The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRN
LWNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGK
VGLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESC
SACYLFGPLKVVQ
Sequence Info Allergen Name Length Opt Bits Score E Value
FJ184279 Lit v 4.0101 193 1309 305.3 7.6e-85
ADV17343 Pen m 4.0101 193 1309 305.3 7.6e-85
P05946 Pon l 4.0101 192 1087 254.7 1.3e-69
I2DDG2 Scy p 4.0101 193 1063 249.2 5.7e-68
Q16XK7 Aed a 5.0101 191 731 173.6 3.4e-45
CAQ72972 Clu h 1.0301 109 116 33.8 0.0022
CAC83659 Cyp c 1.02 109 107 31.8 0.0092
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Lit v 4.0101 Sequence ID: FJ184279

 Score = 305.3 bits 1309,  Expect = 8e-85
 Identities = 193/193 100%, Positives = 193/193 100%, Gaps = 0/193 0%
Query  1    MAYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRN 60
            MAYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRN
Sbjct  1    MAYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRN 60
Query  61   LWNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGK 120
            LWNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGK
Sbjct  61   LWNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGK 120
Query  121  VGLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESC 180
            VGLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESC
Sbjct  121  VGLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESC 180
Query  181  SACYLFGPLKVVQ 193
            SACYLFGPLKVVQ
Sbjct  181  SACYLFGPLKVVQ 193

Sequence Alignment: 2. Allergen Name: Pen m 4.0101 Sequence ID: ADV17343

 Score = 305.3 bits 1309,  Expect = 8e-85
 Identities = 193/193 100%, Positives = 193/193 100%, Gaps = 0/193 0%
Query  1    MAYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRN 60
            MAYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRN
Sbjct  1    MAYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRN 60
Query  61   LWNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGK 120
            LWNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGK
Sbjct  61   LWNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGK 120
Query  121  VGLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESC 180
            VGLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESC
Sbjct  121  VGLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESC 180
Query  181  SACYLFGPLKVVQ 193
            SACYLFGPLKVVQ
Sbjct  181  SACYLFGPLKVVQ 193

Sequence Alignment: 3. Allergen Name: Pon l 4.0101 Sequence ID: P05946

 Score = 254.7 bits 1087,  Expect = 1e-69
 Identities = 158/192 82%, Positives = 173/192 90%, Gaps = 0/192 0%
Query  2    AYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRNL 61
            AYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLA+RNTLIEGRGEF+  AYANNQKIM NL
Sbjct  1    AYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLALRNTLIEGRGEFNEAAYANNQKIMSNL 60
Query  62   WNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGKV 121
            WNEIAELADFNKDGEVT+DEFK+AVQ  C GK +  FP AFKVFIANQFK +DVNGDG V
Sbjct  61   WNEIAELADFNKDGEVTIDEFKKAVQNVCVGKAFATFPAAFKVFIANQFKTVDVNGDGLV 120
Query  122  GLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESCS 181
            G+DEYRLDCI+RSAFA +KEIDDAYNKL T+ D+KAGG++L RYQ+LYAQFISNPDES +
Sbjct  121  GVDEYRLDCISRSAFANIKEIDDAYNKLATDADKKAGGISLARYQELYAQFISNPDESAN 180
Query  182  ACYLFGPLKVVQ 193
            A YLFGPLK VQ
Sbjct  181  AVYLFGPLKEVQ 192

Sequence Alignment: 4. Allergen Name: Scy p 4.0101 Sequence ID: I2DDG2

 Score = 249.2 bits 1063,  Expect = 6e-68
 Identities = 153/193 79%, Positives = 169/193 87%, Gaps = 0/193 0%
Query  1    MAYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRN 60
            MAYSWDNRVKYVVRYMYDIDNNG+LDKNDFECLA+RNTLIEGRGEF++DAYANNQKIM N
Sbjct  1    MAYSWDNRVKYVVRYMYDIDNNGYLDKNDFECLALRNTLIEGRGEFNSDAYANNQKIMSN 60
Query  61   LWNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGK 120
            LWNEIAELADFNKDG+VTVDEFKQAVQ  C GK +  FP  FK  I   FK ID+NGDG 
Sbjct  61   LWNEIAELADFNKDGQVTVDEFKQAVQNLCCGKSFDGFPPCFKTVIGRLFKTIDINGDGL 120
Query  121  VGLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESC 180
             G+DEYRLDCI+RSAF+ VKEIDDAY KL T+DD+KAGG++L RYQ+LYAQFISNPDE C
Sbjct  121  AGVDEYRLDCISRSAFSSVKEIDDAYAKLCTDDDKKAGGISLNRYQELYAQFISNPDEKC 180
Query  181  SACYLFGPLKVVQ 193
            +A YLFGPLK VQ
Sbjct  181  NAVYLFGPLKEVQ 193

Sequence Alignment: 5. Allergen Name: Aed a 5.0101 Sequence ID: Q16XK7

 Score = 173.6 bits 731,  Expect = 3e-45
 Identities = 93/189 49%, Positives = 142/189 75%, Gaps = 0/189 0%
Query  1    MAYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRN 60
            M+Y W+ RV+++V +MYDIDNNGFLD NDF C+A+R T++EG+G  +       + IM+ 
Sbjct  1    MSYPWEKRVEFIVGHMYDIDNNGFLDNNDFMCMALRATVVEGKGTINPARLNEYRTIMKA 60
Query  61   LWNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGK 120
            LW+EI+ LAD++ DG++T +EFK AV+  C GK Y DFP A K FI  +++ +D+N DG 
Sbjct  61   LWDEISALADLDHDGKITTEEFKDAVKATCVGKSYSDFPKAMKAFIDAHYQMMDINNDGL 120
Query  121  VGLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESC 180
            V ++EYR +CI+R A  ++K++DD+YN+L +++D K GG+TL+RYQ+LYAQF+ N  + C
Sbjct  121  VSIEEYRYNCISRIAMDDIKKVDDSYNQLVSDEDNKRGGITLQRYQELYAQFMGNESDKC 180
Query  181  SACYLFGPL 189
            +A +L+GP+
Sbjct  181  AAIFLYGPI 189

Sequence Alignment: 6. Allergen Name: Clu h 1.0301 Sequence ID: CAQ72972

 Score = 33.8 bits 116,  Expect = 0.002
 Identities = 21/55 38%, Positives = 34/55 61%, Gaps = 5/55 9%
Query  67   ELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGKVGLDEY 126
            E+ D +K G +  +E+K  +Q  C+G +     G  K F+    KA D + DGK+G+DE+
Sbjct  49   EIIDQDKSGFIEEEELKLFLQNFCKGAR-ALTDGETKKFL----KAGDSDNDGKIGIDEF 103

Sequence Alignment: 7. Allergen Name: Cyp c 1.02 Sequence ID: CAC83659

 Score = 31.8 bits 107,  Expect = 0.009
 Identities = 21/54 38%, Positives = 32/54 59%, Gaps = 5/54 9%
Query  68   LADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGKVGLDEY 126
            + D +K G +  DE+K  +Q    G +     G  K F+    KA D +GDGK+G+DE+
Sbjct  50   IIDQDKSGFIEEDELKLFLQNFKAGAR-ALTDGETKTFL----KAGDSDGDGKIGVDEF 103

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.