The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAVQKYTVALFLTVALVAGPAASYAADAGYAPATPAAAGAAAGKITPTQEQKLMEDINVG
FKAAVAAAAGAPPADKFKTFQAAFSASVEASAAKLNAAQAPGFVSHVAATSDATYKAAVG
ATPEAKFDSFVAAFTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVA
ATAANAAPANDKFTVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVK
FAVFKAALTKAITAMAEVQKVSKPVAGAATVAAGAATAATGAATGAAGAATGAATVSAGG
YKV
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9FPR0 Poa p 5.0101 303 1829 423.4 5.1e-120
Q40963 Phl p 5.0201 284 1324 308.4 2.1e-85
AAD20386 Lol p 5 301 1316 306.5 8e-85
CAB05371 Phl p 5.0202 281 1313 305.9 1.2e-84
AAC25996 Phl p 5.0204 265 1284 299.3 1.1e-82
9249029 Phl p 5.0205 265 1265 294.9 2.1e-81
CAB10765 Hol l 5.0101 264 1145 267.6 3.7e-73
AAK62277 Dac g 5.02 265 1134 265.1 2.1e-72
AAK62276 Dac g 5.01 265 1122 262.3 1.4e-71
P22285 Poa p 5 333 1044 244.5 4.2e-66
CAD87529 Phl p 5.0109 284 1023 239.7 9.5e-65
CAA52753 Phl p 5.0101 312 1019 238.8 2e-64
Q40962 Phl p 5.0102 286 1000 234.5 3.6e-63
AAC16526 Phl p 5.0106 276 994 233.1 8.9e-63
AAC16528 Phl p 5.0108 276 989 232.0 2e-62
AAC16527 Phl p 5.0107 276 985 231.1 3.7e-62
P22286 Poa p 5 307 981 230.1 7.9e-62
AAC16525 Phl p 5.0105 276 974 228.6 2.1e-61
P22284 Poa p 5 373 974 228.5 3e-61
CAB10766 Hol l 5.0201 240 962 225.9 1.2e-60
CAB05372 Phl p 5.0104 276 960 225.4 1.9e-60
Q40237 Lol p 5 339 902 212.1 2.4e-56
AAK25823 Phl p 5 275 842 198.5 2.4e-52
CBG76811 Sec c 5.0101 292 839 197.8 4.1e-52
P56164 Pha a 5 320 817 192.7 1.5e-50
P56166 Pha a 5 294 793 187.3 6e-49
P56167 Pha a 5 175 776 183.7 4.3e-48
Q40240 Lol p 5 308 744 176.1 1.5e-45
P56165 Pha a 5 305 700 166.1 1.5e-42
U57845 Hor v 5.0101 313 663 157.7 5.4e-40
P43215 Phl p 6.0101 132 351 87.1 4e-19
CAA76556 Phl p 6.0102 138 345 85.7 1.1e-18
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Poa p 5.0101 Sequence ID: Q9FPR0

 Score = 423.4 bits 1829,  Expect = 5e-120
 Identities = 303/303 100%, Positives = 303/303 100%, Gaps = 0/303 0%
Query  1    MAVQKYTVALFLTVALVAGPAASYAADAGYAPATPAAAGAAAGKITPTQEQKLMEDINVG 60
            MAVQKYTVALFLTVALVAGPAASYAADAGYAPATPAAAGAAAGKITPTQEQKLMEDINVG
Sbjct  1    MAVQKYTVALFLTVALVAGPAASYAADAGYAPATPAAAGAAAGKITPTQEQKLMEDINVG 60
Query  61   FKAAVAAAAGAPPADKFKTFQAAFSASVEASAAKLNAAQAPGFVSHVAATSDATYKAAVG 120
            FKAAVAAAAGAPPADKFKTFQAAFSASVEASAAKLNAAQAPGFVSHVAATSDATYKAAVG
Sbjct  61   FKAAVAAAAGAPPADKFKTFQAAFSASVEASAAKLNAAQAPGFVSHVAATSDATYKAAVG 120
Query  121  ATPEAKFDSFVAAFTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVA 180
            ATPEAKFDSFVAAFTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVA
Sbjct  121  ATPEAKFDSFVAAFTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVA 180
Query  181  ATAANAAPANDKFTVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVK 240
            ATAANAAPANDKFTVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVK
Sbjct  181  ATAANAAPANDKFTVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVK 240
Query  241  FAVFKAALTKAITAMAEVQKVSKPVAGAATVAAGAATAATGAATGAAGAATGAATVSAGG 300
            FAVFKAALTKAITAMAEVQKVSKPVAGAATVAAGAATAATGAATGAAGAATGAATVSAGG
Sbjct  241  FAVFKAALTKAITAMAEVQKVSKPVAGAATVAAGAATAATGAATGAAGAATGAATVSAGG 300
Query  301  YKV 303
            YKV
Sbjct  301  YKV 303

Sequence Alignment: 2. Allergen Name: Phl p 5.0201 Sequence ID: Q40963

 Score = 308.4 bits 1324,  Expect = 2e-85
 Identities = 222/272 81%, Positives = 245/272 90%, Gaps = 13/272 4%
Query  19   GPAASYAADAGYAPATPAAAGAAAGKITPTQEQKLMEDINVGFKAAVAAAAGAPPADKFK 78
            GP  SY ADAGYAPATPAAAGAAAGK T T+EQKL+EDINVGFKAAVAAAA  P ADKFK
Sbjct  13   GPGRSYTADAGYAPATPAAAGAAAGKAT-TEEQKLIEDINVGFKAAVAAAASVPAADKFK 71
Query  79   TFQAAFSASVEASAAKLNAAQAPGFVSHVAATSDATYKAAVGATPEAKFDSFVAAFTEAL 138
            TF+AAF++S +A+AAK     APG+V  + A     YKAAVGATPEAKFDSFVA++TEAL
Sbjct  72   TFEAAFTSSSKAAAAK-----APGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEAL 126
Query  139  RIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAAPANDKFTVFEA 198
            R+IAG L+VHAVKP+TEE G AKIPAGE QIIDKIDAAFKVAATAA  APA+DKFTVFEA
Sbjct  127  RVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEA 186
Query  199  AFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKFAVFKAALTKAITAMAEV 258
            AFN AIKESTGGAYDTYK IPSLEAAVKQAYAAT+AAAP+VK+AVF+AALTKAITAM+EV
Sbjct  187  AFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEV 246
Query  259  QKVSKPVAGAATVAAGAATAATGAATGAAGAATGAATVSAGGYKV 303
            QKVS+P  GAATVAAGAAT        AAGAA+GAATV+AGGYKV
Sbjct  247  QKVSQPATGAATVAAGAATT-------AAGAASGAATVAAGGYKV 284

Sequence Alignment: 3. Allergen Name: Lol p 5 Sequence ID: AAD20386

 Score = 306.5 bits 1316,  Expect = 8e-85
 Identities = 223/294 75%, Positives = 246/294 83%, Gaps = 14/294 4%
Query  1    MAVQKYTVALFLTVALVAGPAASYAADAGYAPA------TPAAAGAAAGKITPTQEQKLM 54
            MAVQKYTVALFL VALVAGPAASYAADAGY PA      TPAA  AAAG    T EQKL+
Sbjct  1    MAVQKYTVALFLAVALVAGPAASYAADAGYTPAAAATPATPAATPAAAGGKATTDEQKLL 60
Query  55   EDINVGFKAAVAAAAGAPPADKFKTFQAAFSASVEASAAKLNAAQAPGFVSHVAATSDAT 114
            ED+N GFKAAVAAAA APPADKFK F+AAFS S +   A  +AA+APG++  +    D  
Sbjct  61   EDVNAGFKAAVAAAANAPPADKFKIFEAAFSESSKGLLAT-SAAKAPGLIPKLDTAYDVA 119
Query  115  YKAAVGATPEAKFDSFVAAFTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKID 174
            YKAA GATPEAK+D+FV A+TEALR+IAG L+VHAVKP TEE  AAKIP GE QI+DKID
Sbjct  120  YKAAEGATPEAKYDAFVTALTEALRVIAGALEVHAVKPATEEVPAAKIPTGELQIVDKID 179
Query  175  AAFKVAATAANAAPANDKFTVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIA 234
            AAFK+AATAANAAP NDKFTVFE+AFN A+ E TGGAY+TYK IPSLEAAVKQAYAAT+A
Sbjct  180  AAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATVA 239
Query  235  AAPEVKFAVFKAALTKAITAMAEVQKVSKPVAGAATVAAGAATAATGAATGAAGAATGAA 294
            AAPEVK+AVF+AALTKAITAM + QK  KP A AAT   GAAT ATGAAT AAGAAT A 
Sbjct  240  AAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAAT---GAATVATGAATAAAGAATAA- 295
Query  295  TVSAGGYK 302
               AGGYK
Sbjct  296  ---AGGYK 300

Sequence Alignment: 4. Allergen Name: Phl p 5.0202 Sequence ID: CAB05371

 Score = 305.9 bits 1313,  Expect = 1e-84
 Identities = 220/272 80%, Positives = 243/272 89%, Gaps = 13/272 4%
Query  19   GPAASYAADAGYAPATPAAAGAAAGKITPTQEQKLMEDINVGFKAAVAAAAGAPPADKFK 78
            GP  SYAADAGYAPATPAAAGA AGK T T+EQKL+EDINVGFKAAVAAAA  P  DKFK
Sbjct  10   GPGRSYAADAGYAPATPAAAGAEAGKAT-TEEQKLIEDINVGFKAAVAAAASVPAGDKFK 68
Query  79   TFQAAFSASVEASAAKLNAAQAPGFVSHVAATSDATYKAAVGATPEAKFDSFVAAFTEAL 138
            TF+AAF++S +A+ AK     APG+V  + A     YKAAVGATPEAKFDSFVA++TEAL
Sbjct  69   TFEAAFTSSSKAATAK-----APGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEAL 123
Query  139  RIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAAPANDKFTVFEA 198
            R+IAG L+VHAVKP+TEE G AKIPAGE QIIDKIDAAFKVAATAA  APA+DKFTVFEA
Sbjct  124  RVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEA 183
Query  199  AFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKFAVFKAALTKAITAMAEV 258
            AFN AIKESTGGAYDTYK IPSLEAAVKQAYAAT+AAAP+VK+AVF+AALTKAITAM+EV
Sbjct  184  AFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEV 243
Query  259  QKVSKPVAGAATVAAGAATAATGAATGAAGAATGAATVSAGGYKV 303
            QKVS+P  GAATVAAGAAT ATGAA+GAA       TV+AGGYKV
Sbjct  244  QKVSQPATGAATVAAGAATTATGAASGAA-------TVAAGGYKV 281

Sequence Alignment: 5. Allergen Name: Phl p 5.0204 Sequence ID: AAC25996

 Score = 299.3 bits 1284,  Expect = 1e-82
 Identities = 216/265 81%, Positives = 239/265 90%, Gaps = 13/265 4%
Query  26   ADAGYAPATPAAAGAAAGKITPTQEQKLMEDINVGFKAAVAAAAGAPPADKFKTFQAAFS 85
            ADAGYAPATPAAAGA AGK T T+EQKL+EDINVGFKAAVAAAA  P ADKFKTF+AAF+
Sbjct  1    ADAGYAPATPAAAGAEAGKAT-TEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFT 59
Query  86   ASVEASAAKLNAAQAPGFVSHVAATSDATYKAAVGATPEAKFDSFVAAFTEALRIIAGVL 145
            +S +A+ AK     APG+V  + A     YKAAVGATPEAKFDSFVA++TEALR+IAG L
Sbjct  60   SSSKAATAK-----APGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGAL 114
Query  146  KVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAAPANDKFTVFEAAFNNAIK 205
            +VHAVKP+TEE G AKIPAGE QIIDKIDAAFKVAATAA  APA+DKFTVFEAAFN AIK
Sbjct  115  EVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIK 174
Query  206  ESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKFAVFKAALTKAITAMAEVQKVSKPV 265
            ESTGGAYDTYK IPSLEAAVKQAYAAT+AAAP+VK+AVF+AALTKAITAM+EVQKVS+P 
Sbjct  175  ESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPA 234
Query  266  AGAATVAAGAATAATGAATGAAGAATGAATVSAGGYKV 303
             GAATVAAGAAT        AAGAA+GAATV+AGGYKV
Sbjct  235  TGAATVAAGAATT-------AAGAASGAATVAAGGYKV 265

Sequence Alignment: 6. Allergen Name: Phl p 5.0205 Sequence ID: 9249029

 Score = 294.9 bits 1265,  Expect = 2e-81
 Identities = 213/265 80%, Positives = 237/265 89%, Gaps = 13/265 4%
Query  26   ADAGYAPATPAAAGAAAGKITPTQEQKLMEDINVGFKAAVAAAAGAPPADKFKTFQAAFS 85
            ADAGYAPATPAAAGA AGK T T+EQKL+EDINVGF AAVAAAA  P ADKFKTF+AAF+
Sbjct  1    ADAGYAPATPAAAGAEAGKAT-TEEQKLIEDINVGFNAAVAAAASVPAADKFKTFEAAFT 59
Query  86   ASVEASAAKLNAAQAPGFVSHVAATSDATYKAAVGATPEAKFDSFVAAFTEALRIIAGVL 145
            +S +A+ AK     APG+V  + A     YKAAVGATPEAKFDS+VA++TEALR+IAG L
Sbjct  60   SSSKAATAK-----APGLVPKLDAAYSVAYKAAVGATPEAKFDSLVASLTEALRVIAGAL 114
Query  146  KVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAAPANDKFTVFEAAFNNAIK 205
            +VHAVKP+TEE G AKIPAGE QIIDKIDAAFKVAATAA  APA+DKFTVFEAAFN AIK
Sbjct  115  EVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIK 174
Query  206  ESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKFAVFKAALTKAITAMAEVQKVSKPV 265
            ESTGGAYDTYK IPSLEAAVKQ YAAT+AAAP+VK+AVF+AALTKAITAM+EVQKVS+P 
Sbjct  175  ESTGGAYDTYKCIPSLEAAVKQPYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPA 234
Query  266  AGAATVAAGAATAATGAATGAAGAATGAATVSAGGYKV 303
             GAATVAAGAAT        AAGAA+GAATV+AGGYKV
Sbjct  235  TGAATVAAGAATT-------AAGAASGAATVAAGGYKV 265

Sequence Alignment: 7. Allergen Name: Hol l 5.0101 Sequence ID: CAB10765

 Score = 267.6 bits 1145,  Expect = 4e-73
 Identities = 193/264 73%, Positives = 221/264 83%, Gaps = 14/264 5%
Query  26   ADAGYAPATPAAAGAAAGKITPTQEQKLMEDINVGFKAAVAAAAGAPPADKFKTFQAAFS 85
            ADAGY PA PAAAGA  GK T T EQKL+ED+N GFK AVAAAA  PPADK+KTF+AAF+
Sbjct  1    ADAGYTPAAPAAAGAG-GKAT-TDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAFT 58
Query  86   ASVEASAAKLNAAQAPGFVSHVAATSDATYKAAVGATPEAKFDSFVAAFTEALRIIAGVL 145
            AS +AS A   A +APG++ ++ A ++  Y AA GATPEAK+D+FV  +TEALR+IAG L
Sbjct  59   ASSKASIAA-AATKAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRVIAGAL 117
Query  146  KVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAAPANDKFTVFEAAFNNAIK 205
            +VHAVKP TEE GAAKIPAGE QI+DKIDAAF++AATAANAAP NDKFTVFE AFN AIK
Sbjct  118  EVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEGAFNKAIK 177
Query  206  ESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKFAVFKAALTKAITAMAEVQKVSKPV 265
            ESTGGAY+ YK IPSLE AVKQAYAAT+A APEVK+ VF+ AL KAITAM+E QK +KPV
Sbjct  178  ESTGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKEAKPV 237
Query  266  AGAATVAAGAATAATGAATGAAGAATGAATVSAGGYKV 303
            A           AATGAAT AAG A GAAT +AGGYKV
Sbjct  238  A-----------AATGAATAAAGVAAGAATAAAGGYKV 264

Sequence Alignment: 8. Allergen Name: Dac g 5.02 Sequence ID: AAK62277

 Score = 265.1 bits 1134,  Expect = 2e-72
 Identities = 192/265 72%, Positives = 221/265 83%, Gaps = 13/265 4%
Query  26   ADAGYAPATPAAAGAAAGKITPTQEQKLMEDINVGFKAAVAAAAGAPPADKFKTFQAAFS 85
            ADAGY PA  A   AA GK   T+EQKL+ED+N GFKAAVAAA+ APPADKFKTF+A F+
Sbjct  1    ADAGYTPAAAATPAAAGGKAM-TEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATFT 59
Query  86   ASVEASAAKLNAAQAPGFVSHVAATSDATYKAAVGATPEAKFDSFVAAFTEALRIIAGVL 145
            A+ +A+ A   A + P FV+ + A     YK A G TPEAK+D+FVAA+TEALR+IAG L
Sbjct  60   AACKANIAA-AATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALRVIAGAL 118
Query  146  KVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAAPANDKFTVFEAAFNNAIK 205
            +VHAVKP  EE  AAKIPAGE QI+DKIDAA+K+AATAANAAPANDKFTVFE AFN AIK
Sbjct  119  EVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIK 178
Query  206  ESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKFAVFKAALTKAITAMAEVQKVSKPV 265
            ESTGGAY++YK IP+LEAAVKQAYAAT+AAAPEVK+AVF+AALTKAITAM+E QKV+ P 
Sbjct  179  ESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPA 238
Query  266  AGAATVAAGAATAATGAATGAAGAATGAATVSAGGYKV 303
            A           AATGAAT AA AATGAAT +AGGYKV
Sbjct  239  A-----------AATGAATAAASAATGAATAAAGGYKV 265

Sequence Alignment: 9. Allergen Name: Dac g 5.01 Sequence ID: AAK62276

 Score = 262.3 bits 1122,  Expect = 1e-71
 Identities = 189/265 71%, Positives = 218/265 82%, Gaps = 13/265 4%
Query  26   ADAGYAPATPAAAGAAAGKITPTQEQKLMEDINVGFKAAVAAAAGAPPADKFKTFQAAFS 85
            ADAGY PA  A    A GK   T+EQ L+ED+N GFKAAVAAA+ APPADKFKTF+A F+
Sbjct  1    ADAGYTPAAAATPATAGGKAM-TEEQTLIEDVNAGFKAAVAAASSAPPADKFKTFEATFT 59
Query  86   ASVEASAAKLNAAQAPGFVSHVAATSDATYKAAVGATPEAKFDSFVAAFTEALRIIAGVL 145
            A+ +A+ A   A + P FV+ + A     YK A G TPEAK+D+FVAA+TEALR+IAG L
Sbjct  60   AACKANIAA-AATKVPLFVAKLDAAYAVAYKTATGPTPEAKYDAFVAALTEALRVIAGAL 118
Query  146  KVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAAPANDKFTVFEAAFNNAIK 205
            +VHAVKP  EE  AAKIPAGE QI+DKIDAA+K+AATAANAAPANDKFTVFE AFN AIK
Sbjct  119  EVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIK 178
Query  206  ESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKFAVFKAALTKAITAMAEVQKVSKPV 265
            ESTGGAY++YK IP+LEAAVKQAYAAT+AAAPEVK+AVF+AALTKAITAM+E QKV+ P 
Sbjct  179  ESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPA 238
Query  266  AGAATVAAGAATAATGAATGAAGAATGAATVSAGGYKV 303
            A            ATGAAT AA AATGAAT +AGGYKV
Sbjct  239  A-----------VATGAATAAASAATGAATAAAGGYKV 265

Sequence Alignment: 10. Allergen Name: Poa p 5 Sequence ID: P22285

 Score = 244.5 bits 1044,  Expect = 4e-66
 Identities = 210/296 70%, Positives = 239/296 80%, Gaps = 30/296 10%
Query  1    MAVQKYTVALFLTVALVAGPAASYAADAGY-APAT---PAAAGAAAGKITP--------- 47
            MAV++YTVALFL VALVAGPAASYAAD GY APAT   PA   A A   TP         
Sbjct  1    MAVHQYTVALFLAVALVAGPAASYAADVGYGAPATLATPATPAAPAAGYTPAAPAGAAPK 60
Query  48   --TQEQKLMEDINVGFKAAVAAAAGAPPADKFKTFQAAF-SASVEASAAKLN-----AAQ 99
              T EQKL+E IN GFKAAVAAAAG P  DK+KTF A F +AS +A A  L+     AA 
Sbjct  61   ATTDEQKLIEKINAGFKAAVAAAAGVPAVDKYKTFVATFGTASNKAFAEALSTEPKGAAA 120
Query  100  APG---FVSHVAATSDATYKAAVGATPEAKFDSFVAAFTEALRIIAGVLKVHAVKPITEE 156
            A     + S + A     YK+A GATPEAK+D++VA ++EALRIIAG L+VHAVKP  EE
Sbjct  121  ASSNAVLTSKLDAAYKLAYKSAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAGEE 180
Query  157  TGAAKIPAGEQQIIDKIDAAFKVAATAANAAPANDKFTVFEAAFNNAIKESTGGAYDTYK 216
              A  IPAGE Q+IDK+DAAFKVAATAANAAPANDKFTVFEAAFN+AIK STGGAY +YK
Sbjct  181  VKA--IPAGELQVIDKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYQSYK 238
Query  217  SIPSLEAAVKQAYAATIAAAPEVKFAVFKAALTKAITAMAEVQKVSKPVAGAATVAAGAA 276
             IP+LEAAVKQ+YAAT+A AP VK+ VF+ AL KAITAM++ QK +KP   AA V A  A
Sbjct  239  FIPALEAAVKQSYAATVATAPAVKYTVFETALKKAITAMSQAQKAAKP---AAAVTA-TA 294
Query  277  TAATGAATGAAGAATGAATVSAGGYK 302
            T A GAATGA GAATGAAT +AGGYK
Sbjct  295  TGAVGAATGAVGAATGAATAAAGGYK 320

Sequence Alignment: 11. Allergen Name: Phl p 5.0109 Sequence ID: CAD87529

 Score = 239.7 bits 1023,  Expect = 9e-65
 Identities = 185/270 68%, Positives = 213/270 78%, Gaps = 24/270 8%
Query  19   GPAASYAADAGYAPATPAAAGAAAGKITPTQEQKLMEDINVGFKAAVAAAAGAPPADKFK 78
            GPA   A  AGY PA PA A   AGK T T+EQKL+E IN GFKAA+AAAAG PPADK++
Sbjct  6    GPATPAAPAAGYTPAAPAGA-EPAGKAT-TEEQKLIEKINAGFKAALAAAAGVPPADKYR 63
Query  79   TFQAAFSASVEASAAKLNAAQAPGFV---SHVAATS--DATYKAAV----GATPEAKFDS 129
            TF A F A+   + A+  + +  G     S  A TS  DA YK A     GATPEAK+D+
Sbjct  64   TFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDA 123
Query  130  FVAAFTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAAPA 189
            +VA ++EALRIIAG L+VHAVKP  EE     IPAGE Q+I+K+DAAFKVAATAANAAPA
Sbjct  124  YVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAANAAPA 181
Query  190  NDKFTVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKFAVFKAALT 249
            NDKFTVFEAAFNNAIK STGGAY++YK IP+LEAAVKQAYAAT+A APEVK+ VF+ AL 
Sbjct  182  NDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALK 241
Query  250  KAITAMAEVQKVSKPVAGAATVAAGAATAATGAATGAAGAATGAATVSAGGYKV 303
            KAITAM+E QK +KP A           AAT  AT A GAATGAAT + GGYKV
Sbjct  242  KAITAMSEAQKAAKPAA-----------AATATATSAVGAATGAATAATGGYKV 284

Sequence Alignment: 12. Allergen Name: Phl p 5.0101 Sequence ID: CAA52753

 Score = 238.8 bits 1019,  Expect = 2e-64
 Identities = 206/289 71%, Positives = 237/289 82%, Gaps = 37/289 12%
Query  1    MAVQKYTVALFLTVALVAGPAASYAADAGYAPATPAA--AG------------AAAGKIT 46
            MAV++YTVALFL VALVAGPAASYAAD GY PATPAA  AG            A AGK T
Sbjct  1    MAVHQYTVALFLAVALVAGPAASYAADLGYGPATPAAPAAGYTPATPAAPAEAAPAGKAT 60
Query  47   PTQEQKLMEDINVGFKAAVAAAAGAPPADKFKTFQAAFSASVEASAAKLNAAQAPGFV-- 104
             T+EQKL+E IN GFKAA+AAAAG  PADK++TF A F A+   + A+  + +  G    
Sbjct  61   -TEEQKLIEKINAGFKAALAAAAGVQPADKYRTFVATFGAASNKAFAEGLSGEPKGAAES 119
Query  105  -SHVAATS--DATYKAAV----GATPEAKFDSFVAAFTEALRIIAGVLKVHAVKPITEET 157
             S  A TS  DA YK A     GATPEAK+D++VA ++EALRIIAG L+VHAVKP  EE 
Sbjct  120  SSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEV 179
Query  158  GAAKIPAGEQQIIDKIDAAFKVAATAANAAPANDKFTVFEAAFNNAIKESTGGAYDTYKS 217
                IPAGE Q+I+K+DAAFKVAATAANAAPANDKFTVFEAAFN+AIK STGGAY++YK 
Sbjct  180  KV--IPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYESYKF 237
Query  218  IPSLEAAVKQAYAATIAAAPEVKFAVFKAALTKAITAMAEVQKVSKPVAGAATVAAGAAT 277
            IP+LEAAVKQAYAAT+A APEVK+ VF+ AL KAITAM+E QK +KP A           
Sbjct  238  IPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAA----------- 286
Query  278  AATGAATGAAGAATGAATVSAGGYKV 303
            AAT  AT A GAATGAAT + GGYKV
Sbjct  287  AATATATAAVGAATGAATAATGGYKV 312

Sequence Alignment: 13. Allergen Name: Phl p 5.0102 Sequence ID: Q40962

 Score = 234.5 bits 1000,  Expect = 4e-63
 Identities = 185/270 68%, Positives = 215/270 79%, Gaps = 26/270 9%
Query  19   GPAASYAADAGYAPATPAA-AGA-AAGKITPTQEQKLMEDINVGFKAAVAAAAGAPPADK 76
            GPA   A  AGY PATPAA AGA AAGK T T+EQKL+E IN GFKAA+A A G  PADK
Sbjct  6    GPATPAAPAAGYTPATPAAPAGADAAGKAT-TEEQKLIEKINAGFKAALAGA-GVQPADK 63
Query  77   FKTFQAAFS-ASVEASAAKLN-----AAQAPG---FVSHVAATSDATYKAAVGATPEAKF 127
            ++TF A F  AS +A A  L+     AA++     + S + A     YK A GATPEAK+
Sbjct  64   YRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKY 123
Query  128  DSFVAAFTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAA 187
            D++VA ++EALRIIAG L+VHAVKP  EE     IPAGE Q+I+K+DAAFKVAATAANAA
Sbjct  124  DAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAANAA 181
Query  188  PANDKFTVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKFAVFKAA 247
            PANDKFTVFEAAFN+ IK STGGAY++YK IP+LEAAVKQAYAAT+A APEVK+ VF+ A
Sbjct  182  PANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETA 241
Query  248  LTKAITAMAEVQKVSKPVAGAATVAAGAATAATGAATGAAGAATGAATVSAGGYKV 303
            L KAITAM+E QK +KP A           AAT  AT A GAATGAAT + GGYKV
Sbjct  242  LKKAITAMSEAQKAAKPAA-----------AATATATAAVGAATGAATAATGGYKV 286

Sequence Alignment: 14. Allergen Name: Phl p 5.0106 Sequence ID: AAC16526

 Score = 233.1 bits 994,  Expect = 9e-63
 Identities = 185/264 70%, Positives = 213/264 80%, Gaps = 26/264 9%
Query  26   ADAGYA-PATPAAAGAAA--GKITPTQEQKLMEDINVGFKAAVAAAAGAPPADKFKTFQA 82
            AD GY  PATPAA   AA  GK T T+EQKL+E IN GFKAA+AAAAG PPADK+KTF A
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKAT-TEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVA 59
Query  83   AFSASVEASAAKLNAAQAPGFV---SHVAATS--DATYKAAV----GATPEAKFDSFVAA 133
             F A+   + A+  +A+  G     S  A TS  DA YK A     GATPEAK+D++VA 
Sbjct  60   TFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVAT 119
Query  134  FTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAAPANDKF 193
            ++EALRIIAG L+VHAVKP  EE     IPAGE Q+I+K+D+AFKVAATAANAAPANDKF
Sbjct  120  LSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSAFKVAATAANAAPANDKF 177
Query  194  TVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKFAVFKAALTKAIT 253
            TVFEAAFNNAIK STGGAY++YK IP+LEAAVKQAYAAT+A APEVK+ VF+ AL KAIT
Sbjct  178  TVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAIT 237
Query  254  AMAEVQKVSKPVAGAATVAAGAATAATGAATGAAGAATGAATVSAGGYKV 303
            AM+E QK +KP           AT AT  AT A GAATGAAT + GGYKV
Sbjct  238  AMSEAQKAAKP-----------ATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 15. Allergen Name: Phl p 5.0108 Sequence ID: AAC16528

 Score = 232.0 bits 989,  Expect = 2e-62
 Identities = 184/264 69%, Positives = 212/264 80%, Gaps = 26/264 9%
Query  26   ADAGYA-PATPAAAGAAA--GKITPTQEQKLMEDINVGFKAAVAAAAGAPPADKFKTFQA 82
            AD GY  PATPAA   AA  GK T T+EQKL+E IN GFKAA+AAAAG PPADK+KTF A
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKAT-TEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVA 59
Query  83   AFSASVEASAAKLNAAQAPGFV---SHVAATS--DATYKAAV----GATPEAKFDSFVAA 133
             F A+   + A+  +A+  G     S  A TS  DA YK A     GATPEAK+D++VA 
Sbjct  60   TFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVAT 119
Query  134  FTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAAPANDKF 193
            ++EALRIIAG L+VHAVKP  EE     IPAGE Q+I+K+D+AFKVAATAANAAPANDKF
Sbjct  120  LSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSAFKVAATAANAAPANDKF 177
Query  194  TVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKFAVFKAALTKAIT 253
            TVFEAAFNNAIK STGGAY++YK IP+LEAAVKQAYAAT+A APEVK+ VF+ AL KA T
Sbjct  178  TVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAFT 237
Query  254  AMAEVQKVSKPVAGAATVAAGAATAATGAATGAAGAATGAATVSAGGYKV 303
            AM+E QK +KP           AT AT  AT A GAATGAAT + GGYKV
Sbjct  238  AMSEAQKAAKP-----------ATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 16. Allergen Name: Phl p 5.0107 Sequence ID: AAC16527

 Score = 231.1 bits 985,  Expect = 4e-62
 Identities = 185/264 70%, Positives = 213/264 80%, Gaps = 26/264 9%
Query  26   ADAGYA-PATPAAAGAAA--GKITPTQEQKLMEDINVGFKAAVAAAAGAPPADKFKTFQA 82
            AD GY  PATPAA   AA  GK T T+EQKL+E IN GFKAA+AAAAG PPADK+KTF A
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKAT-TEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVA 59
Query  83   AFSASVEASAAKLNAAQAPGFV---SHVAATS--DATYKAAV----GATPEAKFDSFVAA 133
             F A+   + A+  +A+  G     S  A TS  DA YK A     GATPEAK+D++VA 
Sbjct  60   TFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVAT 119
Query  134  FTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAAPANDKF 193
            ++EALRIIAG L+VHAVKP  EE     IPAGE Q+I+K+D+AFKVAATAANAAPANDKF
Sbjct  120  LSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSAFKVAATAANAAPANDKF 177
Query  194  TVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKFAVFKAALTKAIT 253
            TVFEAAFNNAIK STGGAY++YK IP+LEAAVKQAYAAT+A APEVK+ VF+ AL KAIT
Sbjct  178  TVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAIT 237
Query  254  AMAEVQKVSKPVAGAATVAAGAATAATGAATGAAGAATGAATVSAGGYKV 303
            AM+E QK +KP A           AAT  AT A GAATGA T +AGGYKV
Sbjct  238  AMSEAQKAAKPAA-----------AATATATSAVGAATGATTAAAGGYKV 276

Sequence Alignment: 17. Allergen Name: Poa p 5 Sequence ID: P22286

 Score = 230.1 bits 981,  Expect = 8e-62
 Identities = 202/288 70%, Positives = 232/288 80%, Gaps = 34/288 11%
Query  1    MAVQKYTVALFLTVALVAGPAASYAADAGY-APATPAA--AG---AAAGKITP---TQEQ 51
            MAVQKYTVALFL VALV GPAASYAAD  Y APATPAA  AG   AA     P   T EQ
Sbjct  1    MAVQKYTVALFL-VALVVGPAASYAADLSYGAPATPAAPAAGYTPAAPAGAAPKATTDEQ 59
Query  52   KLMEDINVGFKAAVAAAAGAPPADKFKTFQAAFSA----------SVEASAAKLNAAQAP 101
            K++E INVGFKAAVAAA G P A+K+KTF A F A          S E   A +++++A 
Sbjct  60   KMIEKINVGFKAAVAAAGGVPAANKYKTFVATFGAASNKAFAEALSTEPKGAAVDSSKA- 118
Query  102  GFVSHVAATSDATYKAAVGATPEAKFDSFVAAFTEALRIIAGVLKVHAVKPITEETGAAK 161
             + S + A     YK+A GATPEAK+D +VA ++EALRIIAG L+VH VKP  EE  A  
Sbjct  119  ALTSKLDAAYKLAYKSAEGATPEAKYDDYVATLSEALRIIAGTLEVHGVKPAAEEVKAT- 177
Query  162  IPAGEQQIIDKIDAAFKVAATAANAAPANDKFTVFEAAFNNAIKESTGGAYDTYKSIPSL 221
             PAGE Q+IDK+DAAFKVAATAANAAPANDKFTVFEAAFN+AIK STGGAY +YK IP+L
Sbjct  178  -PAGELQVIDKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKFIPAL 236
Query  222  EAAVKQAYAATIAAAPEVKFAVFKAALTKAITAMAEVQKVSKPVAGAATVAAGAATAATG 281
            EAAVKQ+YAAT+A AP VK+ VF+ AL KAITAM++ QK +KP A           AATG
Sbjct  237  EAAVKQSYAATVATAPAVKYTVFETALKKAITAMSQAQKAAKPAA-----------AATG 285
Query  282  AATGAAGAATGAATVSAGGYKV 303
             AT A GAATGAAT +AGGYKV
Sbjct  286  TATAAVGAATGAATAAAGGYKV 307

Sequence Alignment: 18. Allergen Name: Phl p 5.0105 Sequence ID: AAC16525

 Score = 228.6 bits 974,  Expect = 2e-61
 Identities = 182/264 68%, Positives = 212/264 80%, Gaps = 26/264 9%
Query  26   ADAGYA-PATPAAAGAAA--GKITPTQEQKLMEDINVGFKAAVAAAAGAPPADKFKTFQA 82
            AD GY  PATPAA   AA  GK T T+EQKL+E IN GFKAA+AAAAG PPADK+KTF A
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKAT-TEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVA 59
Query  83   AFSASVEASAAKLNAAQAPGFV---SHVAATS--DATYKAAV----GATPEAKFDSFVAA 133
             F A+   + A+  +A+  G     S  A TS  DA YK A     GATPEA++D++VA 
Sbjct  60   TFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAEYDAYVAT 119
Query  134  FTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAAPANDKF 193
            ++EALRIIAG L+VHAVKP  EE     IPAGE Q+I+K+D+A+KVAATAANAAPANDKF
Sbjct  120  LSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSALKVAATAANAAPANDKF 177
Query  194  TVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKFAVFKAALTKAIT 253
            TVFEAAFNNAIK STGGAY++YK IP+LEAAVKQAYAAT+A APEVK+ VF+ AL KAIT
Sbjct  178  TVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAIT 237
Query  254  AMAEVQKVSKPVAGAATVAAGAATAATGAATGAAGAATGAATVSAGGYKV 303
            A +E QK +KP           AT AT  AT A GAATGAAT + GGYKV
Sbjct  238  ATSEAQKAAKP-----------ATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 19. Allergen Name: Poa p 5 Sequence ID: P22284

 Score = 228.5 bits 974,  Expect = 3e-61
 Identities = 181/278 65%, Positives = 213/278 76%, Gaps = 27/278 9%
Query  11   FLTVALVAGPAASYAADAG--YAPATPAAAGAAAGKITPTQEQKLMEDINVGFKAAVAAA 68
            F+  A+ A PA+ + A      A  TPAA   AA K T T EQKL+E INVGFKAAVAAA
Sbjct  84   FMAGAVKAPPASKFPAKPAPKVAAYTPAAPAGAAPKAT-TDEQKLIEKINVGFKAAVAAA 142
Query  69   AGAPPADKFKTFQAAFSA----------SVEASAAKLNAAQAPGFVSHVAATSDATYKAA 118
            AG P A K+KTF A F A          S E   A + +++A  + S + A     YK+A
Sbjct  143  AGVPAASKYKTFVATFGAASNKAFAEALSTEPKGAAVASSKAV-LTSKLDAAYKLAYKSA 201
Query  119  VGATPEAKFDSFVAAFTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAFK 178
             GATPEAK+D++VA ++EALRIIAG L+VH VKP  EE  A  IPAGE Q+IDK+DAAFK
Sbjct  202  EGATPEAKYDAYVATLSEALRIIAGTLEVHGVKPAAEEVKA--IPAGELQVIDKVDAAFK 259
Query  179  VAATAANAAPANDKFTVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPE 238
            VAATAANAAPANDKFTVFEAAFN+AIK STGGAY +YK IP+LEAAVKQ+YAAT+A AP 
Sbjct  260  VAATAANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVKQSYAATVATAPA 319
Query  239  VKFAVFKAALTKAITAMAEVQKVSKPVAGAATVAAGAATAATGAATGAAGAATGAATVSA 298
            VK+ VF+ AL KAITAM++ QK +KP A           A TG AT A GAATGAAT +A
Sbjct  320  VKYTVFETALKKAITAMSQAQKAAKPAA-----------AVTGTATSAVGAATGAATAAA 368
Query  299  GGYKV 303
            GGYKV
Sbjct  369  GGYKV 373
 Score = 45.2 bits 170,  Expect = 4e-06
 Identities = 31/83 37%, Positives = 46/83 55%, Gaps = 3/83 3%
Query  54   MEDINVGFKAAVAAAAGAPPADKFKTFQAAFSASVEASAAKLNAAQAPGFVSHVAATSDA 113
            M+  N  +K A+ AA+   PA+KF  FQA F  +++     L+   A GF   + A    
Sbjct  1    MDKANGAYKTALKAASAVAPAEKFPVFQATFDKNLKEG---LSGPDAVGFAKKLDAFIQT 57
Query  114  TYKAAVGATPEAKFDSFVAAFTEALR 139
            +Y +   A P+ KFD FV ++TE LR
Sbjct  58   SYLSTKAAEPKEKFDLFVLSLTEVLR 83

Sequence Alignment: 20. Allergen Name: Hol l 5.0201 Sequence ID: CAB10766

 Score = 225.9 bits 962,  Expect = 1e-60
 Identities = 161/238 67%, Positives = 193/238 81%, Gaps = 17/238 7%
Query  51   QKLMEDINVGFKAAVAAAAGAPPADKFKTFQAAFSASVEASA--AKLNAAQAPGFVSHVA 108
            QKL+ED+N  FKAAVAAAA  PPADK+KTF  AF+     S   +K    + P + S + 
Sbjct  1    QKLLEDVNASFKAAVAAAAKVPPADKYKTFLRAFTVLDRGSTEQSKAEETKMPELSSKLV 60
Query  109  ATSDATYKAAVGATPEAKFDSFVAAFTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQ 168
                A +KA+ G T EAK+D+FV  +TEALR+IAG L+VHAVKP TEE  AAKIPAG+ Q
Sbjct  61   DAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAKIPAGDLQ 120
Query  169  IIDKIDAAFKVAATAANAAPANDKFTVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQA 228
            ++DKIDA+FK+AATAANAAPANDKFTVFE AFN A+KESTGGAY++YK IPSLEAAVKQA
Sbjct  121  VVDKIDASFKIAATAANAAPANDKFTVFETAFNKALKESTGGAYESYKFIPSLEAAVKQA 180
Query  229  YAATIAAAPEVKFAVFKAALTKAITAMAEVQKVSKPVAGAATVAAGAATAATGAATGAAG 288
            YA+T+AAAPEVK+AVF+AALTKAITAM++ QKV++P A               AATGAA 
Sbjct  181  YASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQPAA---------------AATGAAT 225
Query  289  AATGAATVSAGGYKV 303
             A GAAT +AGGYKV
Sbjct  226  VAAGAATTAAGGYKV 240

Sequence Alignment: 21. Allergen Name: Phl p 5.0104 Sequence ID: CAB05372

 Score = 225.4 bits 960,  Expect = 2e-60
 Identities = 177/264 67%, Positives = 209/264 79%, Gaps = 26/264 9%
Query  26   ADAGYA-PATPAAAGAAA--GKITPTQEQKLMEDINVGFKAAVAAAAGAPPADKFKTFQA 82
            AD GY  PATPAA   AA  GK T T+EQKL+E IN GFKAA+AAAAG PPADK+KTF A
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKAT-TEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVA 59
Query  83   AFSASVEASAAKLNAAQAPG---------FVSHVAATSDATYKAAVGATPEAKFDSFVAA 133
             F A+   + A+  +A+  G         + S + A     YK + GATPEAK+D++VA 
Sbjct  60   TFGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVAT 119
Query  134  FTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAAPANDKF 193
            ++EALRIIAG L+VHAVKP  EE     IPAGE Q I+K+D+A+KVAATAANAA ANDKF
Sbjct  120  LSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQFIEKVDSALKVAATAANAAAANDKF 177
Query  194  TVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKFAVFKAALTKAIT 253
            TVFEAAFN+AIK STGGAY++YK IP+LEAAVKQAYAAT+A APEVK+ VF+ AL KAIT
Sbjct  178  TVFEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAIT 237
Query  254  AMAEVQKVSKPVAGAATVAAGAATAATGAATGAAGAATGAATVSAGGYKV 303
            AM+E QK +KP           AT AT  AT A GAATGAAT + GGYKV
Sbjct  238  AMSEAQKAAKP-----------ATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 22. Allergen Name: Lol p 5 Sequence ID: Q40237

 Score = 212.1 bits 902,  Expect = 2e-56
 Identities = 194/303 64%, Positives = 226/303 74%, Gaps = 36/303 11%
Query  1    MAVQKYTVALFLTVALVAGPAASYAADAGYAPATPAAAGAAAGKITP------------- 47
            MAVQK+TVALFL VALVAGPAASYAADAGYAPATPA   A A   TP             
Sbjct  1    MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATPATPATPAAVP 60
Query  48   -----TQEQKLMEDINVGFKAAVAAAAGAPPADKFKTFQAAF-SASVEASAAKLNAAQAP 101
                 T+EQKL+E IN GFKAAVAAAA  PPADK+KTF   F +A+ +A    L +  A 
Sbjct  61   SGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNKAFVEGLASGYAD 120
Query  102  GFVSHVAATSDAT----YKAAVGATPEAKFDSFVAAFTEALRIIAGVLKVHAVKPITEET 157
               +++ +  DA     Y+AA GATPEAK+D++VA +TEALR+IAG L+VHAVKP  EE 
Sbjct  121  QSKNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEV 180
Query  158  GAAKIPAGEQQIIDKIDAAFKVAATAANAAPANDKFTVFEAAFNNAIKESTGGAYDTYKS 217
                IPA E Q+IDK+DAA++ AATAANAAPANDKFTVFE  FNNAIK S G AYD+YK 
Sbjct  181  KVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKF 240
Query  218  IPSLEAAVKQAYAATIAAAPEVKFAVFKAALTKAITAMAEVQKVSKPVAGA--------- 268
            IP+L AAVKQAYAA  A APEVK+ V + AL KA+TAM+E +K + P A A         
Sbjct  241  IPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA 300
Query  269  ---ATVAAGAATAATGAATGAAGAATGAAT-VSAGGYKV 303
               AT AA  ATA   AAT  A  A   AT  +AGGYKV
Sbjct  301  TATATPAAAYATATPAAATATATPAAATATPAAAGGYKV 339

Sequence Alignment: 23. Allergen Name: Phl p 5 Sequence ID: AAK25823

 Score = 198.5 bits 842,  Expect = 2e-52
 Identities = 164/265 61%, Positives = 193/265 72%, Gaps = 34/265 12%
Query  14   VALVAGPAASYAADAGYAPATPAAAGAAAGKITPTQEQKLMEDINVGFKAAVAAAAGAPP 73
            +++ A P       A   P  P   GA+  K+ P+             KA     A  PP
Sbjct  2    ISVTAPPPQLPRPPATPPPPPPPQLGASPYKLGPSP------------KARSERPAIVPP 49
Query  74   ADKFKTFQAAF-SASVEASAAKLNAAQAPGF--VSHVAATS--DATYKAAV----GATPE 124
            ADK++TF A F +AS +A A  L+     G    S  A TS  DA YK A     GATPE
Sbjct  50   ADKYRTFVATFGAASNKAFAEGLSGEPKGGAESSSKAALTSKLDAAYKLAYKTAEGATPE 109
Query  125  AKFDSFVAAFTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAA 184
            AK+D++VA ++EALRIIAG L+VHAVKP  EE     IPAGE Q+I+K+DAAFKVAATAA
Sbjct  110  AKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAA 167
Query  185  NAAPANDKFTVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKFAVF 244
            NAAPANDKFTVFEAAFNNAIK  TGGAY++YK IP+LEAAVKQAYAAT+A APEVK+ VF
Sbjct  168  NAAPANDKFTVFEAAFNNAIKAGTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVF 227
Query  245  KAALTKAITAMAEVQKVSKPVAGAATVAAGAATAATGAATGAAGAATGAATVSAGGYKV 303
            + AL KAITAM+E QK +KP A           AAT  AT A GA TGA T +AGGYKV
Sbjct  228  ETALKKAITAMSEAQKAAKPAA-----------AATATATSAVGAPTGATTAAAGGYKV 275

Sequence Alignment: 24. Allergen Name: Sec c 5.0101 Sequence ID: CBG76811

 Score = 197.8 bits 839,  Expect = 4e-52
 Identities = 177/280 63%, Positives = 219/280 78%, Gaps = 33/280 11%
Query  1    MAVQKYTVALFLTVALVAGPAASYAADAGYAPATPAAAGAAAGKITPTQEQKLMEDINVG 60
            MAVQ+YTVALFL VALVAGPA SY     YAPA P   G      TP  EQKLME+IN G
Sbjct  1    MAVQQYTVALFLAVALVAGPAVSYGT---YAPAAP---GTQPKATTP--EQKLMENINNG 52
Query  61   FKAAVAAAAGAPPADKFKTFQAAF-SASVEASAAKLNAA---QAPGFVSHVAATS---DA 113
            FKAAV AAA   PADK+KTFQ  F   S +A A  L AA   Q P     +A  S   ++
Sbjct  53   FKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAASGQIPAQSDSMARLSTSLES 112
Query  114  TYK----AAVGATPEAKFDSFVAAFTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQI 169
            +YK    +A GATPE K+D++VA++TE+LR+I+G ++VHAVKP +EE     +PA + ++
Sbjct  113  SYKLAYDSAEGATPETKYDTYVASLTESLRVISGAFEVHAVKPASEEVKG--VPAPQLKV 170
Query  170  IDKIDAAFKVAATAANAAPANDKFTVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAY 229
            +D+IDAA++ AATAANAAP NDKF VFE++FN AIKE+TGGAY +Y  +P+LE+AVKQAY
Sbjct  171  VDQIDAAYRTAATAANAAPTNDKFNVFESSFNKAIKENTGGAYASYTFVPALESAVKQAY 230
Query  230  AATIAAAPEVKFAVFKAALTKAITAMAEVQKVSKPVAGAATVAAGAATAATGAATGAAGA 289
            AAT+A+APEVK+AVF+AAL+KAI AM E +K +KP          AA AAT  AT   GA
Sbjct  231  AATVASAPEVKYAVFQAALSKAINAMVEAEKDAKP---------AAAAAATATATATVGA 281
Query  290  ATGAATVSAGGYK 302
            A GAA   AGGYK
Sbjct  282  AAGAA---AGGYK 291

Sequence Alignment: 25. Allergen Name: Pha a 5 Sequence ID: P56164

 Score = 192.7 bits 817,  Expect = 1e-50
 Identities = 166/279 59%, Positives = 196/279 70%, Gaps = 10/279 3%
Query  1    MAVQKYTVALFLTVALVAGPAASYAADAGYAPATPAAAGAAAGKITPTQEQKLMEDINVG 60
            MAVQKYT+ALFL VALVAGPAA         P TP        +   T   + +EDIN  
Sbjct  1    MAVQKYTMALFLAVALVAGPAAPTPP----TPRTPPLLPPPRARDKATLTSRSVEDINAA 56
Query  61   FKAAVAAAAGAPPADKFKTFQAAFSASVEASAAKLNAAQAPGFVSHVAATSDATYKAAVG 120
             +    A+   PPADKFKTF A     V  +     A +AP + + + A     Y+AA G
Sbjct  57   SRRPWWASV--PPADKFKTF-ADHVLCVPNADVTSAATKAPQLKAKLDAAYRVAYEAAEG 113
Query  121  ATPEAKFDSFVAAFTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVA 180
            +TPEAK+D+F+AA+TEALR+IAG ++VHAVKP TEE  A   P GE QI+DKIDAAFK+A
Sbjct  114  STPEAKYDAFIAALTEALRVIAGAFEVHAVKPATEEVVAD--PVGELQIVDKIDAAFKIA 171
Query  181  ATAANAAPANDKFTVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVK 240
            ATAAN+APANDKFTVFE AFN AIKEST GAY+TYK IPSLEAAVKQAY AT+A APEVK
Sbjct  172  ATAANSAPANDKFTVFEGAFNKAIKESTAGAYETYKFIPSLEAAVKQAYGATVARAPEVK 231
Query  241  FAVFKAALTKAITAMAEVQKVSKPVAGAATVAAGAATAATGAATGAAGA 289
            +AVF+A LTKAITAM+E QKV+KP             AA GAAT AA +
Sbjct  232  YAVFEAGLTKAITAMSEAQKVAKPPLSPQPPQV-LPLAAGGAATVAAAS 279

Sequence Alignment: 26. Allergen Name: Pha a 5 Sequence ID: P56166

 Score = 187.3 bits 793,  Expect = 6e-49
 Identities = 187/282 66%, Positives = 212/282 75%, Gaps = 33/282 11%
Query  1    MAVQKYTVALFLTVALVAGPAASYAADAGY--APATPAAAGAAAGKITPTQEQKLMEDIN 58
            MAVQKYTVALFL +ALVAGPAASYAADAG    PATPA  GAAAGK T T+EQKL+EDIN
Sbjct  1    MAVQKYTVALFLAMALVAGPAASYAADAGTPPTPATPAVPGAAAGKAT-THEQKLIEDIN 59
Query  59   VGFKAAVAAAAGAPPADKFKTFQAAFSASVEASAAKLNAAQAPGFVSHVAATSDATYKAA 118
              FK      A APPADK+KTF+ AFS       A +  A   G+     A     Y  A
Sbjct  60   AAFK---WWPASAPPADKYKTFETAFSK------ANIAGASTKGL----DAAYSVVYNTA 106
Query  119  VGATPEAKFDSFVAAFTEALRIIAGVLKVHAVKPITEE-TGAAKIPAGEQQIIDKIDAAF 177
             GATPEAK+DSFV A+TEALRI+AG L+VHAVKP TEE   +AKI     +   +  + F
Sbjct  107  AGATPEAKYDSFVTALTEALRIMAGTLEVHAVKPATEEEVPSAKILRANSRSSTR-SSRF 165
Query  178  KVAAT---------AANAAPANDKFTVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQA 228
            K+AAT         AAN+APANDKFTVFE AFN AIKE  GG  +TYK IPSLEAAVKQA
Sbjct  166  KIAATVATPLSHSTAANSAPANDKFTVFEGAFNKAIKERHGGPTETYKFIPSLEAAVKQA 225
Query  229  YAATIAAAPEVKFAVFKAALTKAITAMAEVQKVSKPVAGAATVAAGAATAATGAATGAAG 288
            Y AT+A APEVK+AVF+A LTKAITAM+E QKV+KPV  +         AA GAAT AA 
Sbjct  226  YGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPVRLSPQPPQVLPLAAGGAATVAA- 284
Query  289  AATGAATVSAGGYKV 303
                 A+ S GGYKV
Sbjct  285  -----ASDSRGGYKV 294

Sequence Alignment: 27. Allergen Name: Pha a 5 Sequence ID: P56167

 Score = 183.7 bits 776,  Expect = 4e-48
 Identities = 131/174 75%, Positives = 148/174 85%, Gaps = 6/174 3%
Query  125  AKFDSFVAAFTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAA 184
            AK+D+F+AA+TEALR+IAG ++VHAVKP TEE  AAKIPAGE QI+DKIDAAFK+AATAA
Sbjct  1    AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKIDAAFKIAATAA 60
Query  185  NAAPANDKFTVFEAAFNNAIKESTGGAYDTYKSIPSLEAA-VKQAYAATIAAAPEVKFAV 243
            N+APANDKFTVFE AFN AIKE  GGAY+TYK IPSLEA+  KQAY AT+A APEVK+AV
Sbjct  61   NSAPANDKFTVFEGAFNKAIKERHGGAYETYKFIPSLEASRSKQAYGATVARAPEVKYAV 120
Query  244  FKAALTKAITAMAEVQKVSKPVAGAATVAAGAATAATGAATGAAGAATGAATVSAGGYKV 303
            F+A LTKAITAM+E QKV+KPV      AAGAATAA GAAT AA   T     SAGGYKV
Sbjct  121  FEAGLTKAITAMSEAQKVAKPVRSVTAAAAGAATAAGGAATVAASRPT-----SAGGYKV 175

Sequence Alignment: 28. Allergen Name: Lol p 5 Sequence ID: Q40240

 Score = 176.1 bits 744,  Expect = 1e-45
 Identities = 144/280 51%, Positives = 173/280 61%, Gaps = 11/280 3%
Query  1    MAVQKYTVALFLTVALVAGPAASYAADAGYAPATPAAAGAAAGKITPTQEQKLMEDINV- 59
            MAVQKYTVALFL      GP  SYAADAGY PA  AAA  A    TP    +  +D    
Sbjct  1    MAVQKYTVALFLRRGPRGGPGRSYAADAGYTPA--AAATPATPAATPAGGWREGDDRRAE 58
Query  60   --GFKAAVAAAAGAPPADKFKTFQAAFSA-----SVEASAAKLNAAQAPGFVSHVAATSD 112
              G +  +A+    PP        ++ S+     S   +++  +AA+APG++  +    D
Sbjct  59   AAGGRQRLASRQPWPPLPTPLRRTSSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYD 118
Query  113  ATYKAAVGATPEAKFDSFVAAFTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDK 172
              YKAA  A P  +   +      +LR+IAG L+VHAVKP TEE  AAKIP GE QI+DK
Sbjct  119  VAYKAAE-AHPRGQVRRLRHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDK 177
Query  173  IDAAFKVAATAANAAPANDKFTVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAAT 232
            IDAAFK+AATAANAAP NDKFTVFE+AFN A+ E TGGA     S P       +     
Sbjct  178  IDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPP 237
Query  233  IAAAPEVKFAVFKAALTKAITAMAEVQKVSKPVAGAATVAAGAATAATGAA 283
              AAPEVK+AVF+AALTKAITAM + QK  KP A AAT AA  ATAA  AA
Sbjct  238  SPAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAA 288

Sequence Alignment: 29. Allergen Name: Pha a 5 Sequence ID: P56165

 Score = 166.1 bits 700,  Expect = 2e-42
 Identities = 147/293 50%, Positives = 188/293 64%, Gaps = 22/293 7%
Query  1    MAVQKYTVALFLTVALVAGPAASYAADAGYAPATPAAAGAAAGKITP--TQEQKLMEDIN 58
            MAVQKYTVALFL VALVAGPAA YA D GYAPATPAA+   A   TP  + ++    + +
Sbjct  1    MAVQKYTVALFLAVALVAGPAALYAGD-GYAPATPAASATLATPATPAASPQHAGTTEYH 59
Query  59   VGFKAAVAAAAGAP--PADKFKTFQAA----FSASVEASAAKLNAAQAPGFVSHVAATSD 112
            +  KA +     A     D+ K         F+ SV   A +L    +    +H ++  D
Sbjct  60   IVRKAGLNEEKNAARQTDDEQKRSDEINCPDFNKSVHCRADRLPVCSSTS--AH-SSKQD 116
Query  113  ATYKAAVGATPEAKFD-SFVAAFTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQIID 171
              +    G+      D + V + +  + +I   ++V  +  I EE     IPAGE ++I+
Sbjct  117  VAWMLGYGSIQGFSMDDASVGSVSSEFHVIESAIEV--ITYIGEEVKV--IPAGEVEVIN 172
Query  172  KIDAAFKVAATAANAAPANDKFTVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAA 231
            K+ AAF  AATAA+ APANDKFTVF ++FN AIKE+TGGAY  YK IP+LEAAVKQAYAA
Sbjct  173  KVKAAFSTAATAADEAPANDKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAA 232
Query  232  TIAAAPEVKFAVFKAALTKAITAMAEVQKVSKPVAG--AATVAAGAATAATGAATGAA-G 288
            + A APEVK+AVF+ AL KAI+AM+E QK +KP A   AAT    A+TA   A      G
Sbjct  233  SSATAPEVKYAVFETALKKAISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPPQLG 292
Query  289  AATGAATVSAGGYKV 303
             AT AA   AGGYKV
Sbjct  293  TATPAAV--AGGYKV 305

Sequence Alignment: 30. Allergen Name: Hor v 5.0101 Sequence ID: U57845

 Score = 157.7 bits 663,  Expect = 5e-40
 Identities = 112/199 56%, Positives = 153/199 76%, Gaps = 10/199 5%
Query  78   KTFQAAFSASVEASAAKLNAAQAPGFVSHVAATSDATYKAAV----GATPEAKFDSFVAA 133
            + F+ AF+  ++ +A    A Q+   ++ ++++ + +YK A     GATPEAK+D++VA 
Sbjct  103  REFRKAFAEVLKGAATGQIAGQSSS-MAKLSSSLELSYKLAYDKAQGATPEAKYDAYVAT 161
Query  134  FTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAAPANDKF 193
            +TE+LR+I+G L+VH+VKP  EE     +PAGE + ID++DAAF+ AATAA+AAPANDKF
Sbjct  162  LTESLRVISGTLEVHSVKPAAEEVKG--VPAGELKAIDQVDAAFRTAATAADAAPANDKF 219
Query  194  TVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKFAVFKAALTKAIT 253
            TVFE+      ++  GGAY++YK IP+LEAAVKQAYAAT+AAAPEVKF VF+ AL+KAI 
Sbjct  220  TVFESLQQGPSRKPRGGAYESYKFIPALEAAVKQAYAATVAAAPEVKFTVFQTALSKAIN 279
Query  254  AMAEVQKVSKPVAGA---ATVAAGAATAA 279
            AM +  KV+KP A A   ATVAAGAA  A
Sbjct  280  AMTQAGKVAKPAAAATATATVAAGAAATA 308

Sequence Alignment: 31. Allergen Name: Phl p 6.0101 Sequence ID: P43215

 Score = 87.1 bits 351,  Expect = 4e-19
 Identities = 70/129 54%, Positives = 92/129 71%, Gaps = 16/129 12%
Query  8    VALFLTVALVAGPAASYAADAGYAPATPAAAGAAAGKITPTQEQKLMEDINVGFKAAVAA 67
            VA+FL VA+V G A S           P A G   GK T T+EQKL+ED+N  F+AA+A 
Sbjct  2    VAMFLAVAVVLGLATS-----------PTAEG---GKAT-TEEQKLIEDVNASFRAAMAT 46
Query  68   AAGAPPADKFKTFQAAFSASVEASAAKLNAAQAPGFVSHVAATSDATYKAAVGATPEAKF 127
             A  PPADK+KTF+AAF+ S + + A    ++AP +V  +    +A Y AA  A PE K+
Sbjct  47   TANVPPADKYKTFEAAFTVSSKRNLAD-AVSKAPQLVPKLDEVYNAAYNAADHAAPEDKY 105
Query  128  DSFVAAFTEALRIIAGVLKVHAVKP 152
            ++FV  F+EALRIIAG  +VHAVKP
Sbjct  106  EAFVLHFSEALRIIAGTPEVHAVKP 130

Sequence Alignment: 32. Allergen Name: Phl p 6.0102 Sequence ID: CAA76556

 Score = 85.7 bits 345,  Expect = 1e-18
 Identities = 73/136 53%, Positives = 96/136 70%, Gaps = 16/136 11%
Query  1    MAVQKYTVALFLTVALVAGPAASYAADAGYAPATPAAAGAAAGKITPTQEQKLMEDINVG 60
            MA +K+ VA+FL VA+V G A S           P A G   GK T T+EQKL+EDIN  
Sbjct  1    MAAHKFMVAMFLAVAVVLGLATS-----------PTAEG---GKAT-TEEQKLIEDINAS 45
Query  61   FKAAVAAAAGAPPADKFKTFQAAFSASVEASAAKLNAAQAPGFVSHVAATSDATYKAAVG 120
            F+AA+A  A  PPADK+KTF+AAF+ S + + A    ++AP +V  +    +A Y AA  
Sbjct  46   FRAAMATTANVPPADKYKTFEAAFTVSSKRNLAD-AVSKAPQLVPKLDEVYNAAYNAADH 104
Query  121  ATPEAKFDSFVAAFTEALRIIAGVLKVHAVKP 152
            A PE K+++FV  F+EAL IIAG  +VHAVKP
Sbjct  105  AAPEDKYEAFVLHFSEALHIIAGTPEVHAVKP 136

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.