The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT
QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA
DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE
ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE
FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVELILKE
Sequence Info Allergen Name Length Opt Bits Score E Value
NP_001103782 Bomb m 3.0101 285 1718 398.2 1.8e-112
Q17H75 Aed a 10.0101 285 1634 379.0 1e-106
CAA09938 Chi k 10 285 1591 369.2 9.3e-104
AAD19606 Per a 7.0102 284 1555 361.0 2.7e-101
AAF72534 Bla g 7.0101 284 1546 359.0 1.1e-100
Q9UB83 Per a 7 284 1534 356.2 7.6e-100
A7L5V2 Scy p 1.0101 284 1455 338.2 2e-94
M1H607 Por p 1.0101 284 1447 336.4 7.1e-94
O44119 Hom a 1.0101 284 1444 335.7 1.1e-93
AAC48288 Hom a 1.0102 284 1444 335.7 1.1e-93
C0LU07 Pro c 1.0101 284 1436 333.9 4e-93
EU410072 Lit v 1.0101 284 1432 333.0 7.5e-93
11893851 Pen a 1 284 1432 333.0 7.5e-93
AAX37288 Pen m 1 284 1432 333.0 7.5e-93
D3XNR9 Mac r 1.0101 284 1430 332.5 1e-92
CBY17558 Pan b 1.0101 284 1428 332.1 1.4e-92
M4M2H6 Mel l 1.0101 284 1419 330.0 5.9e-92
AEX31649 Cho a 10.0101 284 1408 327.5 3.3e-91
BAA04557 Der f 10.0101 299 1408 327.5 3.6e-91
AGM32377.1 Copt f 7.0101 256 1404 326.7 5.5e-91
ABU97466 Blo t 10.0101 284 1392 323.9 4.2e-90
Q9NFZ4 Lep d 10 284 1387 322.7 9.2e-90
O61379 Pan s 1 274 1386 322.5 1e-89
O18416 Der p 10 284 1386 322.5 1.1e-89
AAT40866 Tyr p 10.0101 284 1385 322.3 1.3e-89
Q9N2R3 Cha f 1 264 1378 320.7 3.5e-89
Q25456 Met e 1 274 1374 319.8 6.9e-89
Q9NAS5 Ani s 3 284 1239 289.0 1.3e-79
ACN32322 Asc l 3.0101 287 1235 288.1 2.5e-79
CAC84590 Lep s 1 284 1152 269.2 1.2e-73
Q17H80 Aed a 10.0201 284 1123 262.6 1.2e-71
CAB38044 Hel as 1 284 1123 262.6 1.2e-71
APG42675 Hal l 1.0101 284 1094 256.0 1.2e-69
AAG08987 Hal d 1 284 1084 253.7 5.7e-69
AVD53650 Sac g 1.0101 284 1064 249.1 1.3e-67
NP_001117128 Sal s 4.0101 284 997 233.8 5.3e-63
XP_026775428 Pan h 4.0201 284 994 233.2 8.6e-63
AAG08989 Mim n 1 284 993 232.9 1e-62
AAG08988 Per v 1 284 976 229.1 1.5e-61
AAK96889 Cra g 1 233 915 215.2 1.7e-57
XP_026781482 Pan h 4.0101 284 895 210.6 5.3e-56
AAK39511 Der f 11.0101 692 229 58.6 7.4e-10
AAO73464 Der p 11 875 226 57.9 1.5e-09
AAM83103 Blo t 11 875 214 55.2 1e-08
QPB41107 Rap v 2.0101 859 210 54.2 1.9e-08
AAF72796 Ani s 2 869 184 48.3 1.2e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bomb m 3.0101 Sequence ID: NP_001103782

 Score = 398.2 bits 1718,  Expect = 2e-112
 Identities = 285/285 100%, Positives = 285/285 100%, Gaps = 0/285 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT
Sbjct  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
            QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA
Sbjct  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVELILKE 285
            FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVELILKE
Sbjct  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVELILKE 285

Sequence Alignment: 2. Allergen Name: Aed a 10.0101 Sequence ID: Q17H75

 Score = 379.0 bits 1634,  Expect = 1e-106
 Identities = 268/285 94%, Positives = 278/285 97%, Gaps = 0/285 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKMQAMKLEKDNALDRA +CEQQA+DANLRAEKAEEEARQLQKKIQ IEN+LDQT
Sbjct  1    MDAIKKKMQAMKLEKDNALDRALLCEQQARDANLRAEKAEEEARQLQKKIQAIENDLDQT 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
            QE+LM VN KLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLA+ATAKLSEAS AA
Sbjct  61   QEALMAVNAKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLASATAKLSEASAAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESERARKVLENR+LADEERMDALENQLKEARF+AEEADKKYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKVLENRALADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAE+GE KIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE
Sbjct  181  ERAEAGEGKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVELILKE 285
            FAERSVQKLQKEVDRLEDELV EKEKY++IGDDLDTAFVELILKE
Sbjct  241  FAERSVQKLQKEVDRLEDELVMEKEKYREIGDDLDTAFVELILKE 285

Sequence Alignment: 3. Allergen Name: Chi k 10 Sequence ID: CAA09938

 Score = 369.2 bits 1591,  Expect = 9e-104
 Identities = 263/285 92%, Positives = 274/285 96%, Gaps = 0/285 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKMQAMKLEKDNALDRA +CE QA+DANLRAEKAEEEAR LQKKIQTIEN+LDQT
Sbjct  1    MDAIKKKMQAMKLEKDNALDRALLCENQARDANLRAEKAEEEARTLQKKIQTIENDLDQT 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
            Q     VNGKLE KEKALQNAESEVAALNRRIQLL EDL+RSEERLA+ATAKLSEAS AA
Sbjct  61   QGQETLVNGKLEGKEKALQNAESEVAALNRRIQLLGEDLDRSEERLASATAKLSEASAAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESERARK+LENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAE+GE+KIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE
Sbjct  181  ERAEAGEAKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVELILKE 285
            FAERSVQKLQKEVDRLEDELV+EKEKY++IGDDLDTAFVELILKE
Sbjct  241  FAERSVQKLQKEVDRLEDELVSEKEKYREIGDDLDTAFVELILKE 285

Sequence Alignment: 4. Allergen Name: Per a 7.0102 Sequence ID: AAD19606

 Score = 361.0 bits 1555,  Expect = 3e-101
 Identities = 256/282 90%, Positives = 267/282 94%, Gaps = 0/282 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKMQAMKLEKDNA+DRA +CEQQA+DANLRAEKAEEEAR LQKKIQ IEN+LDQT
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
             E LMQVN KL+EK+KALQNAESEVAALNRRIQLLEEDLERSEERLATATAKL+EASQAA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESERARK+LE++ LADEERMDALENQLKEARF+AEEADKKYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAESGESKIVELEEELRVVGNNLKSLEVSEEKAN REEEYK QIKTLTTRLKEAEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVELI 282
            FAERSVQKLQKEVDRLEDELV EKEKYK I DDLD  F ELI
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTELI 282

Sequence Alignment: 5. Allergen Name: Bla g 7.0101 Sequence ID: AAF72534

 Score = 359.0 bits 1546,  Expect = 1e-100
 Identities = 253/282 89%, Positives = 266/282 94%, Gaps = 0/282 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKMQAMKLEKDNA+DRA +CEQQA+DAN+RAEKAEEEAR LQKKIQ IEN+LDQT
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
             E LMQVN KL+EK+KALQNAESEVAALNRRIQLLEEDLERSEERLATATAKL+EASQAA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESERARK+LE++ LADEERMDALENQLKEARF+AEEADKKYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKAN REEEYK QIKTL TRLKEAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVELI 282
            FAERSVQKLQKEVDRLEDELV EKEKYK I DDLD  F ELI
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKYICDDLDMTFTELI 282

Sequence Alignment: 6. Allergen Name: Per a 7 Sequence ID: Q9UB83

 Score = 356.2 bits 1534,  Expect = 8e-100
 Identities = 253/281 90%, Positives = 264/281 93%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKMQAMKLEKDNA+D A +CEQQA+DANLRAEKAEEEAR LQKKIQ IEN+LDQT
Sbjct  1    MDAIKKKMQAMKLEKDNAMDCALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
             E LMQVN KL+EK+KALQNAESEVAALNRRIQLLEEDLERSEERLATATAKL+EASQA 
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAV 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESERARK+LE++ LADEERMDALENQLKEARF+AEEADKKYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAESGESKIVELEEELRVVGNNLKSLEVSEEKAN REEEYK QIKTLTTRLKEAEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            FAERSVQKLQKEVDRLEDELV EKEKYK I DDLD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTEL 281

Sequence Alignment: 7. Allergen Name: Scy p 1.0101 Sequence ID: A7L5V2

 Score = 338.2 bits 1455,  Expect = 2e-94
 Identities = 241/281 85%, Positives = 251/281 89%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKMQAMKLEKDNA+DRA   EQQ K+ANLRAEK EEE R  QKK+Q +ENELDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
            QE L   N KL+EKEKALQNAE EVAALNRRIQLLEEDLERSEERL TAT KL+EASQAA
Sbjct  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER RKVLENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTL  +LK AEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            FAERSVQKLQKEVDRLEDELV EKEKYK I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL 281

Sequence Alignment: 8. Allergen Name: Por p 1.0101 Sequence ID: M1H607

 Score = 336.4 bits 1447,  Expect = 7e-94
 Identities = 237/281 84%, Positives = 255/281 90%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKMQAMKLEKD+A+DRA   EQQ K+AN+RAEKAEEE   LQK++Q +EN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDDAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQV 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
            QESL++ N +LEEK+KAL NAE EVAALNRRIQLLEEDLERSEERL TAT KL+EASQAA
Sbjct  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER RKVLENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTLT +LK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            FAERSVQKLQKEVDRLEDELV EKEKYK   D+LD AF EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSTTDELDQAFSEL 281

Sequence Alignment: 9. Allergen Name: Hom a 1.0101 Sequence ID: O44119

 Score = 335.7 bits 1444,  Expect = 1e-93
 Identities = 239/281 85%, Positives = 251/281 89%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKMQAMKLEKDNA+DRA   EQQ K+AN+RAEK EEE R  +KK+Q +ENELDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKTEEEIRITHKKMQQVENELDQV 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
            QE L   N KLEEKEKALQNAE EVAALNRRIQLLEEDLERSEERL TAT KL+EASQAA
Sbjct  61   QEQLSLANTKLEEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER RKVLENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTL  +LK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            FAERSVQKLQKEVDRLEDELV EKEKYK I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL 281

Sequence Alignment: 10. Allergen Name: Hom a 1.0102 Sequence ID: AAC48288

 Score = 335.7 bits 1444,  Expect = 1e-93
 Identities = 236/281 83%, Positives = 254/281 90%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKMQAMKLEKDNA+DRA   EQQ K+AN+RAEK+EEE   LQK++Q +EN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
            QESL++ N +LEEK+KAL NAE EVAALNRRIQLLEEDLERSEERL TAT KL+EASQAA
Sbjct  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER RKVLENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTL  +LK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            FAERSVQKLQKEVDRLEDELV EKEKYK I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL 281

Sequence Alignment: 11. Allergen Name: Pro c 1.0101 Sequence ID: C0LU07

 Score = 333.9 bits 1436,  Expect = 4e-93
 Identities = 235/281 83%, Positives = 253/281 90%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKMQA KLEKDNA+DRA   EQQ K+AN+RAEKAEEE   LQK++Q +EN+LDQ 
Sbjct  1    MDAIKKKMQATKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQHLENDLDQV 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
            QESL++ N +LEEK+KA+ NAE EVAALNRRIQLLEEDLERSEERL TAT KL+EASQAA
Sbjct  61   QESLLKANTQLEEKDKAISNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER RKVLENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTL  +LK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            FAERSVQKLQKEVDRLEDELV EKEKYK I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL 281

Sequence Alignment: 12. Allergen Name: Lit v 1.0101 Sequence ID: EU410072

 Score = 333.0 bits 1432,  Expect = 8e-93
 Identities = 236/281 83%, Positives = 253/281 90%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKMQAMKLEKDNA+DRA   EQQ K+AN RAEK+EEE   LQK++Q +EN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
            QESL++ N +L EK+KAL NAE EVAALNRRIQLLEEDLERSEERL TAT KL+EASQAA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER RKVLENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTLT +LK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            FAERSVQKLQKEVDRLEDELV EKEKYK I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL 281

Sequence Alignment: 13. Allergen Name: Pen a 1 Sequence ID: 11893851

 Score = 333.0 bits 1432,  Expect = 8e-93
 Identities = 236/281 83%, Positives = 253/281 90%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKMQAMKLEKDNA+DRA   EQQ K+AN RAEK+EEE   LQK++Q +EN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
            QESL++ N +L EK+KAL NAE EVAALNRRIQLLEEDLERSEERL TAT KL+EASQAA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER RKVLENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTLT +LK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            FAERSVQKLQKEVDRLEDELV EKEKYK I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL 281

Sequence Alignment: 14. Allergen Name: Pen m 1 Sequence ID: AAX37288

 Score = 333.0 bits 1432,  Expect = 8e-93
 Identities = 236/281 83%, Positives = 253/281 90%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKMQAMKLEKDNA+DRA   EQQ K+AN RAEK+EEE   LQK++Q +EN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
            QESL++ N +L EK+KAL NAE EVAALNRRIQLLEEDLERSEERL TAT KL+EASQAA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER RKVLENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTLT +LK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            FAERSVQKLQKEVDRLEDELV EKEKYK I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL 281

Sequence Alignment: 15. Allergen Name: Mac r 1.0101 Sequence ID: D3XNR9

 Score = 332.5 bits 1430,  Expect = 1e-92
 Identities = 235/281 83%, Positives = 252/281 89%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKMQAMKLEKDNA+DRA   EQQ K+AN RAEK+EEE   LQK++Q +EN+LD  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDSV 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
            QE+L++ N  LEEK+KAL NAE EVAALNRRIQLLEEDLERSEERL TAT KL+EASQAA
Sbjct  61   QEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER RKVLENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTLT +LK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            FAERSVQKLQKEVDRLEDELV EKEKYK I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL 281

Sequence Alignment: 16. Allergen Name: Pan b 1.0101 Sequence ID: CBY17558

 Score = 332.1 bits 1428,  Expect = 1e-92
 Identities = 236/281 83%, Positives = 252/281 89%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKMQAMKLEKDNA+DRA   EQQ K+AN RAEK+EEE   LQKK+Q +EN+LD  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVFGLQKKLQQLENDLDSV 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
            QE+L++ N  LEEK+KAL NAE EVAALNRRIQLLEEDLERSEERL TAT KL+EASQAA
Sbjct  61   QEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER RKVLENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTLT +LK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            FAERSVQKLQKEVDRLEDELV EKEKYK I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL 281

Sequence Alignment: 17. Allergen Name: Mel l 1.0101 Sequence ID: M4M2H6

 Score = 330.0 bits 1419,  Expect = 6e-92
 Identities = 233/281 82%, Positives = 252/281 89%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKMQAMKLEKDNA+DRA   EQQ K+AN+RAEKAE++  +LQKK+Q +EN++DQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
            QE+L+  N    EK+KAL NAE EVAALNRRIQLLEEDLERSEERL TAT KL+EASQAA
Sbjct  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER RKVLENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTLT +LK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            FAERSVQKLQKEVDRLEDELV EKEKYK I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL 281

Sequence Alignment: 18. Allergen Name: Cho a 10.0101 Sequence ID: AEX31649

 Score = 327.5 bits 1408,  Expect = 3e-91
 Identities = 228/281 81%, Positives = 252/281 89%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            M+AIKKKMQAMKLEKDNA+DRA + EQ+++DANL+AEK+EEE R LQKKIQ IENELDQ 
Sbjct  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
            QES+ Q N KLEEKEKALQ AE +VAALNRRIQL+EEDLERSEERL  ATAKL EAS+AA
Sbjct  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER RK+LE+RS+ DEERMD LENQLKEAR +AE+AD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKA QREE Y+ QI+ +T +LKEAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            FAERSVQKLQKEVDRLEDELV EKEKYK I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAEL 281

Sequence Alignment: 19. Allergen Name: Der f 10.0101 Sequence ID: BAA04557

 Score = 327.5 bits 1408,  Expect = 4e-91
 Identities = 229/281 81%, Positives = 250/281 88%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            M+AIKKKMQAMKLEKDNA+DRA + EQ+A+DANLRAEK+EEE R LQKKIQ IENELDQ 
Sbjct  16   MEAIKKKMQAMKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 75
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
            QE L   N KLEEKEKALQ AE +VAALNRRIQL+EEDLERSEERL  ATAKL EASQ+A
Sbjct  76   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSA 135
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER RK+LE+RS+ DEERMD LENQLKEAR +AE+AD+KYDEVARKLAMVEADLERAE
Sbjct  136  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 195
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKA QREE Y+ QI+ +T +LKEAEARAE
Sbjct  196  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 255
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            FAERSVQKLQKEVDRLEDELV EKEKYK I D+LD  F EL
Sbjct  256  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAEL 296

Sequence Alignment: 20. Allergen Name: Copt f 7.0101 Sequence ID: AGM32377.1

 Score = 326.7 bits 1404,  Expect = 6e-91
 Identities = 230/251 91%, Positives = 241/251 96%, Gaps = 0/251 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKMQAMKLEKDN +DRA +CEQQA+DANLRAEKAEEEAR LQKKIQ IEN+LDQT
Sbjct  1    MDAIKKKMQAMKLEKDNTMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
             E LMQVN KL+EK+KALQNAESEVAALNRRIQLLEEDLERSEERLATATAKL+EASQAA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESERARK+LE++ LADEERMDALENQLKEARF+AEEADKKYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAESGESKIVELEEELRVVGNNLKSLEVSEEKAN REEEYK QIKTLTTRLKEAEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQK 251
            FAERSVQKLQK
Sbjct  241  FAERSVQKLQK 251

Sequence Alignment: 21. Allergen Name: Blo t 10.0101 Sequence ID: ABU97466

 Score = 323.9 bits 1392,  Expect = 4e-90
 Identities = 225/281 80%, Positives = 252/281 89%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            M+AIKKKMQAMKLEKDNA+DRA + EQ+++DANLRAEK+EEE R LQKKIQ IENELDQ 
Sbjct  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
            QESL Q N KLEEKEK+LQ AE +VAALNRRIQL+EEDLERSEERL  ATAKL EAS++A
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER RK+LE+RS+ DEERMD LE+QLKEAR +AE+AD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAE+GE+KIVELEEELRVVGNNLKSLEVSEEKA QREE Y+ QI+ +T +LKEAEARAE
Sbjct  181  ERAETGETKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRMMTGKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            FAERSV+KLQKEVDRLEDELV EKEKYK I D+LD  F EL
Sbjct  241  FAERSVRKLQKEVDRLEDELVHEKEKYKSISDELDQTFAEL 281

Sequence Alignment: 22. Allergen Name: Lep d 10 Sequence ID: Q9NFZ4

 Score = 322.7 bits 1387,  Expect = 9e-90
 Identities = 225/281 80%, Positives = 251/281 89%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            M+AIK KMQAMKLEKDNA+DRA + EQ+++DANLRAEK+EEE R LQKKIQ IENELDQ 
Sbjct  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
            QESL Q N KLEEKEK+LQ AE +VAALNRRIQL+EEDLERSE RL  AT+KL EASQ+A
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER RK+LE+RS+ DEERM+ LE+QLKEAR +AE+AD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKA QREE Y+ QI+ +TT+LKEAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            FAERSVQKLQKEVDRLEDELV EKEKYK I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAEL 281

Sequence Alignment: 23. Allergen Name: Pan s 1 Sequence ID: O61379

 Score = 322.5 bits 1386,  Expect = 1e-89
 Identities = 227/271 83%, Positives = 244/271 90%, Gaps = 0/271 0%
Query  11   MKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQTQESLMQVNGK 70
            MKLEKDNA+DRA   EQQ K+AN+RAEKAEEE   LQK++Q +EN+LDQ QESL++ N +
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
Query  71   LEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAADESERARKVL 130
            LEEK+KAL NAE EVAALNRRIQLLEEDLERSEERL TAT KL+EASQAADESER RKVL
Sbjct  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  131  ENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAESGESKI 190
            ENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAEERAE+GESK 
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
Query  191  VELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAERSVQKLQ 250
            VELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTLT +LK AEARAEFAERSVQKLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  251  KEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            KEVDRLEDELV EKEKYK I D+LD  F EL
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSEL 271

Sequence Alignment: 24. Allergen Name: Der p 10 Sequence ID: O18416

 Score = 322.5 bits 1386,  Expect = 1e-89
 Identities = 226/281 80%, Positives = 249/281 88%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            M+AIK KMQAMKLEKDNA+DRA + EQ+A+DANLRAEK+EEE R LQKKIQ IENELDQ 
Sbjct  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
            QE L   N KLEEKEKALQ AE +VAALNRRIQL+EEDLERSEERL  ATAKL EASQ+A
Sbjct  61   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER RK+LE+RS+ DEERM+ LENQLKEAR +AE+AD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMEGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKA QREE ++ QI+ +TT+LKEAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAHEQQIRIMTTKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            FAERSVQKLQKEV RLEDELV EKEKYK I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVGRLEDELVHEKEKYKSISDELDQTFAEL 281

Sequence Alignment: 25. Allergen Name: Tyr p 10.0101 Sequence ID: AAT40866

 Score = 322.3 bits 1385,  Expect = 1e-89
 Identities = 223/281 79%, Positives = 252/281 89%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIK KMQAMKLE+DNA+DRA + EQ+A+DANL++EK EEE R LQKKIQ IENELDQ 
Sbjct  1    MDAIKNKMQAMKLEEDNAIDRAEIAEQKARDANLKSEKTEEEVRALQKKIQQIENELDQV 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
            QE+L Q   KLEEKEKALQ AE++VAALNRRIQL+EEDLERSEERL  ATAKL EAS++A
Sbjct  61   QENLTQATTKLEEKEKALQTAEADVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER RK+LE+RS+ DEERMD LE+QLKEAR++AE+AD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLESQLKEARLMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKA QREE Y+ QI+ +T++LKEAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTSKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            FAERSVQKLQKEVDRLEDELV EKEKY+ I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYESISDELDQTFAEL 281

Sequence Alignment: 26. Allergen Name: Cha f 1 Sequence ID: Q9N2R3

 Score = 320.7 bits 1378,  Expect = 3e-89
 Identities = 229/264 86%, Positives = 238/264 90%, Gaps = 0/264 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKMQAMKLEKDNA+DRA   EQQ K+ANLRAEK EEE R  QKK+Q +ENELDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
            QE L   N KL+EKEKALQNAE EVAALNRRIQL EEDLERSEERL TAT KL+EASQAA
Sbjct  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLPEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER RKVLENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTL  +LK AEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEK 264
            FAERSVQKLQKEVDRLEDELV EK
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEK 264

Sequence Alignment: 27. Allergen Name: Met e 1 Sequence ID: Q25456

 Score = 319.8 bits 1374,  Expect = 7e-89
 Identities = 226/271 83%, Positives = 243/271 89%, Gaps = 0/271 0%
Query  11   MKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQTQESLMQVNGK 70
            MKLEKDNA+DRA   EQQ K+AN RAEK+EEE   LQK++Q +EN+LDQ QESL++ N +
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
Query  71   LEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAADESERARKVL 130
            L EK+KAL NAE EVAALNRRIQLLEEDLERSEERL TAT KL+EASQAADESER RKVL
Sbjct  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  131  ENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAESGESKI 190
            ENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAEERAE+GESKI
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
Query  191  VELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAERSVQKLQ 250
            VELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTLT +LK AEARAEFAERSVQKLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  251  KEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            KEVDRLEDELV EKEKYK I D+LD  F EL
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSEL 271

Sequence Alignment: 28. Allergen Name: Ani s 3 Sequence ID: Q9NAS5

 Score = 289.0 bits 1239,  Expect = 1e-79
 Identities = 201/281 71%, Positives = 234/281 83%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKMQAMK+EKDNALDRA   E++ +    + E+ EEE R  QKK+   EN+LD+ 
Sbjct  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
            QE L   N  LEEKEK +Q AE+EVAALNRR+ LLEE+LER+EERL  ATAKL EA++ A
Sbjct  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER RKV+ENRS+ DEER + +E+QLKEA+ LAEEAD+KYDEVARKL MVEADLERAE
Sbjct  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAE+GE+KIVELEEELRVVGNNLKSLEVSEEKA QRE+ Y+ QI+T++ RLKEAE RAE
Sbjct  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            FAERSVQKLQKEVDRLEDELV EKE+YK I ++LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQEL 281

Sequence Alignment: 29. Allergen Name: Asc l 3.0101 Sequence ID: ACN32322

 Score = 288.1 bits 1235,  Expect = 3e-79
 Identities = 201/281 71%, Positives = 234/281 83%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKMQAMK+EKDNALDRA   E++ +    + E+ EEE R  QKK+   EN+LD+ 
Sbjct  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
            QE L   N  LEEKEK +Q AE+EVAALNRR+ LLEE+LER+EERL  AT KL EA++ A
Sbjct  61   QEDLSVANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATEKLEEATHTA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER RKV+ENRS+ DEER + +E+QLKEA+ LAEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAE+GE+KIVELEEELRVVGNNLKSLEVSEEKA QRE+ Y+ QI+T++ RLKEAE RAE
Sbjct  181  ERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            FAERSVQKLQKEVDRLEDELV EKE+YK I ++LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQEL 281

Sequence Alignment: 30. Allergen Name: Lep s 1 Sequence ID: CAC84590

 Score = 269.2 bits 1152,  Expect = 1e-73
 Identities = 187/281 66%, Positives = 228/281 81%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            M+AIKKKMQAMKLEKDNA+D+A   E QA+DAN +A+K  EE + L+KK   +E ++  T
Sbjct  1    MEAIKKKMQAMKLEKDNAMDKADALEAQARDANRKADKILEEVQDLKKKPSQVETDFTTT 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
            +E+L   N  LE+KEK L N ESEVA+LNR++Q++EE+LERSEERL TA  KL EAS+AA
Sbjct  61   KENLATANKNLEDKEKTLTNTESEVASLNRKVQMIEENLERSEERLGTALTKLGEASHAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DE+ R  KVLENRS  DEERMD L NQLKEAR LAE+AD K DEV+RK+A VE DLE AE
Sbjct  121  DEASRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADGKSDEVSRKMAQVEDDLEVAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            +R +SG+SKI+ELEEEL+VVGN+LKSLEVSEEKANQR EEYK QIKTLT +LKEAEARAE
Sbjct  181  DRVKSGDSKIMELEEELKVVGNSLKSLEVSEEKANQRVEEYKRQIKTLTVKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            +AE+ V+KLQKEVDRLEDEL   K++Y+ + D++D  F EL
Sbjct  241  YAEKYVKKLQKEVDRLEDELGINKDRYRALADEMDQTFAEL 281

Sequence Alignment: 31. Allergen Name: Aed a 10.0201 Sequence ID: Q17H80

 Score = 262.6 bits 1123,  Expect = 1e-71
 Identities = 183/281 65%, Positives = 226/281 80%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKMQAMKLEKDNA D+A  CE QAK+ANLRA+K  EE  +L K++  +  + ++ 
Sbjct  1    MDAIKKKMQAMKLEKDNAADKADTCENQAKEANLRADKIMEEVAELTKRLTQVTEDHEKF 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
            + +L Q N  LEEKEK L + E+ VAAL R++Q +EEDLE+SEER   A +KL EA+Q+A
Sbjct  61   KNTLEQANKDLEEKEKLLTSTEANVAALTRKVQQVEEDLEKSEERSGAALSKLLEATQSA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DE+ R  KVLENRS  DEERMD L NQLKEAR LAE+AD K DEV+RKLA VE +LE AE
Sbjct  121  DENNRMCKVLENRSQQDEERMDQLSNQLKEARMLAEDADGKSDEVSRKLAFVEDELEVAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            +R +SGE+KI+ELEEEL+VVGN+LKSLEVSE+KANQR EE+K Q+K+LT +LKEAE RAE
Sbjct  181  DRVKSGEAKIMELEEELKVVGNSLKSLEVSEDKANQRVEEFKRQLKSLTIKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
             AE++V+KLQKEVDRLED+L+ EK+KYK I DDLD+ F EL
Sbjct  241  NAEKNVKKLQKEVDRLEDKLMNEKDKYKAICDDLDSTFAEL 281

Sequence Alignment: 32. Allergen Name: Hel as 1 Sequence ID: CAB38044

 Score = 262.6 bits 1123,  Expect = 1e-71
 Identities = 180/281 64%, Positives = 220/281 78%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKM AMK+EK+NALDRA   EQ+ +D      K EE+   LQKK   +EN++D  
Sbjct  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
             E L+  N KLE  EK     ESE A L RRIQLLEEDLERSEERL +AT KL EAS+AA
Sbjct  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER RKVLE+RSLAD+ER+D LE QLKEA+++AE+A++K+DE ARKLA+ E DLERAE
Sbjct  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
             R E+ E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE+ Y+  I+ LT RLK+AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
             AER+V KLQKEVDRLEDEL+AEKE+YK   D+LD+ F EL
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAEL 281

Sequence Alignment: 33. Allergen Name: Hal l 1.0101 Sequence ID: APG42675

 Score = 256.0 bits 1094,  Expect = 1e-69
 Identities = 176/281 62%, Positives = 219/281 77%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKM AMK+EK+NA+DRA   EQ+ +D   +  K EE+   LQKK   +EN++D  
Sbjct  1    MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNV 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
             E L +   KLE  EK +   E EV+   R+I LLEEDLER+EERL TAT +L EAS+AA
Sbjct  61   NEQLQEAMTKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER RKVLE+RSLAD+ER+D LE QLKEA+++AE+A++KYDE ARKLA+ E DLERAE
Sbjct  121  DESERGRKVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
             R E+ E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE+ Y+  I+ LT RLK+AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
             AER+V KLQKEVDRLEDEL+AEKEKYK I D+LD  F EL
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAEL 281

Sequence Alignment: 34. Allergen Name: Hal d 1 Sequence ID: AAG08987

 Score = 253.7 bits 1084,  Expect = 6e-69
 Identities = 174/281 61%, Positives = 218/281 77%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKM AMK+EK+NA+DRA   EQ+ +D   +  K EE+   LQKK   +EN++D  
Sbjct  1    MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNV 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
             E L +   KLE  EK +   E EV+   R+I LLEEDLER+EERL TAT +L EAS+AA
Sbjct  61   NEQLQEAMAKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER  +VLE+RSLAD+ER+D LE QLKEA+++AE+A++KYDE ARKLA+ E DLERAE
Sbjct  121  DESERGARVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
             R E+ E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE+ Y+  I+ LT RLK+AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
             AER+V KLQKEVDRLEDEL+AEKEKYK I D+LD  F EL
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAEL 281

Sequence Alignment: 35. Allergen Name: Sac g 1.0101 Sequence ID: AVD53650

 Score = 249.1 bits 1064,  Expect = 1e-67
 Identities = 173/281 61%, Positives = 211/281 75%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MD+IKKKM AMK+EK+NA DRA   EQQ +D   +  K EE+   LQKK   +ENE+D  
Sbjct  1    MDSIKKKMIAMKMEKENAQDRAEQLEQQLRDTEEQKAKIEEDLTTLQKKHSNLENEFDIV 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
             E       K EE EK    +E E+ +LNRRIQLLEED+ERSEERL TAT KL EAS+AA
Sbjct  61   NEKYQDCQAKYEEAEKKASESEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEASKAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER RKVLEN + A EER D LE QL EA+++AEEADKKYDE ARKLA+ E DLERAE
Sbjct  121  DESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
             R E+ E+K+++LEE+L VVGNN+K+L+V  ++A+QRE+ Y+  I+ LT RLK+AE RA 
Sbjct  181  ARLEAAEAKVIDLEEQLSVVGNNIKTLQVQNDQASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
             AER+V KLQKEVDRLEDEL+AEKE+YK I D+LD  F EL
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAEL 281

Sequence Alignment: 36. Allergen Name: Sal s 4.0101 Sequence ID: NP_001117128

 Score = 233.8 bits 997,  Expect = 5e-63
 Identities = 164/281 58%, Positives = 215/281 76%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKMQ +KL+K+NALDRA   E   K A  ++++ E++   LQKK++  E+ELD+ 
Sbjct  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
             ESL     KLE  EK   +AE++VA+LNRRIQL+EE+L+R++ERLATA  KL EA +AA
Sbjct  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER  KV+ENR+  DEE+M+  + QLKEA+ +AEEAD+KY+EVARKL ++E+DLER E
Sbjct  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK +Q+E++Y+ +IK LT +LKEAE RAE
Sbjct  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            FAERSV KL+K +D LEDEL A+K KYK I ++LD A+ ++
Sbjct  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDM 281

Sequence Alignment: 37. Allergen Name: Pan h 4.0201 Sequence ID: XP_026775428

 Score = 233.2 bits 994,  Expect = 9e-63
 Identities = 163/281 58%, Positives = 214/281 76%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKMQ +KL+K+NALDRA   E   K A  R+++ E++   LQKK++  E+ELD+ 
Sbjct  1    MDAIKKKMQMLKLDKENALDRAEQAESDKKAAEDRSKQLEDDLVALQKKLKGTEDELDKY 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
             E+L     KLE  EK   +AE++VA+LNRRIQL+EE+L+R++ERLATA  KL EA +AA
Sbjct  61   SEALKDAQEKLELSEKKAADAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER  KV+ENR+L DEE+M+  E QLKEA+ +AEEAD+KY+EVARKL +VE +LER E
Sbjct  121  DESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAE  E K  ELEEEL+ V N LKSLE   EK +Q+E++Y+ +IK LT +LKEAE RAE
Sbjct  181  ERAELSEGKCAELEEELKTVTNTLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            FAER+V KL+K +D LEDEL ++K KYK I ++LD A+ ++
Sbjct  241  FAERTVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDM 281

Sequence Alignment: 38. Allergen Name: Mim n 1 Sequence ID: AAG08989

 Score = 232.9 bits 993,  Expect = 1e-62
 Identities = 163/281 58%, Positives = 203/281 72%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            MDAIKKKMQAMK++++NA D A   EQ+ KD      K EEE  +LQKK+   EN  D  
Sbjct  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
             E L + N KLE  EK +   ES+V  L RR+ LLEED ERSEE+L + T KL EAS+AA
Sbjct  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER RKVLE RS + EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
             R E+ ++K++ELEEEL VVG N+K+L+V  ++A+QRE+ Y+  I+ LT  LK+AE RA 
Sbjct  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
             AER V KLQKEVDRLEDEL+AEKE+YK I DDLD  F E+
Sbjct  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEI 281

Sequence Alignment: 39. Allergen Name: Per v 1 Sequence ID: AAG08988

 Score = 229.1 bits 976,  Expect = 1e-61
 Identities = 161/280 57%, Positives = 206/280 73%, Gaps = 2/280 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKK-IQTIENELDQ 59
            MDAIKKKM AMK+EK NALDRA   EQ+ ++      K E++   L KK IQT EN+ D 
Sbjct  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQT-ENDYDN 59
Query  60   TQESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQA 119
                L  V  K E  EK +Q  E E+ +L R+I LLEE + ++EER+ TA+ KL EAS+A
Sbjct  60   CNTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKA 119
Query  120  ADESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERA 179
            ADESER RKVLEN +  ++ER+D LE QL EA+++AEEADKKY+E ARKLA+ E DLERA
Sbjct  120  ADESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERA 179
Query  180  EERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARA 239
            E R E+ E+K+++LEE+L VVG N+K+L+V  ++A+QRE+ Y+  I+ LT RLK+AE RA
Sbjct  180  EARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRA 239
Query  240  EFAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
              AER+V KLQKEVDRLEDEL+ EKEKYK I D+LD  F EL
Sbjct  240  TEAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAEL 281

Sequence Alignment: 40. Allergen Name: Cra g 1 Sequence ID: AAK96889

 Score = 215.2 bits 915,  Expect = 2e-57
 Identities = 148/225 65%, Positives = 178/225 79%, Gaps = 0/225 0%
Query  57   LDQTQESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEA 116
            +D   E   +   K+EE EK    AE E+ +LNRRIQLLEED+ERSEERL TAT KL EA
Sbjct  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
Query  117  SQAADESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADL 176
            S+AADESER RKVLEN + A EER D LE QL EA+++AEEADKKYDE ARKLA+ E DL
Sbjct  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
Query  177  ERAEERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAE 236
            ERAE R E+ E+K++ELEEEL+VVGNN+KSLE+SE++A+QRE+ Y+  I+ LT RLK+AE
Sbjct  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
Query  237  ARAEFAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
             RA  AER+V KLQKEVDRLEDEL+AEKE+YK I D+LD  F EL
Sbjct  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAEL 230

Sequence Alignment: 41. Allergen Name: Pan h 4.0101 Sequence ID: XP_026781482

 Score = 210.6 bits 895,  Expect = 5e-56
 Identities = 149/281 53%, Positives = 204/281 72%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
            M+AIKKKMQ +K +K+NA+DRA   E   K +  + ++ E+E   LQKK++  E+E+D+ 
Sbjct  1    MEAIKKKMQMLKGDKENAFDRAEQAELDKKVSEDKCKQLEDELLGLQKKLKGTEDEVDKY 60
Query  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
             E+L     KLE  EK   +AE EVAALNRRIQL+EE+L+R++ RL TA  KL EA + A
Sbjct  61   SEALKDAQEKLELSEKKATDAEGEVAALNRRIQLIEEELDRAQGRLGTALQKLEEAEKQA 120
Query  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
            DESER  KV+ENR++ DEE+M+  E QLKEA+ +AE++D+KYDEVARKL ++E +LERAE
Sbjct  121  DESERGMKVIENRAMKDEEKMEIQELQLKEAKQIAEDSDRKYDEVARKLVVIEGELERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
            ERAE  E K  +LEEEL+ V N LKSLE   EK + +E++Y+ +I  L  +LKEAE RAE
Sbjct  181  ERAEVSELKSGDLEEELKNVTNTLKSLEAQAEKYSDKEDKYEEEINLLNEKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281
            FAE++V KL+K +D LEDEL  +K K K I ++LD A+ ++
Sbjct  241  FAEKTVSKLEKTIDDLEDELYNQKLKVKAICEELDNALNDM 281

Sequence Alignment: 42. Allergen Name: Der f 11.0101 Sequence ID: AAK39511

 Score = 58.6 bits 229,  Expect = 7e-10
 Identities = 61/258 23%, Positives = 126/258 48%, Gaps = 6/258 2%
Query  6    KKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQTQESLM 65
            K+++ +KL+ DNA        QQ +D   R E+ E +   L+   +T+E EL+  +  L 
Sbjct  127  KEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLD 186
Query  66   QVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAADESER 125
            + +    E E+ L  A  + A+   +    E +L+   + +     K+   +Q   E E 
Sbjct  187  EESEARLELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKM---AQKISEYEE 240
Query  126  ARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAES 185
              + L N+  + E++   L+++++      E+A +   ++ +++A +E      + + E 
Sbjct  241  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE 300
Query  186  GESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAERS 245
                + + ++ELRV    L+ L+   EK   + ++   + K LT  L EA+++   A R 
Sbjct  301  VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLNDAHRR 360
Query  246  VQKLQKEVDRLEDELVAEKEKYKD 269
            +++ + E+ RLE+E       YK+
Sbjct  361  IHEQEIEIKRLENERDELSAAYKE 384

Sequence Alignment: 43. Allergen Name: Der p 11 Sequence ID: AAO73464

 Score = 57.9 bits 226,  Expect = 2e-09
 Identities = 60/258 23%, Positives = 125/258 48%, Gaps = 6/258 2%
Query  6    KKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQTQESLM 65
            K+++ +KL+ DNA        QQ +D   R E+ E +   L+   +T+E EL+  +  L 
Sbjct  213  KEVHEVKLQLDNANHLKQQIAQQLEDTRHRLEEEERKRSSLENHAHTLEVELESLKVQLD 272
Query  66   QVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAADESER 125
              +    E E+ L  A  + A+   +    E +L+   + +     K+   +Q   E E 
Sbjct  273  DESEARLELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKM---AQKISEYEE 326
Query  126  ARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAES 185
              + L N+  + E++   L+++++      E+A     ++ +++A +E      +++ E 
Sbjct  327  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKAAAHAQQLEKRVAQLEKINLDLKDKLEE 386
Query  186  GESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAERS 245
                + + ++ELR+    L+ L+   EK   + ++   + K LT  L EA+++   A R 
Sbjct  387  VTMLMEQAQKELRIKIGELQKLQHEYEKVRDQRDQLARENKKLTDDLAEAKSQLNDAHRR 446
Query  246  VQKLQKEVDRLEDELVAEKEKYKD 269
            +++ + E+ RLE+E       YK+
Sbjct  447  IHEQEIEIKRLENERDELSAAYKE 470
 Score = 42.8 bits 160,  Expect = 5e-05
 Identities = 74/252 29%, Positives = 135/252 53%, Gaps = 33/252 13%
Query  4    IKKKMQAMKLEKDNALD---RAAMCEQQA-KDANLRAEKAEEEARQLQKKIQTIENELDQ 59
            +KKK QA   E + +LD   +A +  Q+  K   L+  + +    ++++++Q   ++L  
Sbjct  539  LKKKYQAQITELELSLDAANKANIDLQKTIKKQALQITELQAHYDEVHRQLQQAVDQLGV 598
Query  60   TQESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEE------RLATATAKL 113
            TQ     +  +LEE   AL+ A     A  +  QL EE + R  E       LA+A +KL
Sbjct  599  TQRRCQALQAELEEMRIALEQASR---AKRQAEQLHEEAVVRVNELTTINVNLASAKSKL 655
Query  114  -SEASQAADESERARKVLENRSLADEERMDALENQLKEAR-FLAEEADK--KYDEVARKL 169
             SE S    + +   K L       +ER+  L  +LK  + +L EE ++  K + V + L
Sbjct  656  ESEFSALQADYDEVHKELR----ISDERVQKLTIELKSTKDLLIEEQERLVKLETVKKSL 711
Query  170  AM----VEADLERAEERAESGESKIV-ELEEELRVVGNNLKSLEVSEEKANQREEEYKNQ 224
                  +   +E  E  A +G  +++ +LE  +R V      +EV EE+  +R  E +  
Sbjct  712  EQEVRTLHVRIEEVEANALAGGKRVIAKLESRIRDV-----EIEVEEER--RRHAETEKM 764
Query  225  IKTLTTRLKEAEARAEFAERSVQKLQKEVDRLEDELVAEKEKYKD 269
            ++    R+KE   + E   + +Q LQ+  D+L +++   K + ++
Sbjct  765  LRKKDHRVKELLLQNEEDHKQIQLLQEMTDKLNEKVKVYKRQMQE 809

Sequence Alignment: 44. Allergen Name: Blo t 11 Sequence ID: AAM83103

 Score = 55.2 bits 214,  Expect = 1e-08
 Identities = 62/256 24%, Positives = 121/256 47%, Gaps = 10/256 3%
Query  6    KKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQTQESLM 65
            K+++  K+  DNA        QQ +D   R E  E +   L+   +T+E EL+  +  L 
Sbjct  213  KEVHEYKISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLE 272
Query  66   QVNGKLEEKEKALQNAESEVAALNRRIQL-LEEDLERSEERLATATAKLSEASQAADESE 124
            + +    E E+ L  A  + A+   + +  L+  ++  EE       K+SE  +  +   
Sbjct  273  EESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALL 332
Query  125  RARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAE 184
                 LE +    +  ++ L   L++A   A+  +K+  ++ +    +  DL+   E   
Sbjct  333  NKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEK----INLDLKSKLEEV- 387
Query  185  SGESKIVE-LEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAE 243
               S ++E  +++LRV   +L+ L+   EK   ++E    + K L   L EA+++   A 
Sbjct  388  ---SMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAH 444
Query  244  RSVQKLQKEVDRLEDELVAEKEKYKD 269
            R +++ + E+ RLE+E       YK+
Sbjct  445  RRIHEQEIEIKRLENEREELAAAYKE 470

Sequence Alignment: 45. Allergen Name: Rap v 2.0101 Sequence ID: QPB41107

 Score = 54.2 bits 210,  Expect = 2e-08
 Identities = 69/245 28%, Positives = 132/245 53%, Gaps = 26/245 10%
Query  2    DAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKA--EEEARQLQKKIQTIENELDQ 59
            D  K+  Q   LE +NA  +  + E   ++  LR EKA  E++ ++L+     +    D 
Sbjct  361  DLTKRNRQ---LENENAGLQRRIEELTGENNTLRNEKALLEQDVQKLRVSNAELTERNDN 417
Query  60   TQESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQA 119
             Q    +++ +L E   AL++A  E+A L +    L   LE   + LA A     EA + 
Sbjct  418  LQRENKHLSDQLREANLALKDANRELADLRQ----LRSQLEAERDSLAAALKDTEEALRD 473
Query  120  ADESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERA 179
            A+      K+   ++  ++ ++D +EN+L+E        D++ + V R  A    +L+R 
Sbjct  474  AEA-----KLASAQAALNQLKID-MENRLREK-------DEEIENVRRSSARAIEELQRT 520
Query  180  EERAESG-ESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEAR 238
                E+  +++I  +++++    ++++ LE + + AN+   EY  QIK+L  R+KE E  
Sbjct  521  LVEVETRYKTEISRMKKKFE---SDIRELEAALDNANRANSEYLKQIKSLQQRVKELETL 577
Query  239  AEFAERSVQKLQKEVDRLEDELVAEKEKYKD 269
             E   R    L+ ++   E + VA  ++ +D
Sbjct  578  LEEERRVSDDLRNQLGVAERKRVALAQELED 608

Sequence Alignment: 46. Allergen Name: Ani s 2 Sequence ID: AAF72796

 Score = 48.3 bits 184,  Expect = 1e-06
 Identities = 73/247 29%, Positives = 127/247 51%, Gaps = 29/247 11%
Query  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLR----AEKAEEEAR--QLQKKIQTIE 54
            M+A++K MQ  ++++  A    A    +A+ A LR    AE AE E     L +     +
Sbjct  509  MEALRKSMQ-FEIDRLTAALADAEARMKAEIARLRKKYQAEIAELEMTVDNLNRANLEAQ 567
Query  55   NELDQTQESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLS 114
              + +  E ++Q+   LE+ ++ LQ    + A   R+I  L  +LE  +  L  A     
Sbjct  568  KTIKKQSEQIIQLQANLEDTQRQLQQTLDQYALAQRKISALSAELEECKTALDNAIRARK 627
Query  115  EASQAADESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEA 174
            +A   AD  E   ++ +  S+     + A++N+L E  +   +AD   DEV ++L    A
Sbjct  628  QAE--ADLEEAHVRISDLTSINSN--LTAIKNKL-ETELSTAQAD--LDEVTKELHA--A 678
Query  175  DLERAEERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKE 234
            D ERA          + EL EE         S+++   + +  E     Q+K L  +++E
Sbjct  679  D-ERANRALADAARAVQELHEEQE------HSMKIDALRKSLEE-----QVKQLQVQIQE 726
Query  235  AEARAEFA-ERSVQKLQKEVDRLEDELVAEKEKYKD 269
            AEA A +  +R + KL+  +  LE  L  E  ++K+
Sbjct  727  AEAAALLGGKRVIAKLETRIRDLEVALDEETRRHKE 762
 Score = 48.5 bits 185,  Expect = 1e-06
 Identities = 73/259 28%, Positives = 138/259 53%, Gaps = 25/259 9%
Query  4    IKKKMQAMKLEKDNAL--DRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQTQ 61
            + +KM A K+E+      ++     ++  D   + ++ + E   L  +I+  + +LD  Q
Sbjct  170  VAEKM-AQKFEQQTIELSNKVEDLNKHVNDLAQQRQRLQAENSDLLAEIHDQKVQLDNLQ 228
Query  62   ESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAAD 121
                Q+  +LEE  + L++AE E + +  + QL +  LE    R+A     L E S A  
Sbjct  229  HVKYQLAQQLEESRRRLEDAERERSQM--QAQLHQVQLELDSVRVA-----LDEESAARV 281
Query  122  ESERARKVLENRSLAD-EERMDAL----ENQLKEARFLAEEADKKYDEVARKLAMVEADL 176
            E+E  +  L N  +   + + DA       ++++ R    +   +Y+E    +    + L
Sbjct  282  EAEH-KLSLANTEITQWKSKFDAEVALHHEEVEDLRKKMMQKQAEYEEQIEIMLQKVSQL 340
Query  177  ERAEERAESG-ESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEA 235
            E+A+ R +S  E  IV+LE+      N +  LE ++E+  ++  E K++I  L   L+ A
Sbjct  341  EKAKARLQSEVEVLIVDLEK----AQNTIAILERAKEQLEKQVLEMKSRIDELLVELEAA 396
Query  236  --EARAEFAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTA 277
              EARA +AE  +QK+++  ++  ++  A   + K + DDL  A
Sbjct  397  QREARAALAE--LQKMKQLYEKAVEQKEALARENKKLQDDLHEA 438

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.