The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAVQKYTVALFLRRGPRGGPGRSYAADAGYTPAAAATPATPAATPAGGWREGDDRRAEAA
GGRQRLASRQPWPPLPTPLRRTSSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVA
YKAAEAHPRGQVRRLRHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDA
AFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPA
APEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAAVLPPPLLVVQS
LISLLIYY
Sequence Info Allergen Name Length Opt Bits Score E Value
Q40240 Lol p 5 308 2008 351.2 2.8e-98
AAD20386 Lol p 5 301 1044 188.0 3.9e-49
Q9FPR0 Poa p 5.0101 303 744 137.2 7.6e-34
AAK62277 Dac g 5.02 265 737 136.0 1.6e-33
CAB10765 Hol l 5.0101 264 734 135.5 2.2e-33
AAK62276 Dac g 5.01 265 732 135.1 2.8e-33
Q40963 Phl p 5.0201 284 698 129.4 1.6e-31
9249029 Phl p 5.0205 265 688 127.7 4.9e-31
CAB05371 Phl p 5.0202 281 678 126.0 1.7e-30
AAC25996 Phl p 5.0204 265 673 125.1 2.9e-30
CAA52753 Phl p 5.0101 312 660 123.0 1.5e-29
CAD87529 Phl p 5.0109 284 648 120.9 5.7e-29
Q40962 Phl p 5.0102 286 645 120.4 8.1e-29
P22286 Poa p 5 307 644 120.3 9.7e-29
CAB10766 Hol l 5.0201 240 637 119.0 1.8e-28
AAC16527 Phl p 5.0107 276 630 117.9 4.6e-28
AAC16526 Phl p 5.0106 276 624 116.8 9.3e-28
CBG76811 Sec c 5.0101 292 621 116.4 1.4e-27
AAC16528 Phl p 5.0108 276 619 116.0 1.7e-27
P56164 Pha a 5 320 619 116.0 1.9e-27
P22285 Poa p 5 333 615 115.4 3.1e-27
AAC16525 Phl p 5.0105 276 609 114.3 5.4e-27
P22284 Poa p 5 373 609 114.4 6.8e-27
AAK25823 Phl p 5 275 592 111.4 4e-26
CAB05372 Phl p 5.0104 276 591 111.3 4.5e-26
P56167 Pha a 5 175 574 108.2 2.3e-25
Q40237 Lol p 5 339 567 107.3 8.8e-25
P56165 Pha a 5 305 516 98.6 3.2e-22
U57845 Hor v 5.0101 313 474 91.5 4.5e-20
P56166 Pha a 5 294 401 79.1 2.3e-16
CAA76556 Phl p 6.0102 138 136 34.0 0.0041
P43215 Phl p 6.0101 132 135 33.8 0.0045
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Lol p 5 Sequence ID: Q40240

 Score = 351.2 bits 2008,  Expect = 3e-98
 Identities = 308/308 100%, Positives = 308/308 100%, Gaps = 0/308 0%
Query  1    MAVQKYTVALFLRRGPRGGPGRSYAADAGYTPAAAATPATPAATPAGGWREGDDRRAEAA 60
            MAVQKYTVALFLRRGPRGGPGRSYAADAGYTPAAAATPATPAATPAGGWREGDDRRAEAA
Sbjct  1    MAVQKYTVALFLRRGPRGGPGRSYAADAGYTPAAAATPATPAATPAGGWREGDDRRAEAA 60
Query  61   GGRQRLASRQPWPPLPTPLRRTSSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVA 120
            GGRQRLASRQPWPPLPTPLRRTSSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVA
Sbjct  61   GGRQRLASRQPWPPLPTPLRRTSSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVA 120
Query  121  YKAAEAHPRGQVRRLRHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDA 180
            YKAAEAHPRGQVRRLRHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDA
Sbjct  121  YKAAEAHPRGQVRRLRHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDA 180
Query  181  AFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPA 240
            AFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPA
Sbjct  181  AFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPA 240
Query  241  APEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAAVLPPPLLVVQS 300
            APEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAAVLPPPLLVVQS
Sbjct  241  APEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAAVLPPPLLVVQS 300
Query  301  LISLLIYY 308
            LISLLIYY
Sbjct  301  LISLLIYY 308

Sequence Alignment: 2. Allergen Name: Lol p 5 Sequence ID: AAD20386

 Score = 188.0 bits 1044,  Expect = 4e-49
 Identities = 198/281 70%, Positives = 210/281 74%, Gaps = 16/281 5%
Query  1    MAVQKYTVALFLRRGPRGGPGRSYAADAGYTPAAAATPATPAATPA--GGWREGDDRRAE 58
            MAVQKYTVALFL      GP  SYAADAGYTPAAAATPATPAATPA  GG    D+++  
Sbjct  1    MAVQKYTVALFLAVALVAGPAASYAADAGYTPAAAATPATPAATPAAAGGKATTDEQKLL 60
Query  59   A---AGGRQRLASRQPWPPLPT--PLRRTSSRSSRPPSPSPPRASSPTSAAKAPGLIPKL 113
                AG +  +A+    PP      +    S SS+            TSAAKAPGLIPKL
Sbjct  61   EDVNAGFKAAVAAAANAPPADKFKIFEAAFSESSK--------GLLATSAAKAPGLIPKL 112
Query  114  DTAYDVAYKAAE-AHPRGQVRRLRHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGEL 172
            DTAYDVAYKAAE A P  +   +      +LRVIAGALEVHAVKPATEEV AAKIPTGEL
Sbjct  113  DTAYDVAYKAAEGATPEAKYDAFVTALTEALRVIAGALEVHAVKPATEEVPAAKIPTGEL 172
Query  173  QIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSR 232
            QIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGA       P       +
Sbjct  173  QIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQ 232
Query  233  PTPPPSPAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAA 289
                   AAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAAT AATVAT AATAAA
Sbjct  233  AYAATVAAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATGAATVATGAATAAA 289

Sequence Alignment: 3. Allergen Name: Poa p 5.0101 Sequence ID: Q9FPR0

 Score = 137.2 bits 744,  Expect = 8e-34
 Identities = 144/280 51%, Positives = 175/280 62%, Gaps = 11/280 3%
Query  1    MAVQKYTVALFLRRGPRGGPGRSYAADAGYTPA--AAATPATPAATPAGGWREGDDRRAE 58
            MAVQKYTVALFL      GP  SYAADAGY PA  AAA  A    TP    +  +D    
Sbjct  1    MAVQKYTVALFLTVALVAGPAASYAADAGYAPATPAAAGAAAGKITPTQEQKLMEDI--- 57
Query  59   AAGGRQRLASRQPWPPLPTPLRRTSSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYD 118
              G +  +A+    PP     +  + +++   S S   +++  +AA+APG++  +    D
Sbjct  58   NVGFKAAVAAAAGAPPAD---KFKTFQAAF--SASVEASAAKLNAAQAPGFVSHVAATSD 112
Query  119  VAYKAAE-AHPRGQVRRLRHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDK 177
              YKAA  A P  +   +      +LR+IAG L+VHAVKP TEE  AAKIP GE QI+DK
Sbjct  113  ATYKAAVGATPEAKFDSFVAAFTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDK 172
Query  178  IDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPP 237
            IDAAFK+AATAANAAP NDKFTVFE+AFN A+ E TGGA     S P       +     
Sbjct  173  IDAAFKVAATAANAAPANDKFTVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAAT 232
Query  238  SPAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAA 288
              AAPEVK+AVF+AALTKAITAM + QK  KP A AAT AA  ATAA  AA
Sbjct  233  IAAAPEVKFAVFKAALTKAITAMAEVQKVSKPVAGAATVAAGAATAATGAA 283

Sequence Alignment: 4. Allergen Name: Dac g 5.02 Sequence ID: AAK62277

 Score = 136.0 bits 737,  Expect = 2e-33
 Identities = 147/253 58%, Positives = 171/253 67%, Gaps = 18/253 7%
Query  26   ADAGYTPAAAATPATPAATPAGGWREGDDRR-AE--AAGGRQRLASRQPWPPLPTPLRRT 82
            ADAGYTPAAAATPA      AGG    ++++  E   AG +  +A+    PP        
Sbjct  1    ADAGYTPAAAATPAA-----AGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPAD------ 49
Query  83   SSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVAYK-AAEAHPRGQVRRLRHCPHR 141
              ++      +  +A+   +A K P ++ KLD AY VAYK AA   P  +   +      
Sbjct  50   KFKTFEATFTAACKANIAAAATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTE 109
Query  142  SLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVF 201
            +LRVIAGALEVHAVKPA EEV AAKIP GELQIVDKIDAA+KIAATAANAAP NDKFTVF
Sbjct  110  ALRVIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVF 169
Query  202  ESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVFEAALTKAITAMT 261
            E AFNKA+ E TGGA       P       +       AAPEVKYAVFEAALTKAITAM+
Sbjct  170  EGAFNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMS 229
Query  262  QAQKAGKPAAAA---ATAAATVATAAATAAA 289
            +AQK   PAAAA   ATAAA+ AT AATAAA
Sbjct  230  EAQKVATPAAAATGAATAAASAATGAATAAA 260

Sequence Alignment: 5. Allergen Name: Hol l 5.0101 Sequence ID: CAB10765

 Score = 135.5 bits 734,  Expect = 2e-33
 Identities = 144/252 57%, Positives = 167/252 66%, Gaps = 19/252 7%
Query  26   ADAGYTPAAAATPATPAATPAGGWREGDDRRAEA---AGGRQRLASRQPWPPLPTPLRRT 82
            ADAGYTPAA      PAA  AGG    D+++      AG +  +A+    PP        
Sbjct  1    ADAGYTPAA------PAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPAD------ 48
Query  83   SSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVAYKAAE-AHPRGQVRRLRHCPHR 141
              ++      +  +AS   +A KAPGLIP+L+ A + AY AA+ A P  +   +      
Sbjct  49   KYKTFEAAFTASSKASIAAAATKAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTE 108
Query  142  SLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVF 201
            +LRVIAGALEVHAVKPATEEV AAKIP GELQIVDKIDAAF+IAATAANAAP NDKFTVF
Sbjct  109  ALRVIAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVF 168
Query  202  ESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVFEAALTKAITAMT 261
            E AFNKA+ E TGGA       P       +        APEVKY VFE AL KAITAM+
Sbjct  169  EGAFNKAIKESTGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMS 228
Query  262  QAQKAGKPAAAA---ATAAATVATAAATAAA 289
            +AQK  KP AAA   ATAAA VA  AATAAA
Sbjct  229  EAQKEAKPVAAATGAATAAAGVAAGAATAAA 259

Sequence Alignment: 6. Allergen Name: Dac g 5.01 Sequence ID: AAK62276

 Score = 135.1 bits 732,  Expect = 3e-33
 Identities = 145/253 57%, Positives = 168/253 66%, Gaps = 18/253 7%
Query  26   ADAGYTPAAAATPATPAATPAGGWREGDDR---RAEAAGGRQRLASRQPWPPLPTPLRRT 82
            ADAGYTPAAAATPAT     AGG    +++       AG +  +A+    PP        
Sbjct  1    ADAGYTPAAAATPAT-----AGGKAMTEEQTLIEDVNAGFKAAVAAASSAPPAD------ 49
Query  83   SSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVAYKAAEAH-PRGQVRRLRHCPHR 141
              ++      +  +A+   +A K P ++ KLD AY VAYK A    P  +   +      
Sbjct  50   KFKTFEATFTAACKANIAAAATKVPLFVAKLDAAYAVAYKTATGPTPEAKYDAFVAALTE 109
Query  142  SLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVF 201
            +LRVIAGALEVHAVKPA EEV AAKIP GELQIVDKIDAA+KIAATAANAAP NDKFTVF
Sbjct  110  ALRVIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVF 169
Query  202  ESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVFEAALTKAITAMT 261
            E AFNKA+ E TGGA       P       +       AAPEVKYAVFEAALTKAITAM+
Sbjct  170  EGAFNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMS 229
Query  262  QAQKAGKPAAAA---ATAAATVATAAATAAA 289
            +AQK   PAA A   ATAAA+ AT AATAAA
Sbjct  230  EAQKVATPAAVATGAATAAASAATGAATAAA 260

Sequence Alignment: 7. Allergen Name: Phl p 5.0201 Sequence ID: Q40963

 Score = 129.4 bits 698,  Expect = 2e-31
 Identities = 148/263 56%, Positives = 172/263 65%, Gaps = 17/263 6%
Query  13   RRGPRGGPGRSYAADAGYTPAAAATPATPAATPAGGWREGDDRRAE--AAGGRQRLASRQ 70
            RRGPRGGPGRSY ADAGY PA   TPA  A   AG     + +  E    G +  +A+  
Sbjct  7    RRGPRGGPGRSYTADAGYAPA---TPAA-AGAAAGKATTEEQKLIEDINVGFKAAVAAAA 62
Query  71   PWPPLPTPLRRTSSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVAYKAAE-AHPR 129
              P         ++ +S          SS  +AAKAPGL+PKLD AY VAYKAA  A P 
Sbjct  63   SVPAADKFKTFEAAFTS----------SSKAAAAKAPGLVPKLDAAYSVAYKAAVGATPE 112
Query  130  GQVRRLRHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAA 189
             +   +      +LRVIAGALEVHAVKP TEE   AKIP GELQI+DKIDAAFK+AATAA
Sbjct  113  AKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAA 172
Query  190  NAAPTNDKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVF 249
              AP +DKFTVFE+AFNKA+ E TGGA       P       +       AAP+VKYAVF
Sbjct  173  ATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVF 232
Query  250  EAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAA 289
            EAALTKAITAM++ QK  +PA  AAT AA  AT AA AA+
Sbjct  233  EAALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAAS 272

Sequence Alignment: 8. Allergen Name: Phl p 5.0205 Sequence ID: 9249029

 Score = 127.7 bits 688,  Expect = 5e-31
 Identities = 137/250 54%, Positives = 159/250 63%, Gaps = 17/250 6%
Query  26   ADAGYTPAAAATPATPAATPAGGWREGDDRRAE--AAGGRQRLASRQPWPPLPTPLRRTS 83
            ADAGY PA   TPA  A   AG     + +  E    G    +A+    P         +
Sbjct  1    ADAGYAPA---TPAA-AGAEAGKATTEEQKLIEDINVGFNAAVAAAASVPAADKFKTFEA 56
Query  84   SRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVAYKAAE-AHPRGQVRRLRHCPHRS 142
            + +S          SS  + AKAPGL+PKLD AY VAYKAA  A P  +   L      +
Sbjct  57   AFTS----------SSKAATAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSLVASLTEA 106
Query  143  LRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFE 202
            LRVIAGALEVHAVKP TEE   AKIP GELQI+DKIDAAFK+AATAA  AP +DKFTVFE
Sbjct  107  LRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFE 166
Query  203  SAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVFEAALTKAITAMTQ 262
            +AFNKA+ E TGGA       P       +P      AAP+VKYAVFEAALTKAITAM++
Sbjct  167  AAFNKAIKESTGGAYDTYKCIPSLEAAVKQPYAATVAAAPQVKYAVFEAALTKAITAMSE 226
Query  263  AQKAGKPAAAAATAAATVATAAATAAA 289
             QK  +PA  AAT AA  AT AA AA+
Sbjct  227  VQKVSQPATGAATVAAGAATTAAGAAS 253

Sequence Alignment: 9. Allergen Name: Phl p 5.0202 Sequence ID: CAB05371

 Score = 126.0 bits 678,  Expect = 2e-30
 Identities = 147/263 55%, Positives = 171/263 65%, Gaps = 17/263 6%
Query  13   RRGPRGGPGRSYAADAGYTPAAAATPATPAATPAGGWREGDDRRAE--AAGGRQRLASRQ 70
            RRGPRGGPGRSYAADAGY PA   TPA  A   AG     + +  E    G +  +A+  
Sbjct  4    RRGPRGGPGRSYAADAGYAPA---TPAA-AGAEAGKATTEEQKLIEDINVGFKAAVAAAA 59
Query  71   PWPPLPTPLRRTSSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVAYKAAE-AHPR 129
              P         ++ +S          SS  + AKAPGL+PKLD AY VAYKAA  A P 
Sbjct  60   SVPAGDKFKTFEAAFTS----------SSKAATAKAPGLVPKLDAAYSVAYKAAVGATPE 109
Query  130  GQVRRLRHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAA 189
             +   +      +LRVIAGALEVHAVKP TEE   AKIP GELQI+DKIDAAFK+AATAA
Sbjct  110  AKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAA 169
Query  190  NAAPTNDKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVF 249
              AP +DKFTVFE+AFNKA+ E TGGA       P       +       AAP+VKYAVF
Sbjct  170  ATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVF 229
Query  250  EAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAA 289
            EAALTKAITAM++ QK  +PA  AAT AA  AT A  AA+
Sbjct  230  EAALTKAITAMSEVQKVSQPATGAATVAAGAATTATGAAS 269

Sequence Alignment: 10. Allergen Name: Phl p 5.0204 Sequence ID: AAC25996

 Score = 125.1 bits 673,  Expect = 3e-30
 Identities = 135/250 54%, Positives = 159/250 63%, Gaps = 17/250 6%
Query  26   ADAGYTPAAAATPATPAATPAGGWREGDDRRAE--AAGGRQRLASRQPWPPLPTPLRRTS 83
            ADAGY PA   TPA  A   AG     + +  E    G +  +A+    P         +
Sbjct  1    ADAGYAPA---TPAA-AGAEAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEA 56
Query  84   SRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVAYKAAE-AHPRGQVRRLRHCPHRS 142
            + +S          SS  + AKAPGL+PKLD AY VAYKAA  A P  +   +      +
Sbjct  57   AFTS----------SSKAATAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEA 106
Query  143  LRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFE 202
            LRVIAGALEVHAVKP TEE   AKIP GELQI+DKIDAAFK+AATAA  AP +DKFTVFE
Sbjct  107  LRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFE 166
Query  203  SAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVFEAALTKAITAMTQ 262
            +AFNKA+ E TGGA       P       +       AAP+VKYAVFEAALTKAITAM++
Sbjct  167  AAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSE 226
Query  263  AQKAGKPAAAAATAAATVATAAATAAA 289
             QK  +PA  AAT AA  AT AA AA+
Sbjct  227  VQKVSQPATGAATVAAGAATTAAGAAS 253

Sequence Alignment: 11. Allergen Name: Phl p 5.0101 Sequence ID: CAA52753

 Score = 123.0 bits 660,  Expect = 1e-29
 Identities = 151/284 53%, Positives = 181/284 63%, Gaps = 24/284 8%
Query  1    MAVQKYTVALFLRRGPRGGPGRSYAADAGY---TPAAAA---TPATPAA----TPAGGWR 50
            MAV++YTVALFL      GP  SYAAD GY   TPAA A   TPATPAA     PAG   
Sbjct  1    MAVHQYTVALFLAVALVAGPAASYAADLGYGPATPAAPAAGYTPATPAAPAEAAPAGKAT 60
Query  51   EGDDRRAEA--AGGRQRLASR---QPWPPLPTPLRRTSSRSSRPPSPS---PPRASSPTS 102
              + +  E   AG +  LA+    QP     T +    + S++  +      P+ ++ +S
Sbjct  61   TEEQKLIEKINAGFKAALAAAAGVQPADKYRTFVATFGAASNKAFAEGLSGEPKGAAESS 120
Query  103  AAKAPGLIPKLDTAYDVAYKAAE-AHPRGQVRRLRHCPHRSLRVIAGALEVHAVKPATEE 161
            +  A  L  KLD AY +AYK AE A P  +          +LR+IAG LEVHAVKPA EE
Sbjct  121  SKAA--LTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEE 178
Query  162  VLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAMRPTS 221
            V    IP GELQ+++K+DAAFK+AATAANAAP NDKFTVFE+AFN A+   TGGA     
Sbjct  179  VKV--IPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYESYK 236
Query  222  SSPPSRPRSSRPTPPPSPAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVA 281
              P       +        APEVKY VFE AL KAITAM++AQKA KPAAAA TA AT A
Sbjct  237  FIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAA-TATATAA 295
Query  282  TAAATAAA 289
              AAT AA
Sbjct  296  VGAATGAA 303

Sequence Alignment: 12. Allergen Name: Phl p 5.0109 Sequence ID: CAD87529

 Score = 120.9 bits 648,  Expect = 6e-29
 Identities = 132/261 50%, Positives = 160/261 61%, Gaps = 19/261 7%
Query  19   GPGRSYAADAGYTPAAAATPATPAATPAGGWREGDDRRAEA--AGGRQRLASRQPWPP-- 74
            GP    A  AGYTPAA   PA   A PAG     + +  E   AG +  LA+    PP  
Sbjct  6    GPATPAAPAAGYTPAA---PA--GAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPAD 60
Query  75   ----LPTPLRRTSSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVAYKAAE-AHPR 129
                +   +   S+++        P+ ++ +S+  A  L  KLD AY +AYK AE A P 
Sbjct  61   KYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAA--LTSKLDAAYKLAYKTAEGATPE 118
Query  130  GQVRRLRHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAA 189
             +          +LR+IAG LEVHAVKPA EEV    IP GELQ+++K+DAAFK+AATAA
Sbjct  119  AKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAA 176
Query  190  NAAPTNDKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVF 249
            NAAP NDKFTVFE+AFN A+   TGGA       P       +        APEVKY VF
Sbjct  177  NAAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVF 236
Query  250  EAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAA 289
            E AL KAITAM++AQKA KPAAAA TA AT A  AAT AA
Sbjct  237  ETALKKAITAMSEAQKAAKPAAAA-TATATSAVGAATGAA 275

Sequence Alignment: 13. Allergen Name: Phl p 5.0102 Sequence ID: Q40962

 Score = 120.4 bits 645,  Expect = 8e-29
 Identities = 132/263 50%, Positives = 160/263 60%, Gaps = 17/263 6%
Query  19   GPGRSYAADAGYTPAAAATPATPAATPAGGWREGDDRR-AEA--AGGRQRLASR--QPWP 73
            GP    A  AGYTPA   TPA PA   A G    ++++  E   AG +  LA    QP  
Sbjct  6    GPATPAAPAAGYTPA---TPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQPAD 62
Query  74   PLPTPLRRTSSRSSRPPSPS---PPRASSPTSAAKAPGLIPKLDTAYDVAYKAAE-AHPR 129
               T +      S++  +      P+ ++ +S+  A  L  KLD AY +AYK AE A P 
Sbjct  63   KYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAA--LTSKLDAAYKLAYKTAEGATPE 120
Query  130  GQVRRLRHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAA 189
             +          +LR+IAG LEVHAVKPA EEV    IP GELQ+++K+DAAFK+AATAA
Sbjct  121  AKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAA 178
Query  190  NAAPTNDKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVF 249
            NAAP NDKFTVFE+AFN  +   TGGA       P       +        APEVKY VF
Sbjct  179  NAAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVF 238
Query  250  EAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAA 289
            E AL KAITAM++AQKA KPAAAA TA AT A  AAT AA
Sbjct  239  ETALKKAITAMSEAQKAAKPAAAA-TATATAAVGAATGAA 277

Sequence Alignment: 14. Allergen Name: Poa p 5 Sequence ID: P22286

 Score = 120.3 bits 644,  Expect = 1e-28
 Identities = 148/280 52%, Positives = 179/280 63%, Gaps = 31/280 11%
Query  1    MAVQKYTVALFLRRGPRGGPGRSYAADAGY----TPAAAATPATPAATPAGGWREG--DD 54
            MAVQKYTVALFL      GP  SYAAD  Y    TPAA A   TPAA PAG   +   D+
Sbjct  1    MAVQKYTVALFLV-ALVVGPAASYAADLSYGAPATPAAPAAGYTPAA-PAGAAPKATTDE 58
Query  55   RR------------AEAAGGRQRLASRQPWPPLPTPLRRTSSRSSRPPSPSPPRASSPTS 102
            ++              AAGG   + +   +  +   +   S+++      + P+ ++  S
Sbjct  59   QKMIEKINVGFKAAVAAAGG---VPAANKYKTFVATFGAASNKAFAEALSTEPKGAAVDS 115
Query  103  AAKAPGLIPKLDTAYDVAYKAAE-AHPRGQVRRLRHCPHRSLRVIAGALEVHAVKPATEE 161
            +  A  L  KLD AY +AYK+AE A P  +          +LR+IAG LEVH VKPA EE
Sbjct  116  SKAA--LTSKLDAAYKLAYKSAEGATPEAKYDDYVATLSEALRIIAGTLEVHGVKPAAEE 173
Query  162  VLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAMRPTS 221
            V A   P GELQ++DK+DAAFK+AATAANAAP NDKFTVFE+AFN A+   TGGA +   
Sbjct  174  VKAT--PAGELQVIDKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYQSYK 231
Query  222  SSPPSRPRSSRPTPPPSPAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAA---ATAAA 278
              P       +        AP VKY VFE AL KAITAM+QAQKA KPAAAA   ATAA 
Sbjct  232  FIPALEAAVKQSYAATVATAPAVKYTVFETALKKAITAMSQAQKAAKPAAAATGTATAAV 291
Query  279  TVATAAATAAA 289
              AT AATAAA
Sbjct  292  GAATGAATAAA 302

Sequence Alignment: 15. Allergen Name: Hol l 5.0201 Sequence ID: CAB10766

 Score = 119.0 bits 637,  Expect = 2e-28
 Identities = 121/193 62%, Positives = 135/193 69%, Gaps = 5/193 2%
Query  96   RASSPTSAA---KAPGLIPKLDTAYDVAYKAAEAHPR-GQVRRLRHCPHRSLRVIAGALE 151
            R S+  S A   K P L  KL  AY  A+KA+    +  +   +      +LRVIAGALE
Sbjct  39   RGSTEQSKAEETKMPELSSKLVDAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALE 98
Query  152  VHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNE 211
            VHAVKPATEEV AAKIP G+LQ+VDKIDA+FKIAATAANAAP NDKFTVFE+AFNKAL E
Sbjct  99   VHAVKPATEEVPAAKIPAGDLQVVDKIDASFKIAATAANAAPANDKFTVFETAFNKALKE 158
Query  212  CTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVFEAALTKAITAMTQAQKAGKPAA 271
             TGGA       P       +       AAPEVKYAVFEAALTKAITAM+QAQK  +PAA
Sbjct  159  STGGAYESYKFIPSLEAAVKQAYASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQPAA 218
Query  272  AAATAAATVATAAATAAA 289
            AA T AATVA  AAT AA
Sbjct  219  AA-TGAATVAAGAATTAA 235

Sequence Alignment: 16. Allergen Name: Phl p 5.0107 Sequence ID: AAC16527

 Score = 117.9 bits 630,  Expect = 5e-28
 Identities = 128/258 49%, Positives = 159/258 61%, Gaps = 19/258 7%
Query  26   ADAGYTPAAAATPATPA-ATPAGGWREGDDRRAEAA--GGRQRLASRQPWPP------LP 76
            AD GY     ATPA PA A PAG     + +  E    G +  LA+    PP      + 
Sbjct  1    ADLGY--GGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFV 58
Query  77   TPLRRTSSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVAYKAAE-AHPRGQVRRL 135
              +   S+++      + P+ ++ +S+  A  L  KLD AY +AYK AE A P  +    
Sbjct  59   ATFGAASNKAFAEGLSAEPKGAAESSSKAA--LTSKLDAAYKLAYKTAEGATPEAKYDAY 116
Query  136  RHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTN 195
                  +LR+IAG LEVHAVKPA EEV    IP GELQ+++K+D+AFK+AATAANAAP N
Sbjct  117  VATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSAFKVAATAANAAPAN 174
Query  196  DKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVFEAALTK 255
            DKFTVFE+AFN A+   TGGA       P       +        APEVKY VFE AL K
Sbjct  175  DKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKK 234
Query  256  AITAMTQAQKAGKPAAAA---ATAAATVATAAATAAA 289
            AITAM++AQKA KPAAAA   AT+A   AT A TAAA
Sbjct  235  AITAMSEAQKAAKPAAAATATATSAVGAATGATTAAA 271

Sequence Alignment: 17. Allergen Name: Phl p 5.0106 Sequence ID: AAC16526

 Score = 116.8 bits 624,  Expect = 9e-28
 Identities = 126/257 49%, Positives = 156/257 60%, Gaps = 17/257 6%
Query  26   ADAGYTPAAAATPATPA-ATPAGGWREGDDRRAEAA--GGRQRLASRQPWPP------LP 76
            AD GY     ATPA PA A PAG     + +  E    G +  LA+    PP      + 
Sbjct  1    ADLGY--GGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFV 58
Query  77   TPLRRTSSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVAYKAAE-AHPRGQVRRL 135
              +   S+++      + P+ ++ +S+  A  L  KLD AY +AYK AE A P  +    
Sbjct  59   ATFGAASNKAFAEGLSAEPKGAAESSSKAA--LTSKLDAAYKLAYKTAEGATPEAKYDAY 116
Query  136  RHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTN 195
                  +LR+IAG LEVHAVKPA EEV    IP GELQ+++K+D+AFK+AATAANAAP N
Sbjct  117  VATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSAFKVAATAANAAPAN 174
Query  196  DKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVFEAALTK 255
            DKFTVFE+AFN A+   TGGA       P       +        APEVKY VFE AL K
Sbjct  175  DKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKK 234
Query  256  AITAMTQAQKAGKPAAAAATAAATVATAAATAAA 289
            AITAM++AQKA KPA  A TA AT A  AAT AA
Sbjct  235  AITAMSEAQKAAKPATEA-TATATAAVGAATGAA 267

Sequence Alignment: 18. Allergen Name: Sec c 5.0101 Sequence ID: CBG76811

 Score = 116.4 bits 621,  Expect = 1e-27
 Identities = 122/284 42%, Positives = 158/284 55%, Gaps = 6/284 2%
Query  1    MAVQKYTVALFLRRGPRGGPGRSYAADAGYTPAAAATPATPAATPAGGWREGDDRRAEAA 60
            MAVQ+YTVALFL      GP  SY   A   P       TP          G     EAA
Sbjct  1    MAVQQYTVALFLAVALVAGPAVSYGTYAPAAPGTQPKATTPEQKLMENINNGFKAAVEAA 60
Query  61   GGRQRLASRQPWPPLPTPLRRTSSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVA 120
                 +A    +  + T + + S+++      +      P  +     L   L+++Y +A
Sbjct  61   AA---VAPADKYKTFQTTFIKGSNKAFADVLTAAASGQIPAQSDSMARLSTSLESSYKLA 117
Query  121  YKAAE-AHPRGQVRRLRHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKID 179
            Y +AE A P  +          SLRVI+GA+EVHAVKPA+EEV    +P  +L++VD+ID
Sbjct  118  YDSAEGATPETKYDTYVASLTESLRVISGAFEVHAVKPASEEVKG--VPAPQLKVVDQID 175
Query  180  AAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSP 239
            AA++ AATAANAAPTNDKF VFES+FNKA+ E TGGA    +  P       +       
Sbjct  176  AAYRTAATAANAAPTNDKFNVFESSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVA 235
Query  240  AAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAA 289
            +APEVKYAVF+AAL+KAI AM +A+K  KPAAAAA  A   AT  A A A
Sbjct  236  SAPEVKYAVFQAALSKAINAMVEAEKDAKPAAAAAATATATATVGAAAGA 285

Sequence Alignment: 19. Allergen Name: Phl p 5.0108 Sequence ID: AAC16528

 Score = 116.0 bits 619,  Expect = 2e-27
 Identities = 125/257 48%, Positives = 155/257 60%, Gaps = 17/257 6%
Query  26   ADAGYTPAAAATPATPA-ATPAGGWREGDDRRAEAA--GGRQRLASRQPWPP------LP 76
            AD GY     ATPA PA A PAG     + +  E    G +  LA+    PP      + 
Sbjct  1    ADLGY--GGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFV 58
Query  77   TPLRRTSSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVAYKAAE-AHPRGQVRRL 135
              +   S+++      + P+ ++ +S+  A  L  KLD AY +AYK AE A P  +    
Sbjct  59   ATFGAASNKAFAEGLSAEPKGAAESSSKAA--LTSKLDAAYKLAYKTAEGATPEAKYDAY 116
Query  136  RHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTN 195
                  +LR+IAG LEVHAVKPA EEV    IP GELQ+++K+D+AFK+AATAANAAP N
Sbjct  117  VATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSAFKVAATAANAAPAN 174
Query  196  DKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVFEAALTK 255
            DKFTVFE+AFN A+   TGGA       P       +        APEVKY VFE AL K
Sbjct  175  DKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKK 234
Query  256  AITAMTQAQKAGKPAAAAATAAATVATAAATAAA 289
            A TAM++AQKA KPA  A TA AT A  AAT AA
Sbjct  235  AFTAMSEAQKAAKPATEA-TATATAAVGAATGAA 267

Sequence Alignment: 20. Allergen Name: Pha a 5 Sequence ID: P56164

 Score = 116.0 bits 619,  Expect = 2e-27
 Identities = 146/265 55%, Positives = 169/265 63%, Gaps = 33/265 12%
Query  1    MAVQKYTVALFLRRGPRGGPGRSYAADAGYTPAAAATPATPAATPAGGWREG---DDRRA 57
            MAVQKYT+ALFL      GP       A  TP    TP TP   P    R+      R  
Sbjct  1    MAVQKYTMALFLAVALVAGP-------AAPTP---PTPRTPPLLPPPRARDKATLTSRSV 50
Query  58   EAAGGRQRLASRQPWPPLPTPLRRTSSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAY 117
            E        ASR+PW     P  +  + +        P A   ++A KAP L  KLD AY
Sbjct  51   EDINA----ASRRPWWASVPPADKFKTFADH--VLCVPNADVTSAATKAPQLKAKLDAAY 104
Query  118  DVAYKAAEAH-PRGQVRRLRHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVD 176
             VAY+AAE   P  +   +      +LRVIAGA+EVHAVKPATEEV+A   P GELQIVD
Sbjct  105  RVAYEAAEGSTPEAKYDAFIAALTEALRVIAGAFEVHAVKPATEEVVAD--PVGELQIVD 162
Query  177  KIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPP 236
            KIDAAFKIAATAAN+AP NDKFTVFE AFNKA+ E T GA   T    PS   + +    
Sbjct  163  KIDAAFKIAATAANSAPANDKFTVFEGAFNKAIKESTAGAYE-TYKFIPSLEAAVKQAYG 221
Query  237  PSPA-APEVKYAVFEAALTKAITAMTQAQKAGKPAAA---------AATAAATVATAA 284
             + A APEVKYAVFEA LTKAITAM++AQK  KP  +         AA  AATVA A+
Sbjct  222  ATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPPLSPQPPQVLPLAAGGAATVAAAS 279

Sequence Alignment: 21. Allergen Name: Poa p 5 Sequence ID: P22285

 Score = 115.4 bits 615,  Expect = 3e-27
 Identities = 148/284 52%, Positives = 176/284 61%, Gaps = 24/284 8%
Query  1    MAVQKYTVALFLRRGPRGGPGRSYAADAGY-TPAAAATPATPAATPAGGWREGDDRRA-- 57
            MAV++YTVALFL      GP  SYAAD GY  PA  ATPATPAA PA G+       A  
Sbjct  1    MAVHQYTVALFLAVALVAGPAASYAADVGYGAPATLATPATPAA-PAAGYTPAAPAGAAP 59
Query  58   EAAGGRQRL---------ASRQPWPPLPTPLRRTSSRSSRPPSPSPPRA----SSPTSAA 104
            +A    Q+L         A+      +P   +  +  ++   + +   A    + P  AA
Sbjct  60   KATTDEQKLIEKINAGFKAAVAAAAGVPAVDKYKTFVATFGTASNKAFAEALSTEPKGAA 119
Query  105  KAPG---LIPKLDTAYDVAYKAAE-AHPRGQVRRLRHCPHRSLRVIAGALEVHAVKPATE 160
             A     L  KLD AY +AYK+AE A P  +          +LR+IAG LEVHAVKPA E
Sbjct  120  AASSNAVLTSKLDAAYKLAYKSAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAGE 179
Query  161  EVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAMRPT 220
            EV A  IP GELQ++DK+DAAFK+AATAANAAP NDKFTVFE+AFN A+   TGGA +  
Sbjct  180  EVKA--IPAGELQVIDKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYQSY 237
Query  221  SSSPPSRPRSSRPTPPPSPAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATV 280
               P       +        AP VKY VFE AL KAITAM+QAQKA KPAAA  TA AT 
Sbjct  238  KFIPALEAAVKQSYAATVATAPAVKYTVFETALKKAITAMSQAQKAAKPAAAV-TATATG 296
Query  281  ATAAATAA 288
            A  AAT A
Sbjct  297  AVGAATGA 304

Sequence Alignment: 22. Allergen Name: Phl p 5.0105 Sequence ID: AAC16525

 Score = 114.3 bits 609,  Expect = 5e-27
 Identities = 124/257 48%, Positives = 155/257 60%, Gaps = 17/257 6%
Query  26   ADAGYTPAAAATPATPA-ATPAGGWREGDDRRAEAA--GGRQRLASRQPWPP------LP 76
            AD GY     ATPA PA A PAG     + +  E    G +  LA+    PP      + 
Sbjct  1    ADLGY--GGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFV 58
Query  77   TPLRRTSSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVAYKAAE-AHPRGQVRRL 135
              +   S+++      + P+ ++ +S+  A  L  KLD AY +AYK AE A P  +    
Sbjct  59   ATFGAASNKAFAEGLSAEPKGAAESSSKAA--LTSKLDAAYKLAYKTAEGATPEAEYDAY 116
Query  136  RHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTN 195
                  +LR+IAG LEVHAVKPA EEV    IP GELQ+++K+D+A+K+AATAANAAP N
Sbjct  117  VATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSALKVAATAANAAPAN 174
Query  196  DKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVFEAALTK 255
            DKFTVFE+AFN A+   TGGA       P       +        APEVKY VFE AL K
Sbjct  175  DKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKK 234
Query  256  AITAMTQAQKAGKPAAAAATAAATVATAAATAAA 289
            AITA ++AQKA KPA  A TA AT A  AAT AA
Sbjct  235  AITATSEAQKAAKPATEA-TATATAAVGAATGAA 267

Sequence Alignment: 23. Allergen Name: Poa p 5 Sequence ID: P22284

 Score = 114.4 bits 609,  Expect = 7e-27
 Identities = 128/264 48%, Positives = 158/264 59%, Gaps = 13/264 4%
Query  20   PGRSYAADAGYTPAAAATPATPAATPAGGWREGDD---RRAEAAGGRQRLASRQPWPPLP 76
            P +     A YTPAA A  A  A T      E  +   + A AA      AS+  +  + 
Sbjct  98   PAKPAPKVAAYTPAAPAGAAPKATTDEQKLIEKINVGFKAAVAAAAGVPAASK--YKTFV 155
Query  77   TPLRRTSSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVAYKAAE-AHPRGQVRRL 135
              +   S+++      + P+ ++  S+ KA  L  KLD AY +AYK+AE A P  +    
Sbjct  156  ATFGAASNKAFAEALSTEPKGAAVASS-KAV-LTSKLDAAYKLAYKSAEGATPEAKYDAY 213
Query  136  RHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTN 195
                  +LR+IAG LEVH VKPA EEV A  IP GELQ++DK+DAAFK+AATAANAAP N
Sbjct  214  VATLSEALRIIAGTLEVHGVKPAAEEVKA--IPAGELQVIDKVDAAFKVAATAANAAPAN 271
Query  196  DKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVFEAALTK 255
            DKFTVFE+AFN A+   TGGA +     P       +        AP VKY VFE AL K
Sbjct  272  DKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVKQSYAATVATAPAVKYTVFETALKK 331
Query  256  AITAMTQAQKAGKPAAAA---ATAAATVATAAATAAA 289
            AITAM+QAQKA KPAAA    AT+A   AT AATAAA
Sbjct  332  AITAMSQAQKAAKPAAAVTGTATSAVGAATGAATAAA 368

Sequence Alignment: 24. Allergen Name: Phl p 5 Sequence ID: AAK25823

 Score = 111.4 bits 592,  Expect = 4e-26
 Identities = 119/250 47%, Positives = 148/250 59%, Gaps = 15/250 6%
Query  32   PAAAATPATPAATPAGGWREGDDRRAEAAGGRQRLASRQPWPPLPTPLRRTSSRSSRPPS 91
            P A   P  P    A  ++ G   +A +    +R A   P     T +    + S++  +
Sbjct  14   PPATPPPPPPPQLGASPYKLGPSPKARS----ERPAIVPPADKYRTFVATFGAASNKAFA 69
Query  92   PS---PPRASSPTSAAKAPGLIPKLDTAYDVAYKAAE-AHPRGQVRRLRHCPHRSLRVIA 147
                  P+  + +S+  A  L  KLD AY +AYK AE A P  +          +LR+IA
Sbjct  70   EGLSGEPKGGAESSSKAA--LTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIA 127
Query  148  GALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNK 207
            G LEVHAVKPA EEV    IP GELQ+++K+DAAFK+AATAANAAP NDKFTVFE+AFN 
Sbjct  128  GTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNN 185
Query  208  ALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVFEAALTKAITAMTQAQKAG 267
            A+   TGGA       P       +        APEVKY VFE AL KAITAM++AQKA 
Sbjct  186  AIKAGTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAA 245
Query  268  KPAAAA---ATAAATVATAAATAAA 289
            KPAAAA   AT+A    T A TAAA
Sbjct  246  KPAAAATATATSAVGAPTGATTAAA 270

Sequence Alignment: 25. Allergen Name: Phl p 5.0104 Sequence ID: CAB05372

 Score = 111.3 bits 591,  Expect = 4e-26
 Identities = 122/257 47%, Positives = 154/257 59%, Gaps = 17/257 6%
Query  26   ADAGYTPAAAATPATPA-ATPAGGWREGDDRRAEAA--GGRQRLASRQPWPP------LP 76
            AD GY     ATPA PA A PAG     + +  E    G +  LA+    PP      + 
Sbjct  1    ADLGY--GGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFV 58
Query  77   TPLRRTSSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVAYKAAE-AHPRGQVRRL 135
              +   S+++      + P+ ++ +S+  A  L  KL+ AY +AYK +E A P  +    
Sbjct  59   ATFGAASNKAFAEGLSAEPKGAAESSSKGA--LTSKLEAAYKLAYKTSEGATPEAKYDAY 116
Query  136  RHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTN 195
                  +LR+IAG LEVHAVKPA EEV    IP GELQ ++K+D+A+K+AATAANAA  N
Sbjct  117  VATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQFIEKVDSALKVAATAANAAAAN 174
Query  196  DKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVFEAALTK 255
            DKFTVFE+AFN A+   TGGA       P       +        APEVKY VFE AL K
Sbjct  175  DKFTVFEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKK 234
Query  256  AITAMTQAQKAGKPAAAAATAAATVATAAATAAA 289
            AITAM++AQKA KPA  A TA AT A  AAT AA
Sbjct  235  AITAMSEAQKAAKPATEA-TATATAAVGAATGAA 267

Sequence Alignment: 26. Allergen Name: Pha a 5 Sequence ID: P56167

 Score = 108.2 bits 574,  Expect = 2e-25
 Identities = 104/151 68%, Positives = 112/151 74%, Gaps = 4/151 2%
Query  142  SLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVF 201
            +LRVIAGA+EVHAVKPATEEV AAKIP GELQIVDKIDAAFKIAATAAN+AP NDKFTVF
Sbjct  13   ALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKIDAAFKIAATAANSAPANDKFTVF 72
Query  202  ESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPA-APEVKYAVFEAALTKAITAM 260
            E AFNKA+ E  GGA       P      S+     + A APEVKYAVFEA LTKAITAM
Sbjct  73   EGAFNKAIKERHGGAYETYKFIPSLEASRSKQAYGATVARAPEVKYAVFEAGLTKAITAM 132
Query  261  TQAQKAGKPA---AAAATAAATVATAAATAAAVLP 292
            ++AQK  KP     AAA  AAT A  AAT AA  P
Sbjct  133  SEAQKVAKPVRSVTAAAAGAATAAGGAATVAASRP 167

Sequence Alignment: 27. Allergen Name: Lol p 5 Sequence ID: Q40237

 Score = 107.3 bits 567,  Expect = 9e-25
 Identities = 133/289 46%, Positives = 162/289 56%, Gaps = 19/289 6%
Query  1    MAVQKYTVALFLRRGPRGGPGRSYAADAGY---------------TPAAAATPATPAATP 45
            MAVQK+TVALFL      GP  SYAADAGY               TPA  ATPATPAA P
Sbjct  1    MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATPATPATPAAVP 60
Query  46   AGGWREGDDRRAEA--AGGRQRLASRQPWPPLPTPLRRTSSRSSRPPSPSPPRASSPTSA 103
            +G     + +  E   AG +  +A+    PP         +  +          +S  + 
Sbjct  61   SGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNKAFVEGLASGYAD 120
Query  104  AKAPGLIPKLDTAYDVAYKAAE-AHPRGQVRRLRHCPHRSLRVIAGALEVHAVKPATEEV 162
                 L  KLD A  +AY+AA+ A P  +          +LRVIAG LEVHAVKPA EEV
Sbjct  121  QSKNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEV 180
Query  163  LAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAMRPTSS 222
                IP  E+Q++DK+DAA++ AATAANAAP NDKFTVFE+ FN A+    G A      
Sbjct  181  KVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKF 240
Query  223  SPPSRPRSSRPTPPPSPAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAA-ATAAATVA 281
             P       +        APEVKY V E AL KA+TAM++A+K   PAAAA AT     A
Sbjct  241  IPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA 300
Query  282  TAAATAAA 289
            TA AT AA
Sbjct  301  TATATPAA 308

Sequence Alignment: 28. Allergen Name: Pha a 5 Sequence ID: P56165

 Score = 98.6 bits 516,  Expect = 3e-22
 Identities = 129/277 46%, Positives = 159/277 57%, Gaps = 33/277 11%
Query  1    MAVQKYTVALFLRRGPRGGPGRSYAADAGY---TPAAAAT---PATPAATP--AGGWREG 52
            MAVQKYTVALFL      GP   YA D GY   TPAA+AT   PATPAA+P  AG     
Sbjct  1    MAVQKYTVALFLAVALVAGPAALYAGD-GYAPATPAASATLATPATPAASPQHAGTTEYH 59
Query  53   DDRRA----EAAGGRQR--LASRQPWPPLPTPLRRTSSRSSRPPSPSPPRASSPTSAAKA 106
              R+A    E    RQ      R      P   +    R+ R P        S TSA  +
Sbjct  60   IVRKAGLNEEKNAARQTDDEQKRSDEINCPDFNKSVHCRADRLP------VCSSTSAHSS 113
Query  107  PGLIPKLDTAYDVAYKAAEAHPRGQVRRLRHCPHRSLRVIAGALEVHAVKPATEEVLAAK 166
                 K D A+ + Y + +                 + VI  A+EV  +    EEV    
Sbjct  114  -----KQDVAWMLGYGSIQGFSMDDAS--VGSVSSEFHVIESAIEV--ITYIGEEVKV-- 162
Query  167  IPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAMRPTSSSPPS 226
            IP GE+++++K+ AAF  AATAA+ AP NDKFTVF S+FNKA+ E TGGA       P  
Sbjct  163  IPAGEVEVINKVKAAFSTAATAADEAPANDKFTVFVSSFNKAIKETTGGAYAGYKFIPTL 222
Query  227  RPRSSRPTPPPSPAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAAT 286
                 +     S  APEVKYAVFE AL KAI+AM++AQK  KPAAA + A  T++ + AT
Sbjct  223  EAAVKQAYAASSATAPEVKYAVFETALKKAISAMSEAQKEAKPAAAISAATTTISASTAT 282
Query  287  AAAVLPPPLL 296
             AA  PPP L
Sbjct  283  PAAP-PPPQL 291

Sequence Alignment: 29. Allergen Name: Hor v 5.0101 Sequence ID: U57845

 Score = 91.5 bits 474,  Expect = 5e-20
 Identities = 92/186 49%, Positives = 111/186 59%, Gaps = 6/186 3%
Query  97   ASSPTSAAKAPGLIPKLDTAYDVAY-KAAEAHPRGQVRRLRHCPHRSLRVIAGALEVHAV 155
            A   +S AK   L   L+ +Y +AY KA  A P  +          SLRVI+G LEVH+V
Sbjct  122  AGQSSSMAK---LSSSLELSYKLAYDKAQGATPEAKYDAYVATLTESLRVISGTLEVHSV 178
Query  156  KPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGG 215
            KPA EEV    +P GEL+ +D++DAAF+ AATAA+AAP NDKFTVFES       +  GG
Sbjct  179  KPAAEEVKG--VPAGELKAIDQVDAAFRTAATAADAAPANDKFTVFESLQQGPSRKPRGG 236
Query  216  AMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAAT 275
            A       P       +       AAPEVK+ VF+ AL+KAI AMTQA K  KPAAAA  
Sbjct  237  AYESYKFIPALEAAVKQAYAATVAAAPEVKFTVFQTALSKAINAMTQAGKVAKPAAAATA 296
Query  276  AAATVATAAATA 287
             A   A AAATA
Sbjct  297  TATVAAGAAATA 308

Sequence Alignment: 30. Allergen Name: Pha a 5 Sequence ID: P56166

 Score = 79.1 bits 401,  Expect = 2e-16
 Identities = 132/269 49%, Positives = 157/269 58%, Gaps = 34/269 12%
Query  1    MAVQKYTVALFLRRGPRGGPGRSYAADAGYTPAAAATPATPAATPAGGWREGDDRRAEAA 60
            MAVQKYTVALFL      GP  SYAADAG TP   ATPA P A  AG     + +  E  
Sbjct  1    MAVQKYTVALFLAMALVAGPAASYAADAG-TPPTPATPAVPGAA-AGKATTHEQKLIEDI 58
Query  61   GGRQRLASRQPWPPLPTPLRRTSSRSSRPPSPSPPRASSPTSAAKAPGLIPK-LDTAYDV 119
                  A+ + WP            +S PP+       +  S A   G   K LD AY V
Sbjct  59   N-----AAFKWWP------------ASAPPADKYKTFETAFSKANIAGASTKGLDAAYSV 101
Query  120  AYK-AAEAHPRGQVRRLRHCPHRSLRVIAGALEVHAVKPATEE-VLAAKIPTGELQIVDK 177
             Y  AA A P  +   +      +LR++AG LEVHAVKPATEE V +AKI     +   +
Sbjct  102  VYNTAAGATPEAKYDSFVTALTEALRIMAGTLEVHAVKPATEEEVPSAKILRANSRSSTR 161
Query  178  IDAAFKIAAT---------AANAAPTNDKFTVFESAFNKALNECTGGAMRPTSSSPPSRP 228
              + FKIAAT         AAN+AP NDKFTVFE AFNKA+ E  GG    T    PS  
Sbjct  162  -SSRFKIAATVATPLSHSTAANSAPANDKFTVFEGAFNKAIKERHGGPTE-TYKFIPSLE 219
Query  229  RSSRPTPPPSPA-APEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATA 287
             + +     + A APEVKYAVFEA LTKAITAM++AQK  KP   +      +  AA  A
Sbjct  220  AAVKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPVRLSPQPPQVLPLAAGGA 279
Query  288  AAV 290
            A V
Sbjct  280  ATV 282

Sequence Alignment: 31. Allergen Name: Phl p 6.0102 Sequence ID: CAA76556

 Score = 34.0 bits 136,  Expect = 0.004
 Identities = 26/56 46%, Positives = 35/56 62%, Gaps = 1/56 1%
Query  102  SAAKAPGLIPKLDTAYDVAYKAAE-AHPRGQVRRLRHCPHRSLRVIAGALEVHAVKP 157
            + +KAP L+PKLD  Y+ AY AA+ A P  +   +      +L +IAG  EVHAVKP
Sbjct  80   AVSKAPQLVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALHIIAGTPEVHAVKP 136

Sequence Alignment: 32. Allergen Name: Phl p 6.0101 Sequence ID: P43215

 Score = 33.8 bits 135,  Expect = 0.004
 Identities = 27/56 48%, Positives = 36/56 64%, Gaps = 1/56 1%
Query  102  SAAKAPGLIPKLDTAYDVAYKAAE-AHPRGQVRRLRHCPHRSLRVIAGALEVHAVKP 157
            + +KAP L+PKLD  Y+ AY AA+ A P  +   +      +LR+IAG  EVHAVKP
Sbjct  74   AVSKAPQLVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALRIIAGTPEVHAVKP 130

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.