergen Name: Lol p 5 Sequence ID: Q40240

 Score = 135.7 bits 567,  Expect = 2e-33
 Identities = 133/289 46%, Positives = 162/289 56%, Gaps = 19/289 6%
Query  1    MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATPATPATPAAVP 60
            MAVQK+TVALFL      GP  SYAADAGY               TPA  ATPATPAA P
Sbjct  1    MAVQKYTVALFLRRGPRGGPGRSYAADAGY---------------TPAAAATPATPAATP 45
Query  61   SGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNKAFVEGLASGYAD 120
            +G     + +  E   AG +  +A+    PP         +  +          +S  + 
Sbjct  46   AGGWREGDDRRAEA--AGGRQRLASRQPWPPLPTPLRRTSSRSSRPPSPSPPRASSPTSA 103
Query  121  QSKNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEV 180
                 L  KLD A  +AY+AA+ A P  +          +LRVIAG LEVHAVKPA EEV
Sbjct  104  AKAPGLIPKLDTAYDVAYKAAE-AHPRGQVRRLRHCPHRSLRVIAGALEVHAVKPATEEV 162
Query  181  KVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKF 240
                IP  E+Q++DK+DAA++ AATAANAAP NDKFTVFE+ FN A+    G A      
Sbjct  163  LAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAMRPTSS 222
Query  241  IPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA 300
             P       +        APEVKY V E AL KA+TAM++A+K   PAAAA AT     A
Sbjct  223  SPPSRPRSSRPTPPPSPAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAA-ATAAATVA 281
Query  301  TATATPAA 308
            TA AT AA
Sbjct  282  TAAATAAA 289

Sequence Alignment: 30. Allergen Name: Pha a 5 Sequence ID: P56166

 Score = 114.1 bits 472,  Expect = 7e-27
 Identities = 178/270 65%, Positives = 203/270 75%, Gaps = 54/270 20%
Query  1    MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATPATPATPAAVP 60
            MAVQK+TVALFLA+ALVAGPAASYAADAG                TP TPATPA P A  
Sbjct  1    MAVQKYTVALFLAMALVAGPAASYAADAG----------------TPPTPATPAVPGAA- 43
Query  61   SGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNKAFVEGLASGYAD 120
            +GKATT EQKLIE INA FK   A+A   PPADKYK    TF TA +KA + G AS    
Sbjct  44   AGKATTHEQKLIEDINAAFKWWPASA---PPADKYK----TFETAFSKANIAG-AS---- 91
Query  121  QSKNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEV 180
                  T  LDAA  + Y  A GATPEAKYD++V  LTEALR++AGTLEVHAVKPA EE 
Sbjct  92   ------TKGLDAAYSVVYNTAAGATPEAKYDSFVTALTEALRIMAGTLEVHAVKPATEE- 144
Query  181  KVGAIPAAEVQLID----------KVDAAYRTA---ATAANAAPANDKFTVFENTFNNAI 227
                +P+A++   +          K+ A   T    +TAAN+APANDKFTVFE  FN AI
Sbjct  145  ---EVPSAKILRANSRSSTRSSRFKIAATVATPLSHSTAANSAPANDKFTVFEGAFNKAI 201
Query  228  KVSLGAAYDSYKFIPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATP 287
            K   G   ++YKFIP+L AAVKQAY A  A APEVKY V E  L KA+TAMSEA+K A P
Sbjct  202  KERHGGPTETYKFIPSLEAAVKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKP 261
Query  288  AAAATATPT--PAAATATATPAAA 309
               +   P   P AA   AT AAA
Sbjct  262  VRLSPQPPQVLPLAAGGAATVAAA 285

Sequence Alignment: 31. Allergen Name: Phl p 6.0101 Sequence ID: P43215

 Score = 92.1 bits 373,  Expect = 1e-20
 Identities = 64/118 54%, Positives = 79/118 66%, Gaps = 6/118 5%
Query  54   ATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNKAFVEG 113
            AT      GKATTEEQKLIE +NA F+AA+A  A VPPADKYKTF   F  ++ + + + 
Sbjct  15   ATSPTAEGGKATTEEQKLIEDVNASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADA 74
Query  114  LASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTLEVHAV 173
            ++         QL  KLD     AY AA  A PE KY+A+V  ++EALR+IAGT EVHAV
Sbjct  75   VSKA------PQLVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALRIIAGTPEVHAV 128
Query  174  KPAA 177
            KP A
Sbjct  129  KPGA 132

Sequence Alignment: 32. Allergen Name: Phl p 6.0102 Sequence ID: CAA76556

 Score = 90.7 bits 367,  Expect = 4e-20
 Identities = 64/118 54%, Positives = 78/118 66%, Gaps = 6/118 5%
Query  54   ATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNKAFVEG 113
            AT      GKATTEEQKLIE INA F+AA+A  A VPPADKYKTF   F  ++ + + + 
Sbjct  21   ATSPTAEGGKATTEEQKLIEDINASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADA 80
Query  114  LASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTLEVHAV 173
            ++         QL  KLD     AY AA  A PE KY+A+V  ++EAL +IAGT EVHAV
Sbjct  81   VSKA------PQLVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALHIIAGTPEVHAV 134
Query  174  KPAA 177
            KP A
Sbjct  135  KPGA 138

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.