The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV
QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE
FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sequence Info Allergen Name Length Opt Bits Score E Value
AAC48288 Hom a 1.0102 284 1719 398.4 1.5e-112
C0LU07 Pro c 1.0101 284 1695 392.9 6.7e-111
M1H607 Por p 1.0101 284 1694 392.7 7.9e-111
AAX37288 Pen m 1 284 1691 392.0 1.3e-110
11893851 Pen a 1 284 1691 392.0 1.3e-110
EU410072 Lit v 1.0101 284 1691 392.0 1.3e-110
D3XNR9 Mac r 1.0101 284 1683 390.2 4.5e-110
CBY17558 Pan b 1.0101 284 1657 384.3 2.7e-108
O61379 Pan s 1 274 1643 381.1 2.4e-107
M4M2H6 Mel l 1.0101 284 1638 380.0 5.5e-107
O44119 Hom a 1.0101 284 1631 378.4 1.7e-106
Q25456 Met e 1 274 1630 378.1 1.9e-106
A7L5V2 Scy p 1.0101 284 1621 376.1 8.1e-106
Q9N2R3 Cha f 1 264 1487 345.6 1.2e-96
AEX31649 Cho a 10.0101 284 1459 339.2 1.1e-94
BAA04557 Der f 10.0101 299 1455 338.2 2.1e-94
AAF72534 Bla g 7.0101 284 1450 337.1 4.4e-94
AAD19606 Per a 7.0102 284 1444 335.7 1.1e-93
ABU97466 Blo t 10.0101 284 1444 335.7 1.1e-93
NP_001103782 Bomb m 3.0101 285 1444 335.7 1.1e-93
Q9NFZ4 Lep d 10 284 1440 334.8 2.1e-93
Q9UB83 Per a 7 284 1440 334.8 2.1e-93
O18416 Der p 10 284 1429 332.3 1.2e-92
AAT40866 Tyr p 10.0101 284 1417 329.6 8e-92
Q17H75 Aed a 10.0101 285 1411 328.2 2.1e-91
CAA09938 Chi k 10 285 1365 317.7 3e-88
Q9NAS5 Ani s 3 284 1303 303.6 5.3e-84
ACN32322 Asc l 3.0101 287 1300 302.9 8.7e-84
AGM32377.1 Copt f 7.0101 256 1284 299.3 9.4e-83
CAC84590 Lep s 1 284 1200 280.1 6.2e-77
Q17H80 Aed a 10.0201 284 1156 270.1 6.5e-74
CAB38044 Hel as 1 284 1155 269.9 7.6e-74
APG42675 Hal l 1.0101 284 1135 265.3 1.8e-72
AAG08987 Hal d 1 284 1118 261.4 2.6e-71
AVD53650 Sac g 1.0101 284 1085 253.9 4.9e-69
AAG08989 Mim n 1 284 1033 242.0 1.8e-65
NP_001117128 Sal s 4.0101 284 1000 234.5 3.3e-63
AAG08988 Per v 1 284 998 234.1 4.5e-63
XP_026775428 Pan h 4.0201 284 998 234.1 4.5e-63
AAK96889 Cra g 1 233 941 221.2 2.9e-59
XP_026781482 Pan h 4.0101 284 926 217.7 4e-58
AAK39511 Der f 11.0101 692 236 60.2 2.4e-10
AAO73464 Der p 11 875 211 54.5 1.6e-08
QPB41107 Rap v 2.0101 859 202 52.4 6.6e-08
AAF72796 Ani s 2 869 194 50.6 2.4e-07
AAM83103 Blo t 11 875 194 50.6 2.4e-07
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Hom a 1.0102 Sequence ID: AAC48288

 Score = 398.4 bits 1719,  Expect = 2e-112
 Identities = 284/284 100%, Positives = 284/284 100%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 2. Allergen Name: Pro c 1.0101 Sequence ID: C0LU07

 Score = 392.9 bits 1695,  Expect = 7e-111
 Identities = 279/284 98%, Positives = 283/284 99%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQA KLEKDNAMDRADTLEQQNKEANIRAEK+EEEVHNLQKRMQ+LENDLDQV
Sbjct  1    MDAIKKKMQATKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQHLENDLDQV 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QESLLKANTQLEEKDKA+SNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QESLLKANTQLEEKDKAISNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELTGY 284

Sequence Alignment: 3. Allergen Name: Por p 1.0101 Sequence ID: M1H607

 Score = 392.7 bits 1694,  Expect = 8e-111
 Identities = 279/284 98%, Positives = 281/284 98%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKD+AMDRADTLEQQNKEANIRAEK+EEEVHNLQKRMQQLENDLDQV
Sbjct  1    MDAIKKKMQAMKLEKDDAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQV 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTL NKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKS TDELDQ FSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSTTDELDQAFSELSGY 284

Sequence Alignment: 4. Allergen Name: Pen m 1 Sequence ID: AAX37288

 Score = 392.0 bits 1691,  Expect = 1e-110
 Identities = 280/284 98%, Positives = 280/284 98%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN RAEKSEEEVHNLQKRMQQLENDLDQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QESLLKAN QL EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTL NKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 5. Allergen Name: Pen a 1 Sequence ID: 11893851

 Score = 392.0 bits 1691,  Expect = 1e-110
 Identities = 280/284 98%, Positives = 280/284 98%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN RAEKSEEEVHNLQKRMQQLENDLDQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QESLLKAN QL EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTL NKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 6. Allergen Name: Lit v 1.0101 Sequence ID: EU410072

 Score = 392.0 bits 1691,  Expect = 1e-110
 Identities = 280/284 98%, Positives = 280/284 98%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN RAEKSEEEVHNLQKRMQQLENDLDQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QESLLKAN QL EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTL NKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 7. Allergen Name: Mac r 1.0101 Sequence ID: D3XNR9

 Score = 390.2 bits 1683,  Expect = 4e-110
 Identities = 278/284 97%, Positives = 280/284 98%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN RAEKSEEEVHNLQKRMQQLENDLD V
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDSV 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE+LLKAN +LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTL NKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 8. Allergen Name: Pan b 1.0101 Sequence ID: CBY17558

 Score = 384.3 bits 1657,  Expect = 3e-108
 Identities = 274/284 96%, Positives = 278/284 97%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN RAEKSEEEV  LQK++QQLENDLD V
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVFGLQKKLQQLENDLDSV 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE+LLKAN +LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTL NKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 9. Allergen Name: Pan s 1 Sequence ID: O61379

 Score = 381.1 bits 1643,  Expect = 2e-107
 Identities = 271/274 98%, Positives = 272/274 99%, Gaps = 0/274 0%
Query  11   MKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 70
            MKLEKDNAMDRADTLEQQNKEANIRAEK+EEEVHNLQKRMQQLENDLDQVQESLLKANTQ
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
Query  71   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
            LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 190
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESK 
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
Query  191  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAEFAERSVQKLQ 250
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTL NKLKAAEARAEFAERSVQKLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 10. Allergen Name: Mel l 1.0101 Sequence ID: M4M2H6

 Score = 380.0 bits 1638,  Expect = 6e-107
 Identities = 270/284 95%, Positives = 278/284 97%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEK+E++V+ LQK++QQLEND+DQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE+LL ANT   EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTL NKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 11. Allergen Name: Hom a 1.0101 Sequence ID: O44119

 Score = 378.4 bits 1631,  Expect = 2e-106
 Identities = 269/284 94%, Positives = 277/284 97%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEK+EEE+   +K+MQQ+EN+LDQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKTEEEIRITHKKMQQVENELDQV 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  ANT+LEEK+KAL NAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QEQLSLANTKLEEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 12. Allergen Name: Met e 1 Sequence ID: Q25456

 Score = 378.1 bits 1630,  Expect = 2e-106
 Identities = 270/274 98%, Positives = 270/274 98%, Gaps = 0/274 0%
Query  11   MKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 70
            MKLEKDNAMDRADTLEQQNKEAN RAEKSEEEVHNLQKRMQQLENDLDQVQESLLKAN Q
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
Query  71   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
            L EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 190
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
Query  191  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAEFAERSVQKLQ 250
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTL NKLKAAEARAEFAERSVQKLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 13. Allergen Name: Scy p 1.0101 Sequence ID: A7L5V2

 Score = 376.1 bits 1621,  Expect = 8e-106
 Identities = 265/284 93%, Positives = 275/284 96%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN+RAEK+EEE+   QK+MQQ+EN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  ANT+L+EK+KAL NAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YKEQIKTLANKLKAAEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 14. Allergen Name: Cha f 1 Sequence ID: Q9N2R3

 Score = 345.6 bits 1487,  Expect = 1e-96
 Identities = 244/264 92%, Positives = 254/264 96%, Gaps = 0/264 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN+RAEK+EEE+   QK+MQQ+EN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  ANT+L+EK+KAL NAEGEVAALNRRIQL EEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLPEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YKEQIKTLANKLKAAEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEK 264
            FAERSVQKLQKEVDRLEDELVNEK
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEK 264

Sequence Alignment: 15. Allergen Name: Cho a 10.0101 Sequence ID: AEX31649

 Score = 339.2 bits 1459,  Expect = 1e-94
 Identities = 232/284 81%, Positives = 266/284 93%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            M+AIKKKMQAMKLEKDNA+DRA+  EQ++++AN++AEKSEEEV  LQK++QQ+EN+LDQV
Sbjct  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QES+ +ANT+LEEK+KAL  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EAS+AA
Sbjct  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +  KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 16. Allergen Name: Der f 10.0101 Sequence ID: BAA04557

 Score = 338.2 bits 1455,  Expect = 2e-94
 Identities = 233/284 82%, Positives = 263/284 92%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            M+AIKKKMQAMKLEKDNA+DRA+  EQ+ ++AN+RAEKSEEEV  LQK++QQ+EN+LDQV
Sbjct  16   MEAIKKKMQAMKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 75
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  ANT+LEEK+KAL  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EASQ+A
Sbjct  76   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSA 135
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  136  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 195
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +  KLK AEARAE
Sbjct  196  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 255
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  256  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 299

Sequence Alignment: 17. Allergen Name: Bla g 7.0101 Sequence ID: AAF72534

 Score = 337.1 bits 1450,  Expect = 4e-94
 Identities = 235/283 83%, Positives = 257/283 90%, Gaps = 0/283 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMDRA   EQQ ++ANIRAEK+EEE  +LQK++QQ+ENDLDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E L++ N +L+EKDKAL NAE EVAALNRRIQLLEEDLERSEERL TAT KLAEASQAA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE++ L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAN REE YK+QIKTL  +LK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSG 283
            FAERSVQKLQKEVDRLEDELV+EKEKYK I D+LD TF+EL G
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKYICDDLDMTFTELIG 283

Sequence Alignment: 18. Allergen Name: Per a 7.0102 Sequence ID: AAD19606

 Score = 335.7 bits 1444,  Expect = 1e-93
 Identities = 233/283 82%, Positives = 257/283 90%, Gaps = 0/283 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMDRA   EQQ ++AN+RAEK+EEE  +LQK++QQ+ENDLDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E L++ N +L+EKDKAL NAE EVAALNRRIQLLEEDLERSEERL TAT KLAEASQAA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE++ L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKAN REE YK+QIKTL  +LK AEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSG 283
            FAERSVQKLQKEVDRLEDELV+EKEKYK I D+LD TF+EL G
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTELIG 283

Sequence Alignment: 19. Allergen Name: Blo t 10.0101 Sequence ID: ABU97466

 Score = 335.7 bits 1444,  Expect = 1e-93
 Identities = 229/284 80%, Positives = 266/284 93%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            M+AIKKKMQAMKLEKDNA+DRA+  EQ++++AN+RAEKSEEEV  LQK++QQ+EN+LDQV
Sbjct  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QESL +ANT+LEEK+K+L  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EAS++A
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +  KLK AEARAE
Sbjct  181  ERAETGETKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRMMTGKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSV+KLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVRKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 20. Allergen Name: Bomb m 3.0101 Sequence ID: NP_001103782

 Score = 335.7 bits 1444,  Expect = 1e-93
 Identities = 236/281 83%, Positives = 254/281 90%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNA+DRA   EQQ K+AN+RAEK+EEE   LQK++Q +EN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QESL++ N +LEEK+KAL NAE EVAALNRRIQLLEEDLERSEERL TAT KL+EASQAA
Sbjct  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTL  +LK AEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL 281
            FAERSVQKLQKEVDRLEDELV EKEKYK I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281

Sequence Alignment: 21. Allergen Name: Lep d 10 Sequence ID: Q9NFZ4

 Score = 334.8 bits 1440,  Expect = 2e-93
 Identities = 229/284 80%, Positives = 265/284 93%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            M+AIK KMQAMKLEKDNA+DRA+  EQ++++AN+RAEKSEEEV  LQK++QQ+EN+LDQV
Sbjct  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QESL +ANT+LEEK+K+L  AEG+VAALNRRIQL+EEDLERSE RL  AT+KL EASQ+A
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERM+ LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +  KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 22. Allergen Name: Per a 7 Sequence ID: Q9UB83

 Score = 334.8 bits 1440,  Expect = 2e-93
 Identities = 232/284 81%, Positives = 257/284 90%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMD A   EQQ ++AN+RAEK+EEE  +LQK++QQ+ENDLDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDCALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E L++ N +L+EKDKAL NAE EVAALNRRIQLLEEDLERSEERL TAT KLAEASQA 
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAV 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE++ L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKAN REE YK+QIKTL  +LK AEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYK I D+LD TF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTELAGY 284

Sequence Alignment: 23. Allergen Name: Der p 10 Sequence ID: O18416

 Score = 332.3 bits 1429,  Expect = 1e-92
 Identities = 229/284 80%, Positives = 261/284 91%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            M+AIK KMQAMKLEKDNA+DRA+  EQ+ ++AN+RAEKSEEEV  LQK++QQ+EN+LDQV
Sbjct  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  ANT+LEEK+KAL  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EASQ+A
Sbjct  61   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERM+ LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMEGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEA+++QI+ +  KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAHEQQIRIMTTKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEV RLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVGRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 24. Allergen Name: Tyr p 10.0101 Sequence ID: AAT40866

 Score = 329.6 bits 1417,  Expect = 8e-92
 Identities = 224/284 78%, Positives = 264/284 92%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIK KMQAMKLE+DNA+DRA+  EQ+ ++AN+++EK+EEEV  LQK++QQ+EN+LDQV
Sbjct  1    MDAIKNKMQAMKLEEDNAIDRAEIAEQKARDANLKSEKTEEEVRALQKKIQQIENELDQV 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE+L +A T+LEEK+KAL  AE +VAALNRRIQL+EEDLERSEERL  AT KL EAS++A
Sbjct  61   QENLTQATTKLEEKEKALQTAEADVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LE+QLKEAR++AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLESQLKEARLMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ + +KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTSKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKY+SI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYESISDELDQTFAELTGY 284

Sequence Alignment: 25. Allergen Name: Aed a 10.0101 Sequence ID: Q17H75

 Score = 328.2 bits 1411,  Expect = 2e-91
 Identities = 229/281 81%, Positives = 250/281 88%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNA+DRA   EQQ ++AN+RAEK+EEE   LQK++Q +ENDLDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRALLCEQQARDANLRAEKAEEEARQLQKKIQAIENDLDQT 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE+L+  N +LEEK+KAL NAE EVAALNRRIQLLEEDLERSEERL +AT KL+EAS AA
Sbjct  61   QEALMAVNAKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLASATAKLSEASAAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLENR+L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKVLENRALADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAE GE KIVELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTL  +LK AEARAE
Sbjct  181  ERAEAGEGKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL 281
            FAERSVQKLQKEVDRLEDELV EKEKY+ I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVMEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 26. Allergen Name: Chi k 10 Sequence ID: CAA09938

 Score = 317.7 bits 1365,  Expect = 3e-88
 Identities = 224/281 79%, Positives = 245/281 87%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNA+DRA   E Q ++AN+RAEK+EEE   LQK++Q +ENDLDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRALLCENQARDANLRAEKAEEEARTLQKKIQTIENDLDQT 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            Q      N +LE K+KAL NAE EVAALNRRIQLL EDL+RSEERL +AT KL+EAS AA
Sbjct  61   QGQETLVNGKLEGKEKALQNAESEVAALNRRIQLLGEDLDRSEERLASATAKLSEASAAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAE GE+KIVELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTL  +LK AEARAE
Sbjct  181  ERAEAGEAKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL 281
            FAERSVQKLQKEVDRLEDELV+EKEKY+ I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVSEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 27. Allergen Name: Ani s 3 Sequence ID: Q9NAS5

 Score = 303.6 bits 1303,  Expect = 5e-84
 Identities = 208/284 73%, Positives = 247/284 86%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMK+EKDNA+DRAD  E++ ++   + E+ EEE+ + QK+M Q ENDLD+ 
Sbjct  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  AN+ LEEK+K +  AE EVAALNRR+ LLEE+LER+EERL  AT KL EA++ A
Sbjct  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER+RKV+ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKL MVEADLERAE
Sbjct  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAE
Sbjct  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKE+YKSI++ELDQTF ELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 28. Allergen Name: Asc l 3.0101 Sequence ID: ACN32322

 Score = 302.9 bits 1300,  Expect = 9e-84
 Identities = 208/284 73%, Positives = 247/284 86%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMK+EKDNA+DRAD  E++ ++   + E+ EEE+ + QK+M Q ENDLD+ 
Sbjct  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  AN+ LEEK+K +  AE EVAALNRR+ LLEE+LER+EERL  AT KL EA++ A
Sbjct  61   QEDLSVANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATEKLEEATHTA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER+RKV+ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAE GE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAE
Sbjct  181  ERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKE+YKSI++ELDQTF ELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 29. Allergen Name: Copt f 7.0101 Sequence ID: AGM32377.1

 Score = 299.3 bits 1284,  Expect = 9e-83
 Identities = 207/251 82%, Positives = 228/251 90%, Gaps = 0/251 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDN MDRA   EQQ ++AN+RAEK+EEE  +LQK++QQ+ENDLDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNTMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E L++ N +L+EKDKAL NAE EVAALNRRIQLLEEDLERSEERL TAT KLAEASQAA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE++ L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKAN REE YK+QIKTL  +LK AEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQK 251
            FAERSVQKLQK
Sbjct  241  FAERSVQKLQK 251

Sequence Alignment: 30. Allergen Name: Lep s 1 Sequence ID: CAC84590

 Score = 280.1 bits 1200,  Expect = 6e-77
 Identities = 193/284 67%, Positives = 238/284 83%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            M+AIKKKMQAMKLEKDNAMD+AD LE Q ++AN +A+K  EEV++L+K+  Q+E D+   
Sbjct  1    MEAIKKKMQAMKLEKDNAMDKADALEAQARDANRKADKILEEVQDLKKKPSQVETDFTTT 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            +E+L  AN  LE+K+K L+N E EVA+LNR++Q++EE+LERSEERL TA TKL EAS+AA
Sbjct  61   KENLATANKNLEDKEKTLTNTESEVASLNRKVQMIEENLERSEERLGTALTKLGEASHAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DE+ RM KVLENRS  DEERMD L NQLKEAR LAE+AD K DEV+RK+A VE DLE AE
Sbjct  121  DEASRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADGKSDEVSRKMAQVEDDLEVAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            +R ++G+SKI+ELEEEL+VVGN+LKSLEVSEEKANQR E YK QIKTL  KLK AEARAE
Sbjct  181  DRVKSGDSKIMELEEELKVVGNSLKSLEVSEEKANQRVEEYKRQIKTLTVKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            +AE+ V+KLQKEVDRLEDEL   K++Y+++ DE+DQTF+ELSGY
Sbjct  241  YAEKYVKKLQKEVDRLEDELGINKDRYRALADEMDQTFAELSGY 284

Sequence Alignment: 31. Allergen Name: Aed a 10.0201 Sequence ID: Q17H80

 Score = 270.1 bits 1156,  Expect = 7e-74
 Identities = 187/284 65%, Positives = 232/284 81%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNA D+ADT E Q KEAN+RA+K  EEV  L KR+ Q+  D ++ 
Sbjct  1    MDAIKKKMQAMKLEKDNAADKADTCENQAKEANLRADKIMEEVAELTKRLTQVTEDHEKF 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            + +L +AN  LEEK+K L++ E  VAAL R++Q +EEDLE+SEER   A +KL EA+Q+A
Sbjct  61   KNTLEQANKDLEEKEKLLTSTEANVAALTRKVQQVEEDLEKSEERSGAALSKLLEATQSA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DE+ RM KVLENRS  DEERMD L NQLKEAR LAE+AD K DEV+RKLA VE +LE AE
Sbjct  121  DENNRMCKVLENRSQQDEERMDQLSNQLKEARMLAEDADGKSDEVSRKLAFVEDELEVAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            +R ++GE+KI+ELEEEL+VVGN+LKSLEVSE+KANQR E +K Q+K+L  KLK AE RAE
Sbjct  181  DRVKSGEAKIMELEEELKVVGNSLKSLEVSEDKANQRVEEFKRQLKSLTIKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AE++V+KLQKEVDRLED+L+NEK+KYK+I D+LD TF+EL+GY
Sbjct  241  NAEKNVKKLQKEVDRLEDKLMNEKDKYKAICDDLDSTFAELTGY 284

Sequence Alignment: 32. Allergen Name: Hel as 1 Sequence ID: CAB38044

 Score = 269.9 bits 1155,  Expect = 8e-74
 Identities = 182/284 64%, Positives = 232/284 81%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKM AMK+EK+NA+DRA+ +EQ+ ++      K EE+++NLQK+   LEND+D +
Sbjct  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E LL ANT+LE  +K  +  E E A L RRIQLLEEDLERSEERL +AT KL EAS+AA
Sbjct  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLE+RSL+D+ER+D LE QLKEA+++AE+A+RK+DE ARKLA+ E DLERAE
Sbjct  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ L  +LK AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+ +DELD TF+EL+GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284

Sequence Alignment: 33. Allergen Name: Hal l 1.0101 Sequence ID: APG42675

 Score = 265.3 bits 1135,  Expect = 2e-72
 Identities = 181/284 63%, Positives = 233/284 82%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKM AMK+EK+NA+DRA+  EQ+ ++   +  K EE+++NLQK+   LEND+D V
Sbjct  1    MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNV 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E L +A T+LE  +K ++  E EV+   R+I LLEEDLER+EERL TAT +L EAS+AA
Sbjct  61   NEQLQEAMTKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLE+RSL+D+ER+D LE QLKEA+++AE+A+RKYDE ARKLA+ E DLERAE
Sbjct  121  DESERGRKVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ L  +LK AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+I+DELDQTF+EL+GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 34. Allergen Name: Hal d 1 Sequence ID: AAG08987

 Score = 261.4 bits 1118,  Expect = 3e-71
 Identities = 178/284 62%, Positives = 231/284 81%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKM AMK+EK+NA+DRA+  EQ+ ++   +  K EE+++NLQK+   LEND+D V
Sbjct  1    MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNV 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E L +A  +LE  +K ++  E EV+   R+I LLEEDLER+EERL TAT +L EAS+AA
Sbjct  61   NEQLQEAMAKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER  +VLE+RSL+D+ER+D LE QLKEA+++AE+A+RKYDE ARKLA+ E DLERAE
Sbjct  121  DESERGARVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ L  +LK AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+I+DELDQTF+EL+GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 35. Allergen Name: Sac g 1.0101 Sequence ID: AVD53650

 Score = 253.9 bits 1085,  Expect = 5e-69
 Identities = 173/284 60%, Positives = 222/284 78%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MD+IKKKM AMK+EK+NA DRA+ LEQQ ++   +  K EE++  LQK+   LEN++D V
Sbjct  1    MDSIKKKMIAMKMEKENAQDRAEQLEQQLRDTEEQKAKIEEDLTTLQKKHSNLENEFDIV 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E       + EE +K  S +E E+ +LNRRIQLLEED+ERSEERL TAT KL EAS+AA
Sbjct  61   NEKYQDCQAKYEEAEKKASESEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEASKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLEN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DLERAE
Sbjct  121  DESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
             R E  E+K+++LEE+L VVGNN+K+L+V  ++A+QRE++Y+E I+ L  +LK AE RA 
Sbjct  181  ARLEAAEAKVIDLEEQLSVVGNNIKTLQVQNDQASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+I+DELDQTF+EL+GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 284

Sequence Alignment: 36. Allergen Name: Mim n 1 Sequence ID: AAG08989

 Score = 242.0 bits 1033,  Expect = 2e-65
 Identities = 165/284 58%, Positives = 216/284 76%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMK++++NA D A+ +EQ+ K+      K EEE + LQK++   EN+ D V
Sbjct  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E L +ANT+LE  +K ++  E +V  L RR+ LLEED ERSEE+LN+ T KL EAS+AA
Sbjct  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLE RS S EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
             R E  ++K++ELEEEL VVG N+K+L+V  ++A+QRE++Y+E I+ L   LK AE RA 
Sbjct  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AER V KLQKEVDRLEDEL+ EKE+YK+I+D+LDQTF+E++GY
Sbjct  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284

Sequence Alignment: 37. Allergen Name: Sal s 4.0101 Sequence ID: NP_001117128

 Score = 234.5 bits 1000,  Expect = 3e-63
 Identities = 160/282 56%, Positives = 219/282 77%, Gaps = 0/282 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQ +KL+K+NA+DRA+  E   K A  ++++ E+++  LQK+++  E++LD+ 
Sbjct  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             ESL  A  +LE  +K  ++AE +VA+LNRRIQL+EE+L+R++ERL TA TKL EA +AA
Sbjct  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER  KV+ENR+  DEE+M+  + QLKEA+ +AEEADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK +Q+E+ Y+E+IK L +KLK AE RAE
Sbjct  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS 282
            FAERSV KL+K +D LEDEL  +K KYK+I++ELD  +++++
Sbjct  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282

Sequence Alignment: 38. Allergen Name: Per v 1 Sequence ID: AAG08988

 Score = 234.1 bits 998,  Expect = 5e-63
 Identities = 159/284 55%, Positives = 213/284 75%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKM AMK+EK NA+DRA+ LEQ+ +E      K E++ ++L K+  Q END D  
Sbjct  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
               L     + E  +K +   E E+ +L R+I LLEE + ++EER+ TA+ KL EAS+AA
Sbjct  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLEN +  ++ER+D LE QL EA+++AEEAD+KY+E ARKLA+ E DLERAE
Sbjct  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
             R E  E+K+++LEE+L VVG N+K+L+V  ++A+QRE++Y+E I+ L N+LK AE RA 
Sbjct  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+I+DELD TF+EL+GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284

Sequence Alignment: 39. Allergen Name: Pan h 4.0201 Sequence ID: XP_026775428

 Score = 234.1 bits 998,  Expect = 5e-63
 Identities = 159/282 56%, Positives = 219/282 77%, Gaps = 0/282 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQ +KL+K+NA+DRA+  E   K A  R+++ E+++  LQK+++  E++LD+ 
Sbjct  1    MDAIKKKMQMLKLDKENALDRAEQAESDKKAAEDRSKQLEDDLVALQKKLKGTEDELDKY 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E+L  A  +LE  +K  ++AE +VA+LNRRIQL+EE+L+R++ERL TA  KL EA +AA
Sbjct  61   SEALKDAQEKLELSEKKAADAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER  KV+ENR+L DEE+M+  E QLKEA+ +AEEADRKY+EVARKL +VE +LER E
Sbjct  121  DESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAE  E K  ELEEEL+ V N LKSLE   EK +Q+E+ Y+E+IK L +KLK AE RAE
Sbjct  181  ERAELSEGKCAELEEELKTVTNTLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS 282
            FAER+V KL+K +D LEDEL ++K KYK+I++ELD+ +++++
Sbjct  241  FAERTVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMT 282

Sequence Alignment: 40. Allergen Name: Cra g 1 Sequence ID: AAK96889

 Score = 221.2 bits 941,  Expect = 3e-59
 Identities = 150/228 65%, Positives = 187/228 82%, Gaps = 0/228 0%
Query  57   LDQVQESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEA 116
            +D V E   +  T++EE +K  S AE E+ +LNRRIQLLEED+ERSEERL TAT KL EA
Sbjct  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
Query  117  SQAADESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADL 176
            S+AADESER RKVLEN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DL
Sbjct  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
Query  177  ERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAE 236
            ERAE R E  E+K++ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ L  +LK AE
Sbjct  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
Query  237  ARAEFAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK+I+DELDQTF+EL+GY
Sbjct  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233

Sequence Alignment: 41. Allergen Name: Pan h 4.0101 Sequence ID: XP_026781482

 Score = 217.7 bits 926,  Expect = 4e-58
 Identities = 150/282 53%, Positives = 210/282 74%, Gaps = 0/282 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
            M+AIKKKMQ +K +K+NA DRA+  E   K +  + ++ E+E+  LQK+++  E+++D+ 
Sbjct  1    MEAIKKKMQMLKGDKENAFDRAEQAELDKKVSEDKCKQLEDELLGLQKKLKGTEDEVDKY 60
Query  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E+L  A  +LE  +K  ++AEGEVAALNRRIQL+EE+L+R++ RL TA  KL EA + A
Sbjct  61   SEALKDAQEKLELSEKKATDAEGEVAALNRRIQLIEEELDRAQGRLGTALQKLEEAEKQA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER  KV+ENR++ DEE+M+  E QLKEA+ +AE++DRKYDEVARKL ++E +LERAE
Sbjct  121  DESERGMKVIENRAMKDEEKMEIQELQLKEAKQIAEDSDRKYDEVARKLVVIEGELERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
            ERAE  E K  +LEEEL+ V N LKSLE   EK + +E+ Y+E+I  L  KLK AE RAE
Sbjct  181  ERAEVSELKSGDLEEELKNVTNTLKSLEAQAEKYSDKEDKYEEEINLLNEKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS 282
            FAE++V KL+K +D LEDEL N+K K K+I +ELD  +++++
Sbjct  241  FAEKTVSKLEKTIDDLEDELYNQKLKVKAICEELDNALNDMT 282

Sequence Alignment: 42. Allergen Name: Der f 11.0101 Sequence ID: AAK39511

 Score = 60.2 bits 236,  Expect = 2e-10
 Identities = 63/256 24%, Positives = 131/256 51%, Gaps = 8/256 3%
Query  6    KKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQVQESLL 65
            K+++ +KL+ DNA      + QQ ++   R E+ E +  +L+   + LE +L+ ++  L 
Sbjct  127  KEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLD 186
Query  66   KANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESER 125
            + +    E ++ L+ A G+ A+   +    E +L+   + +     K+A   Q   E E 
Sbjct  187  EESEARLELERQLTKANGDAASWKSK---YEAELQAHADEVEELRRKMA---QKISEYEE 240
Query  126  MRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAET 185
              + L N+  S E++   L+++++      E+A R   ++ +++A +E      + + E 
Sbjct  241  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE 300
Query  186  GESKIVELEEELRVVGNNLKSLEVSEEKA-NQREEAYKEQIKTLANKLKAAEARAEFAER 244
                + + ++ELRV    L+ L+   EK  +QR++  +E  K L + L  A+++   A R
Sbjct  301  VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLAREN-KKLTDDLAEAKSQLNDAHR 359
Query  245  SVQKLQKEVDRLEDELVNEKEKYK 268
             +++ + E+ RLE+E       YK
Sbjct  360  RIHEQEIEIKRLENERDELSAAYK 383

Sequence Alignment: 43. Allergen Name: Der p 11 Sequence ID: AAO73464

 Score = 54.5 bits 211,  Expect = 2e-08
 Identities = 61/256 23%, Positives = 130/256 50%, Gaps = 8/256 3%
Query  6    KKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQVQESLL 65
            K+++ +KL+ DNA      + QQ ++   R E+ E +  +L+   + LE +L+ ++  L 
Sbjct  213  KEVHEVKLQLDNANHLKQQIAQQLEDTRHRLEEEERKRSSLENHAHTLEVELESLKVQLD 272
Query  66   KANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESER 125
              +    E ++ L+ A G+ A+   +    E +L+   + +     K+A   Q   E E 
Sbjct  273  DESEARLELERQLTKANGDAASWKSK---YEAELQAHADEVEELRRKMA---QKISEYEE 326
Query  126  MRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAET 185
              + L N+  S E++   L+++++      E+A     ++ +++A +E      +++ E 
Sbjct  327  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKAAAHAQQLEKRVAQLEKINLDLKDKLEE 386
Query  186  GESKIVELEEELRVVGNNLKSLEVSEEKA-NQREEAYKEQIKTLANKLKAAEARAEFAER 244
                + + ++ELR+    L+ L+   EK  +QR++  +E  K L + L  A+++   A R
Sbjct  387  VTMLMEQAQKELRIKIGELQKLQHEYEKVRDQRDQLAREN-KKLTDDLAEAKSQLNDAHR 445
Query  245  SVQKLQKEVDRLEDELVNEKEKYK 268
             +++ + E+ RLE+E       YK
Sbjct  446  RIHEQEIEIKRLENERDELSAAYK 469
 Score = 42.2 bits 157,  Expect = 8e-05
 Identities = 70/253 27%, Positives = 131/253 51%, Gaps = 29/253 11%
Query  4    IKKKMQAMKLEKDNAMDRADT----LEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQ 59
            +KKK QA   E + ++D A+     L++  K+  ++  + +     +++++QQ  + L  
Sbjct  539  LKKKYQAQITELELSLDAANKANIDLQKTIKKQALQITELQAHYDEVHRQLQQAVDQLGV 598
Query  60   VQESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEA-SQ 118
             Q        +LEE   AL  A     A  +  QL EE + R  E L T    LA A S+
Sbjct  599  TQRRCQALQAELEEMRIALEQAS---RAKRQAEQLHEEAVVRVNE-LTTINVNLASAKSK 654
Query  119  AADESERMR----KVLENRSLSDEERMDALENQLKEAR-FLAEEADR--KYDEVARKLAM 171
               E   ++    +V +   +SDE R+  L  +LK  + +L EE +R  K + V + L  
Sbjct  655  LESEFSALQADYDEVHKELRISDE-RVQKLTIELKSTKDLLIEEQERLVKLETVKKSLEQ 713
Query  172  ----VEADLERAEERAETGESKIV-ELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIK 226
                +   +E  E  A  G  +++ +LE  +R V      +EV EE+  +R    ++ ++
Sbjct  714  EVRTLHVRIEEVEANALAGGKRVIAKLESRIRDV-----EIEVEEER--RRHAETEKMLR 766
Query  227  TLANKLKAAEARAEFAERSVQKLQKEVDRLEDELVNEKEKYK 268
               +++K    + E   + +Q LQ+  D+L +++   K + +
Sbjct  767  KKDHRVKELLLQNEEDHKQIQLLQEMTDKLNEKVKVYKRQMQ 808

Sequence Alignment: 44. Allergen Name: Rap v 2.0101 Sequence ID: QPB41107

 Score = 52.4 bits 202,  Expect = 7e-08
 Identities = 77/272 28%, Positives = 147/272 54%, Gaps = 54/272 19%
Query  4    IKKKMQAMKLEKDNAMDRADTLEQQNK-------EANIRAEKSEEEVHNLQKRMQQLEND 56
            +++ +Q +++      +R D L+++NK       EAN+  + +  E+ +L++   QLE +
Sbjct  397  LEQDVQKLRVSNAELTERNDNLQRENKHLSDQLREANLALKDANRELADLRQLRSQLEAE 456
Query  57   LDQVQESLLKANTQLEEKDKALSNAEGEVAALN----RRIQLLEEDLE---RSEER-LNT 108
             D +  +L      L + +  L++A+  +  L      R++  +E++E   RS  R +  
Sbjct  457  RDSLAAALKDTEEALRDAEAKLASAQAALNQLKIDMENRLREKDEEIENVRRSSARAIEE 516
Query  109  ATTKLAEA-SQAADESERMRKVLE-------------NRSLSD--------EERMDALEN 146
                L E  ++   E  RM+K +E             NR+ S+        ++R+  LE 
Sbjct  517  LQRTLVEVETRYKTEISRMKKKFESDIRELEAALDNANRANSEYLKQIKSLQQRVKELET 576
Query  147  QLKEARFLAEE-------ADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRV 199
             L+E R ++++       A+RK   +A++L    A LE AE   +  E+++ +    L  
Sbjct  577  LLEEERRVSDDLRNQLGVAERKRVALAQELEDARALLEGAERARKNAETELADTSTRLSE 636
Query  200  VGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAEFAERSVQKLQKEVDRLEDE 259
            +   + SL   + +      A +  +    N  + AE RAE       +L  E  RL DE
Sbjct  637  ITLQVTSLTNDKRRLEADLSAMQSDLDDAINNQRGAEERAE-------RLAAENGRLADE 689
Query  260  LVNEKEKYK---SITDELDQTFSELS 282
            L  E+E YK   S+  +L+    E++
Sbjct  690  LRQEQENYKNAESLRKQLEVEIREIT 715

Sequence Alignment: 45. Allergen Name: Ani s 2 Sequence ID: AAF72796

 Score = 50.6 bits 194,  Expect = 2e-07
 Identities = 71/266 26%, Positives = 140/266 52%, Gaps = 26/266 9%
Query  1    MDAIKKKMQ---AMKLEKDNAMDRADT-LEQQNKEANIRAEKSEEEVHNLQKRMQQLEND 56
            +D+++  +    A ++E ++ +  A+T + Q   + +       EEV +L+K+M Q + +
Sbjct  266  LDSVRVALDEESAARVEAEHKLSLANTEITQWKSKFDAEVALHHEEVEDLRKKMMQKQAE 325
Query  57   LDQVQESLLKANTQLEEKDKALSNAEGEVAALN-RRIQLLEEDLERSEERLNTATTKLAE 115
             ++  E +L+  +QLE K KA   +E EV  ++  + Q     LER++E+L         
Sbjct  326  YEEQIEIMLQKVSQLE-KAKARLQSEVEVLIVDLEKAQNTIAILERAKEQLE-------- 376
Query  116  ASQAADESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEAD 175
              Q  +   R+ ++L     +  E   AL  +L++ + L E+A  + + +AR+   ++ D
Sbjct  377  -KQVLEMKSRIDELLVELEAAQREARAALA-ELQKMKQLYEKAVEQKEALARENKKLQDD 434
Query  176  LERAEERAETGESKIVELE-EELRVVGNNLKSLEVS-EEKANQREEAYKEQIKTLANKLK 233
            L  A E       K+ EL+ E  R+ G  ++ L+V+ +E    R +A     + LA   +
Sbjct  435  LHEANEALADANRKLHELDLENARLAGE-IRDLQVALKESEAARRDAEARAQRALAELQQ 493
Query  234  A---AEARAEFAERSVQKLQK----EVDRLEDELVNEKEKYKSITDELDQTF 278
                 E R +  E  ++ L+K    E+DRL   L + + + K+    L + +
Sbjct  494  VRIEMERRLQEKEEEMEALRKSMQFEIDRLTAALADAEARMKAEIARLRKKY 545

Sequence Alignment: 46. Allergen Name: Blo t 11 Sequence ID: AAM83103

 Score = 50.6 bits 194,  Expect = 2e-07
 Identities = 59/255 23%, Positives = 126/255 49%, Gaps = 10/255 3%
Query  6    KKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQVQESLL 65
            K+++  K+  DNA      + QQ ++   R E  E +  +L+   + LE +L+ ++  L 
Sbjct  213  KEVHEYKISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLE 272
Query  66   KANTQLEEKDKALSNAEGEVAALNRRIQL-LEEDLERSEERLNTATTKLAEASQAADESE 124
            + +    E ++ L+ A G+ A+   + +  L+  ++  EE       K++E  +  +   
Sbjct  273  EESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALL 332
Query  125  RMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAE 184
                 LE +    +  ++ L   L++A   A+  +++  ++ +    +  DL+   E   
Sbjct  333  NKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEK----INLDLKSKLEEV- 387
Query  185  TGESKIVE-LEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAEFAE 243
               S ++E  +++LRV   +L+ L+   EK   ++EA   + K LA+ L  A+++   A 
Sbjct  388  ---SMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAH 444
Query  244  RSVQKLQKEVDRLEDELVNEKEKYK 268
            R +++ + E+ RLE+E       YK
Sbjct  445  RRIHEQEIEIKRLENEREELAAAYK 469
 Score = 40.6 bits 150,  Expect = 0.0002
 Identities = 62/224 27%, Positives = 108/224 48%, Gaps = 27/224 12%
Query  22   ADTLEQQNKEANIR--AEKSEEEVHNLQKRMQQLENDLD----QVQESLLKANTQLEEKD 75
            A+TL +Q +  N R  AE ++   H+ +KR+ Q E +++    Q Q  + + N +L E +
Sbjct  471  AETLRKQEEAKNQRLTAELAQTR-HDYEKRLAQKEEEIEALRKQYQIEIEQLNMRLAEAE 529
Query  76   KALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVLENRSL 135
              L     EVA L ++ Q    +LE S +  N A   L +  +        ++ L+   L
Sbjct  530  AKLKT---EVARLKKKYQAQITELELSLDAANKANIDLQKTIK--------KQALQITGL 578
Query  136  SDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKIVELEE 195
              +   D +  QL++A        R+   +  +L  +  +LE+A       E    ++ E
Sbjct  579  --QAHYDEVHRQLQQAVDQLGVTQRRCQALTAELEEMRVNLEQALRAKRAAE----QMHE 632
Query  196  ELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAEFAERSVQKLQKEVDR 255
            E  V  N L ++ V+   A  + E    +   L N           ++  VQKL  EV  
Sbjct  633  EAVVRVNELTTINVNLASAKSKLET---EFSALQNDYDEVHKELRISDERVQKLTIEVKS 689
Query  256  LEDELVNEKEK 266
             +D L +E E+
Sbjct  690  TKDLLESETER 700

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.