The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA
QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE
FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sequence Info Allergen Name Length Opt Bits Score E Value
A7L5V2 Scy p 1.0101 284 1713 397.1 3.9e-112
O44119 Hom a 1.0101 284 1672 387.7 2.6e-109
AAC48288 Hom a 1.0102 284 1621 376.1 8.1e-106
C0LU07 Pro c 1.0101 284 1599 371.1 2.6e-104
AAX37288 Pen m 1 284 1598 370.8 3.1e-104
EU410072 Lit v 1.0101 284 1598 370.8 3.1e-104
11893851 Pen a 1 284 1598 370.8 3.1e-104
M1H607 Por p 1.0101 284 1598 370.8 3.1e-104
D3XNR9 Mac r 1.0101 284 1594 369.9 5.7e-104
CBY17558 Pan b 1.0101 284 1591 369.2 9.2e-104
M4M2H6 Mel l 1.0101 284 1583 367.4 3.3e-103
Q9N2R3 Cha f 1 264 1579 366.5 5.6e-103
O61379 Pan s 1 274 1547 359.2 9.2e-101
Q25456 Met e 1 274 1537 356.9 4.5e-100
BAA04557 Der f 10.0101 299 1489 346.0 9.8e-97
O18416 Der p 10 284 1463 340.1 5.6e-95
AEX31649 Cho a 10.0101 284 1461 339.6 7.7e-95
AAD19606 Per a 7.0102 284 1458 338.9 1.2e-94
NP_001103782 Bomb m 3.0101 285 1455 338.2 2e-94
Q9UB83 Per a 7 284 1454 338.0 2.3e-94
AAF72534 Bla g 7.0101 284 1452 337.6 3.2e-94
ABU97466 Blo t 10.0101 284 1452 337.6 3.2e-94
Q9NFZ4 Lep d 10 284 1442 335.3 1.5e-93
AAT40866 Tyr p 10.0101 284 1435 333.7 4.7e-93
Q17H75 Aed a 10.0101 285 1422 330.7 3.7e-92
CAA09938 Chi k 10 285 1389 323.2 6.7e-90
ACN32322 Asc l 3.0101 287 1335 310.9 3.4e-86
Q9NAS5 Ani s 3 284 1332 310.2 5.5e-86
AGM32377.1 Copt f 7.0101 256 1298 302.5 1e-83
CAC84590 Lep s 1 284 1196 279.2 1.2e-76
Q17H80 Aed a 10.0201 284 1140 266.4 8.2e-73
CAB38044 Hel as 1 284 1132 264.6 2.9e-72
APG42675 Hal l 1.0101 284 1121 262.1 1.6e-71
AAG08987 Hal d 1 284 1104 258.2 2.4e-70
AVD53650 Sac g 1.0101 284 1086 254.1 4.1e-69
AAG08989 Mim n 1 284 1034 242.3 1.5e-65
AAG08988 Per v 1 284 1012 237.3 5e-64
XP_026775428 Pan h 4.0201 284 1009 236.6 8e-64
NP_001117128 Sal s 4.0101 284 1007 236.1 1.1e-63
AAK96889 Cra g 1 233 939 220.7 3.9e-59
XP_026781482 Pan h 4.0101 284 929 218.3 2.5e-58
AAO73464 Der p 11 875 232 59.3 5.9e-10
AAM83103 Blo t 11 875 208 53.8 2.6e-08
QPB41107 Rap v 2.0101 859 206 53.3 3.5e-08
AAK39511 Der f 11.0101 692 162 43.3 2.9e-05
AAF72796 Ani s 2 869 160 42.8 5.1e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Scy p 1.0101 Sequence ID: A7L5V2

 Score = 397.1 bits 1713,  Expect = 4e-112
 Identities = 284/284 100%, Positives = 284/284 100%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 2. Allergen Name: Hom a 1.0101 Sequence ID: O44119

 Score = 387.7 bits 1672,  Expect = 3e-109
 Identities = 276/284 97%, Positives = 280/284 98%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN+RAEKTEEEIR T+KKMQQVENELDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKTEEEIRITHKKMQQVENELDQV 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QEQLS ANTKL+EKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QEQLSLANTKLEEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YKEQIKTLANKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 3. Allergen Name: Hom a 1.0102 Sequence ID: AAC48288

 Score = 376.1 bits 1621,  Expect = 8e-106
 Identities = 265/284 93%, Positives = 275/284 96%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN+RAEK+EEE+   QK+MQQ+EN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  ANT+L+EK+KAL NAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YKEQIKTLANKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 4. Allergen Name: Pro c 1.0101 Sequence ID: C0LU07

 Score = 371.1 bits 1599,  Expect = 3e-104
 Identities = 261/284 91%, Positives = 273/284 96%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKMQA KLEKDNAMDRADTLEQQNKEAN+RAEK EEE+   QK+MQ++EN+LDQ 
Sbjct  1    MDAIKKKMQATKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQHLENDLDQV 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  ANT+L+EK+KA+ NAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QESLLKANTQLEEKDKAISNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YKEQIKTLANKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELTGY 284

Sequence Alignment: 5. Allergen Name: Pen m 1 Sequence ID: AAX37288

 Score = 370.8 bits 1598,  Expect = 3e-104
 Identities = 263/284 92%, Positives = 271/284 95%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN RAEK+EEE+   QK+MQQ+EN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  AN +L EK+KAL NAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YKEQIKTL NKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 6. Allergen Name: Lit v 1.0101 Sequence ID: EU410072

 Score = 370.8 bits 1598,  Expect = 3e-104
 Identities = 263/284 92%, Positives = 271/284 95%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN RAEK+EEE+   QK+MQQ+EN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  AN +L EK+KAL NAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YKEQIKTL NKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 7. Allergen Name: Pen a 1 Sequence ID: 11893851

 Score = 370.8 bits 1598,  Expect = 3e-104
 Identities = 263/284 92%, Positives = 271/284 95%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN RAEK+EEE+   QK+MQQ+EN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  AN +L EK+KAL NAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YKEQIKTL NKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 8. Allergen Name: Por p 1.0101 Sequence ID: M1H607

 Score = 370.8 bits 1598,  Expect = 3e-104
 Identities = 261/284 91%, Positives = 271/284 95%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKMQAMKLEKD+AMDRADTLEQQNKEAN+RAEK EEE+   QK+MQQ+EN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDDAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQV 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  ANT+L+EK+KAL NAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YKEQIKTL NKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKS TDELDQ FSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSTTDELDQAFSELSGY 284

Sequence Alignment: 9. Allergen Name: Mac r 1.0101 Sequence ID: D3XNR9

 Score = 369.9 bits 1594,  Expect = 6e-104
 Identities = 262/284 92%, Positives = 270/284 95%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN RAEK+EEE+   QK+MQQ+EN+LD  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDSV 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  AN  L+EK+KAL NAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YKEQIKTL NKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 10. Allergen Name: Pan b 1.0101 Sequence ID: CBY17558

 Score = 369.2 bits 1591,  Expect = 9e-104
 Identities = 262/284 92%, Positives = 270/284 95%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN RAEK+EEE+   QKK+QQ+EN+LD  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVFGLQKKLQQLENDLDSV 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  AN  L+EK+KAL NAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YKEQIKTL NKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 11. Allergen Name: Mel l 1.0101 Sequence ID: M4M2H6

 Score = 367.4 bits 1583,  Expect = 3e-103
 Identities = 260/284 91%, Positives = 270/284 95%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN+RAEK E+++   QKK+QQ+EN++DQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  ANT   EK+KAL NAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YKEQIKTL NKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 12. Allergen Name: Cha f 1 Sequence ID: Q9N2R3

 Score = 366.5 bits 1579,  Expect = 6e-103
 Identities = 263/264 99%, Positives = 263/264 99%, Gaps = 0/264 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQL EEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLPEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEK 264
            FAERSVQKLQKEVDRLEDELVNEK
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEK 264

Sequence Alignment: 13. Allergen Name: Pan s 1 Sequence ID: O61379

 Score = 359.2 bits 1547,  Expect = 9e-101
 Identities = 253/274 92%, Positives = 262/274 95%, Gaps = 0/274 0%
Query  11   MKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQAQEQLSAANTK 70
            MKLEKDNAMDRADTLEQQNKEAN+RAEK EEE+   QK+MQQ+EN+LDQ QE L  ANT+
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
Query  71   LDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
            L+EK+KAL NAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAESGESKI 190
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAE+GESK 
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
Query  191  VELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAEFAERSVQKLQ 250
            VELEEELRVVGNNLKSLEVSEEKANQREE YKEQIKTL NKLKAAEARAEFAERSVQKLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 14. Allergen Name: Met e 1 Sequence ID: Q25456

 Score = 356.9 bits 1537,  Expect = 4e-100
 Identities = 253/274 92%, Positives = 261/274 95%, Gaps = 0/274 0%
Query  11   MKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQAQEQLSAANTK 70
            MKLEKDNAMDRADTLEQQNKEAN RAEK+EEE+   QK+MQQ+EN+LDQ QE L  AN +
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
Query  71   LDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
            L EK+KAL NAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAESGESKI 190
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAE+GESKI
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
Query  191  VELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAEFAERSVQKLQ 250
            VELEEELRVVGNNLKSLEVSEEKANQREE YKEQIKTL NKLKAAEARAEFAERSVQKLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 15. Allergen Name: Der f 10.0101 Sequence ID: BAA04557

 Score = 346.0 bits 1489,  Expect = 1e-96
 Identities = 237/284 83%, Positives = 266/284 93%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            M+AIKKKMQAMKLEKDNA+DRA+  EQ+ ++ANLRAEK+EEE+RA QKK+QQ+ENELDQ 
Sbjct  16   MEAIKKKMQAMKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 75
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QEQLSAANTKL+EKEKALQ AEG+VAALNRRIQL+EEDLERSEERL  AT KL EASQ+A
Sbjct  76   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSA 135
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  136  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 195
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKA QREE Y++QI+ +  KLK AEARAE
Sbjct  196  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 255
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  256  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 299

Sequence Alignment: 16. Allergen Name: Der p 10 Sequence ID: O18416

 Score = 340.1 bits 1463,  Expect = 6e-95
 Identities = 233/284 82%, Positives = 264/284 92%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            M+AIK KMQAMKLEKDNA+DRA+  EQ+ ++ANLRAEK+EEE+RA QKK+QQ+ENELDQ 
Sbjct  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QEQLSAANTKL+EKEKALQ AEG+VAALNRRIQL+EEDLERSEERL  AT KL EASQ+A
Sbjct  61   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERM+ LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMEGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKA QREE +++QI+ +  KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAHEQQIRIMTTKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEV RLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVGRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 17. Allergen Name: Cho a 10.0101 Sequence ID: AEX31649

 Score = 339.6 bits 1461,  Expect = 8e-95
 Identities = 231/284 81%, Positives = 264/284 92%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            M+AIKKKMQAMKLEKDNA+DRA+  EQ++++ANL+AEK+EEE+R  QKK+QQ+ENELDQ 
Sbjct  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE ++ ANTKL+EKEKALQ AEG+VAALNRRIQL+EEDLERSEERL  AT KL EAS+AA
Sbjct  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKA QREE Y++QI+ +  KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 18. Allergen Name: Per a 7.0102 Sequence ID: AAD19606

 Score = 338.9 bits 1458,  Expect = 1e-94
 Identities = 238/283 84%, Positives = 256/283 90%, Gaps = 0/283 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKMQAMKLEKDNAMDRA   EQQ ++ANLRAEK EEE R+ QKK+QQ+EN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             EQL   N KLDEK+KALQNAE EVAALNRRIQLLEEDLERSEERL TAT KLAEASQAA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE++ L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAESGESKIVELEEELRVVGNNLKSLEVSEEKAN REE YK+QIKTL  +LK AEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSG 283
            FAERSVQKLQKEVDRLEDELV+EKEKYK I D+LD TF+EL G
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTELIG 283

Sequence Alignment: 19. Allergen Name: Bomb m 3.0101 Sequence ID: NP_001103782

 Score = 338.2 bits 1455,  Expect = 2e-94
 Identities = 241/281 85%, Positives = 251/281 89%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKMQAMKLEKDNA+DRA   EQQ K+ANLRAEK EEE R  QKK+Q +ENELDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L   N KL+EKEKALQNAE EVAALNRRIQLLEEDLERSEERL TAT KL+EASQAA
Sbjct  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTL  +LK AEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL 281
            FAERSVQKLQKEVDRLEDELV EKEKYK I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281

Sequence Alignment: 20. Allergen Name: Per a 7 Sequence ID: Q9UB83

 Score = 338.0 bits 1454,  Expect = 2e-94
 Identities = 237/284 83%, Positives = 256/284 90%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKMQAMKLEKDNAMD A   EQQ ++ANLRAEK EEE R+ QKK+QQ+EN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDCALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             EQL   N KLDEK+KALQNAE EVAALNRRIQLLEEDLERSEERL TAT KLAEASQA 
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAV 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE++ L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAESGESKIVELEEELRVVGNNLKSLEVSEEKAN REE YK+QIKTL  +LK AEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYK I D+LD TF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTELAGY 284

Sequence Alignment: 21. Allergen Name: Bla g 7.0101 Sequence ID: AAF72534

 Score = 337.6 bits 1452,  Expect = 3e-94
 Identities = 236/283 83%, Positives = 256/283 90%, Gaps = 0/283 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKMQAMKLEKDNAMDRA   EQQ ++AN+RAEK EEE R+ QKK+QQ+EN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             EQL   N KLDEK+KALQNAE EVAALNRRIQLLEEDLERSEERL TAT KLAEASQAA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE++ L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKAN REE YK+QIKTL  +LK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSG 283
            FAERSVQKLQKEVDRLEDELV+EKEKYK I D+LD TF+EL G
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKYICDDLDMTFTELIG 283

Sequence Alignment: 22. Allergen Name: Blo t 10.0101 Sequence ID: ABU97466

 Score = 337.6 bits 1452,  Expect = 3e-94
 Identities = 229/284 80%, Positives = 265/284 93%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            M+AIKKKMQAMKLEKDNA+DRA+  EQ++++ANLRAEK+EEE+RA QKK+QQ+ENELDQ 
Sbjct  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L+ ANTKL+EKEK+LQ AEG+VAALNRRIQL+EEDLERSEERL  AT KL EAS++A
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAE+GE+KIVELEEELRVVGNNLKSLEVSEEKA QREE Y++QI+ +  KLK AEARAE
Sbjct  181  ERAETGETKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRMMTGKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSV+KLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVRKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 23. Allergen Name: Lep d 10 Sequence ID: Q9NFZ4

 Score = 335.3 bits 1442,  Expect = 2e-93
 Identities = 228/284 80%, Positives = 263/284 92%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            M+AIK KMQAMKLEKDNA+DRA+  EQ++++ANLRAEK+EEE+R  QKK+QQ+ENELDQ 
Sbjct  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L+ ANTKL+EKEK+LQ AEG+VAALNRRIQL+EEDLERSE RL  AT+KL EASQ+A
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERM+ LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKA QREE Y++QI+ +  KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 24. Allergen Name: Tyr p 10.0101 Sequence ID: AAT40866

 Score = 333.7 bits 1435,  Expect = 5e-93
 Identities = 227/284 79%, Positives = 263/284 92%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIK KMQAMKLE+DNA+DRA+  EQ+ ++ANL++EKTEEE+RA QKK+QQ+ENELDQ 
Sbjct  1    MDAIKNKMQAMKLEEDNAIDRAEIAEQKARDANLKSEKTEEEVRALQKKIQQIENELDQV 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L+ A TKL+EKEKALQ AE +VAALNRRIQL+EEDLERSEERL  AT KL EAS++A
Sbjct  61   QENLTQATTKLEEKEKALQTAEADVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LE+QLKEAR++AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLESQLKEARLMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKA QREE Y++QI+ + +KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTSKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKY+SI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYESISDELDQTFAELTGY 284

Sequence Alignment: 25. Allergen Name: Aed a 10.0101 Sequence ID: Q17H75

 Score = 330.7 bits 1422,  Expect = 4e-92
 Identities = 233/281 82%, Positives = 250/281 88%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKMQAMKLEKDNA+DRA   EQQ ++ANLRAEK EEE R  QKK+Q +EN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRALLCEQQARDANLRAEKAEEEARQLQKKIQAIENDLDQT 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L A N KL+EKEKALQNAE EVAALNRRIQLLEEDLERSEERL +AT KL+EAS AA
Sbjct  61   QEALMAVNAKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLASATAKLSEASAAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLENR+L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKVLENRALADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAE+GE KIVELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTL  +LK AEARAE
Sbjct  181  ERAEAGEGKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL 281
            FAERSVQKLQKEVDRLEDELV EKEKY+ I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVMEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 26. Allergen Name: Chi k 10 Sequence ID: CAA09938

 Score = 323.2 bits 1389,  Expect = 7e-90
 Identities = 228/281 81%, Positives = 248/281 88%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKMQAMKLEKDNA+DRA   E Q ++ANLRAEK EEE R  QKK+Q +EN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRALLCENQARDANLRAEKAEEEARTLQKKIQTIENDLDQT 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            Q Q +  N KL+ KEKALQNAE EVAALNRRIQLL EDL+RSEERL +AT KL+EAS AA
Sbjct  61   QGQETLVNGKLEGKEKALQNAESEVAALNRRIQLLGEDLDRSEERLASATAKLSEASAAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAE+GE+KIVELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTL  +LK AEARAE
Sbjct  181  ERAEAGEAKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL 281
            FAERSVQKLQKEVDRLEDELV+EKEKY+ I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVSEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 27. Allergen Name: Asc l 3.0101 Sequence ID: ACN32322

 Score = 310.9 bits 1335,  Expect = 3e-86
 Identities = 213/284 75%, Positives = 252/284 88%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKMQAMK+EKDNA+DRAD  E++ ++   + E+ EEE+R TQKKM Q EN+LD+A
Sbjct  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE LS AN+ L+EKEK +Q AE EVAALNRR+ LLEE+LER+EERL  AT KL EA++ A
Sbjct  61   QEDLSVANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATEKLEEATHTA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER+RKV+ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAE+GE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAE
Sbjct  181  ERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKE+YKSI++ELDQTF ELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 28. Allergen Name: Ani s 3 Sequence ID: Q9NAS5

 Score = 310.2 bits 1332,  Expect = 5e-86
 Identities = 212/284 74%, Positives = 251/284 88%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKMQAMK+EKDNA+DRAD  E++ ++   + E+ EEE+R TQKKM Q EN+LD+A
Sbjct  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE LS AN+ L+EKEK +Q AE EVAALNRR+ LLEE+LER+EERL  AT KL EA++ A
Sbjct  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER+RKV+ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKL MVEADLERAE
Sbjct  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAE+GE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAE
Sbjct  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKE+YKSI++ELDQTF ELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 29. Allergen Name: Copt f 7.0101 Sequence ID: AGM32377.1

 Score = 302.5 bits 1298,  Expect = 1e-83
 Identities = 212/251 84%, Positives = 227/251 90%, Gaps = 0/251 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKMQAMKLEKDN MDRA   EQQ ++ANLRAEK EEE R+ QKK+QQ+EN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNTMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             EQL   N KLDEK+KALQNAE EVAALNRRIQLLEEDLERSEERL TAT KLAEASQAA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE++ L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAESGESKIVELEEELRVVGNNLKSLEVSEEKAN REE YK+QIKTL  +LK AEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQK 251
            FAERSVQKLQK
Sbjct  241  FAERSVQKLQK 251

Sequence Alignment: 30. Allergen Name: Lep s 1 Sequence ID: CAC84590

 Score = 279.2 bits 1196,  Expect = 1e-76
 Identities = 193/284 67%, Positives = 235/284 82%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            M+AIKKKMQAMKLEKDNAMD+AD LE Q ++AN +A+K  EE++  +KK  QVE ++   
Sbjct  1    MEAIKKKMQAMKLEKDNAMDKADALEAQARDANRKADKILEEVQDLKKKPSQVETDFTTT 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            +E L+ AN  L++KEK L N E EVA+LNR++Q++EE+LERSEERL TA TKL EAS+AA
Sbjct  61   KENLATANKNLEDKEKTLTNTESEVASLNRKVQMIEENLERSEERLGTALTKLGEASHAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DE+ RM KVLENRS  DEERMD L NQLKEAR LAE+AD K DEV+RK+A VE DLE AE
Sbjct  121  DEASRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADGKSDEVSRKMAQVEDDLEVAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            +R +SG+SKI+ELEEEL+VVGN+LKSLEVSEEKANQR E YK QIKTL  KLK AEARAE
Sbjct  181  DRVKSGDSKIMELEEELKVVGNSLKSLEVSEEKANQRVEEYKRQIKTLTVKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            +AE+ V+KLQKEVDRLEDEL   K++Y+++ DE+DQTF+ELSGY
Sbjct  241  YAEKYVKKLQKEVDRLEDELGINKDRYRALADEMDQTFAELSGY 284

Sequence Alignment: 31. Allergen Name: Aed a 10.0201 Sequence ID: Q17H80

 Score = 266.4 bits 1140,  Expect = 8e-73
 Identities = 186/284 65%, Positives = 228/284 80%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKMQAMKLEKDNA D+ADT E Q KEANLRA+K  EE+    K++ QV  + ++ 
Sbjct  1    MDAIKKKMQAMKLEKDNAADKADTCENQAKEANLRADKIMEEVAELTKRLTQVTEDHEKF 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            +  L  AN  L+EKEK L + E  VAAL R++Q +EEDLE+SEER   A +KL EA+Q+A
Sbjct  61   KNTLEQANKDLEEKEKLLTSTEANVAALTRKVQQVEEDLEKSEERSGAALSKLLEATQSA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DE+ RM KVLENRS  DEERMD L NQLKEAR LAE+AD K DEV+RKLA VE +LE AE
Sbjct  121  DENNRMCKVLENRSQQDEERMDQLSNQLKEARMLAEDADGKSDEVSRKLAFVEDELEVAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            +R +SGE+KI+ELEEEL+VVGN+LKSLEVSE+KANQR E +K Q+K+L  KLK AE RAE
Sbjct  181  DRVKSGEAKIMELEEELKVVGNSLKSLEVSEDKANQRVEEFKRQLKSLTIKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AE++V+KLQKEVDRLED+L+NEK+KYK+I D+LD TF+EL+GY
Sbjct  241  NAEKNVKKLQKEVDRLEDKLMNEKDKYKAICDDLDSTFAELTGY 284

Sequence Alignment: 32. Allergen Name: Hel as 1 Sequence ID: CAB38044

 Score = 264.6 bits 1132,  Expect = 3e-72
 Identities = 180/284 63%, Positives = 228/284 80%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKM AMK+EK+NA+DRA+ +EQ+ ++      K EE++   QKK   +EN++D  
Sbjct  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             EQL  ANTKL+  EK     E E A L RRIQLLEEDLERSEERL +AT KL EAS+AA
Sbjct  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLE+RSL+D+ER+D LE QLKEA+++AE+A+RK+DE ARKLA+ E DLERAE
Sbjct  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
             R E+ E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ L  +LK AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+ +DELD TF+EL+GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284

Sequence Alignment: 33. Allergen Name: Hal l 1.0101 Sequence ID: APG42675

 Score = 262.1 bits 1121,  Expect = 2e-71
 Identities = 179/284 63%, Positives = 229/284 80%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKM AMK+EK+NA+DRA+  EQ+ ++   +  K EE++   QKK   +EN++D  
Sbjct  1    MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNV 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             EQL  A TKL+  EK +   E EV+   R+I LLEEDLER+EERL TAT +L EAS+AA
Sbjct  61   NEQLQEAMTKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLE+RSL+D+ER+D LE QLKEA+++AE+A+RKYDE ARKLA+ E DLERAE
Sbjct  121  DESERGRKVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
             R E+ E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ L  +LK AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+I+DELDQTF+EL+GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 34. Allergen Name: Hal d 1 Sequence ID: AAG08987

 Score = 258.2 bits 1104,  Expect = 2e-70
 Identities = 176/284 61%, Positives = 227/284 79%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKM AMK+EK+NA+DRA+  EQ+ ++   +  K EE++   QKK   +EN++D  
Sbjct  1    MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNV 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             EQL  A  KL+  EK +   E EV+   R+I LLEEDLER+EERL TAT +L EAS+AA
Sbjct  61   NEQLQEAMAKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER  +VLE+RSL+D+ER+D LE QLKEA+++AE+A+RKYDE ARKLA+ E DLERAE
Sbjct  121  DESERGARVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
             R E+ E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ L  +LK AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+I+DELDQTF+EL+GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 35. Allergen Name: Sac g 1.0101 Sequence ID: AVD53650

 Score = 254.1 bits 1086,  Expect = 4e-69
 Identities = 172/284 60%, Positives = 221/284 77%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MD+IKKKM AMK+EK+NA DRA+ LEQQ ++   +  K EE++   QKK   +ENE+D  
Sbjct  1    MDSIKKKMIAMKMEKENAQDRAEQLEQQLRDTEEQKAKIEEDLTTLQKKHSNLENEFDIV 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E+      K +E EK    +E E+ +LNRRIQLLEED+ERSEERL TAT KL EAS+AA
Sbjct  61   NEKYQDCQAKYEEAEKKASESEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEASKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLEN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DLERAE
Sbjct  121  DESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
             R E+ E+K+++LEE+L VVGNN+K+L+V  ++A+QRE++Y+E I+ L  +LK AE RA 
Sbjct  181  ARLEAAEAKVIDLEEQLSVVGNNIKTLQVQNDQASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+I+DELDQTF+EL+GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 284

Sequence Alignment: 36. Allergen Name: Mim n 1 Sequence ID: AAG08989

 Score = 242.3 bits 1034,  Expect = 2e-65
 Identities = 166/284 58%, Positives = 212/284 74%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKMQAMK++++NA D A+ +EQ+ K+      K EEE    QKK+   EN  D  
Sbjct  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             EQL  ANTKL+  EK +   E +V  L RR+ LLEED ERSEE+LN+ T KL EAS+AA
Sbjct  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLE RS S EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
             R E+ ++K++ELEEEL VVG N+K+L+V  ++A+QRE++Y+E I+ L   LK AE RA 
Sbjct  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AER V KLQKEVDRLEDEL+ EKE+YK+I+D+LDQTF+E++GY
Sbjct  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284

Sequence Alignment: 37. Allergen Name: Per v 1 Sequence ID: AAG08988

 Score = 237.3 bits 1012,  Expect = 5e-64
 Identities = 161/284 56%, Positives = 214/284 75%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKM AMK+EK NA+DRA+ LEQ+ +E      K E++  +  KK  Q EN+ D  
Sbjct  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
              QL     K +  EK +Q  E E+ +L R+I LLEE + ++EER+ TA+ KL EAS+AA
Sbjct  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLEN +  ++ER+D LE QL EA+++AEEAD+KY+E ARKLA+ E DLERAE
Sbjct  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
             R E+ E+K+++LEE+L VVG N+K+L+V  ++A+QRE++Y+E I+ L N+LK AE RA 
Sbjct  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+I+DELD TF+EL+GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284

Sequence Alignment: 38. Allergen Name: Pan h 4.0201 Sequence ID: XP_026775428

 Score = 236.6 bits 1009,  Expect = 8e-64
 Identities = 162/282 57%, Positives = 217/282 76%, Gaps = 0/282 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKMQ +KL+K+NA+DRA+  E   K A  R+++ E+++ A QKK++  E+ELD+ 
Sbjct  1    MDAIKKKMQMLKLDKENALDRAEQAESDKKAAEDRSKQLEDDLVALQKKLKGTEDELDKY 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E L  A  KL+  EK   +AE +VA+LNRRIQL+EE+L+R++ERL TA  KL EA +AA
Sbjct  61   SEALKDAQEKLELSEKKAADAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER  KV+ENR+L DEE+M+  E QLKEA+ +AEEADRKY+EVARKL +VE +LER E
Sbjct  121  DESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAE  E K  ELEEEL+ V N LKSLE   EK +Q+E+ Y+E+IK L +KLK AE RAE
Sbjct  181  ERAELSEGKCAELEEELKTVTNTLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS 282
            FAER+V KL+K +D LEDEL ++K KYK+I++ELD+ +++++
Sbjct  241  FAERTVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMT 282

Sequence Alignment: 39. Allergen Name: Sal s 4.0101 Sequence ID: NP_001117128

 Score = 236.1 bits 1007,  Expect = 1e-63
 Identities = 162/282 57%, Positives = 217/282 76%, Gaps = 0/282 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            MDAIKKKMQ +KL+K+NA+DRA+  E   K A  ++++ E+++ A QKK++  E+ELD+ 
Sbjct  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E L  A  KL+  EK   +AE +VA+LNRRIQL+EE+L+R++ERL TA TKL EA +AA
Sbjct  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER  KV+ENR+  DEE+M+  + QLKEA+ +AEEADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK +Q+E+ Y+E+IK L +KLK AE RAE
Sbjct  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS 282
            FAERSV KL+K +D LEDEL  +K KYK+I++ELD  +++++
Sbjct  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282

Sequence Alignment: 40. Allergen Name: Cra g 1 Sequence ID: AAK96889

 Score = 220.7 bits 939,  Expect = 4e-59
 Identities = 149/228 65%, Positives = 186/228 81%, Gaps = 0/228 0%
Query  57   LDQAQEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEA 116
            +D   E+     TK++E EK    AE E+ +LNRRIQLLEED+ERSEERL TAT KL EA
Sbjct  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
Query  117  SQAADESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADL 176
            S+AADESER RKVLEN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DL
Sbjct  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
Query  177  ERAEERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAE 236
            ERAE R E+ E+K++ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ L  +LK AE
Sbjct  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
Query  237  ARAEFAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK+I+DELDQTF+EL+GY
Sbjct  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233

Sequence Alignment: 41. Allergen Name: Pan h 4.0101 Sequence ID: XP_026781482

 Score = 218.3 bits 929,  Expect = 2e-58
 Identities = 152/282 53%, Positives = 207/282 73%, Gaps = 0/282 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
            M+AIKKKMQ +K +K+NA DRA+  E   K +  + ++ E+E+   QKK++  E+E+D+ 
Sbjct  1    MEAIKKKMQMLKGDKENAFDRAEQAELDKKVSEDKCKQLEDELLGLQKKLKGTEDEVDKY 60
Query  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E L  A  KL+  EK   +AEGEVAALNRRIQL+EE+L+R++ RL TA  KL EA + A
Sbjct  61   SEALKDAQEKLELSEKKATDAEGEVAALNRRIQLIEEELDRAQGRLGTALQKLEEAEKQA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER  KV+ENR++ DEE+M+  E QLKEA+ +AE++DRKYDEVARKL ++E +LERAE
Sbjct  121  DESERGMKVIENRAMKDEEKMEIQELQLKEAKQIAEDSDRKYDEVARKLVVIEGELERAE 180
Query  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
            ERAE  E K  +LEEEL+ V N LKSLE   EK + +E+ Y+E+I  L  KLK AE RAE
Sbjct  181  ERAEVSELKSGDLEEELKNVTNTLKSLEAQAEKYSDKEDKYEEEINLLNEKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS 282
            FAE++V KL+K +D LEDEL N+K K K+I +ELD  +++++
Sbjct  241  FAEKTVSKLEKTIDDLEDELYNQKLKVKAICEELDNALNDMT 282

Sequence Alignment: 42. Allergen Name: Der p 11 Sequence ID: AAO73464

 Score = 59.3 bits 232,  Expect = 6e-10
 Identities = 62/256 24%, Positives = 128/256 50%, Gaps = 8/256 3%
Query  6    KKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQAQEQLS 65
            K+++ +KL+ DNA      + QQ ++   R E+ E +  + +   + +E EL+  + QL 
Sbjct  213  KEVHEVKLQLDNANHLKQQIAQQLEDTRHRLEEEERKRSSLENHAHTLEVELESLKVQLD 272
Query  66   AANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESER 125
              +    E E+ L  A G+ A+   +    E +L+   + +     K+A   Q   E E 
Sbjct  273  DESEARLELERQLTKANGDAASWKSK---YEAELQAHADEVEELRRKMA---QKISEYEE 326
Query  126  MRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAES 185
              + L N+  S E++   L+++++      E+A     ++ +++A +E      +++ E 
Sbjct  327  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKAAAHAQQLEKRVAQLEKINLDLKDKLEE 386
Query  186  GESKIVELEEELRVVGNNLKSLEVSEEKA-NQREETYKEQIKTLANKLKAAEARAEFAER 244
                + + ++ELR+    L+ L+   EK  +QR++  +E  K L + L  A+++   A R
Sbjct  387  VTMLMEQAQKELRIKIGELQKLQHEYEKVRDQRDQLAREN-KKLTDDLAEAKSQLNDAHR 445
Query  245  SVQKLQKEVDRLEDELVNEKEKYK 268
             +++ + E+ RLE+E       YK
Sbjct  446  RIHEQEIEIKRLENERDELSAAYK 469
 Score = 47.4 bits 180,  Expect = 2e-06
 Identities = 71/253 28%, Positives = 135/253 53%, Gaps = 29/253 11%
Query  4    IKKKMQAMKLEKDNAMDRADT----LEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQ 59
            +KKK QA   E + ++D A+     L++  K+  L+  + +      ++++QQ  ++L  
Sbjct  539  LKKKYQAQITELELSLDAANKANIDLQKTIKKQALQITELQAHYDEVHRQLQQAVDQLGV 598
Query  60   AQEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEA-SQ 118
             Q +  A   +L+E   AL+ A     A  +  QL EE + R  E L T    LA A S+
Sbjct  599  TQRRCQALQAELEEMRIALEQAS---RAKRQAEQLHEEAVVRVNE-LTTINVNLASAKSK 654
Query  119  AADESERMR----KVLENRSLSDEERMDALENQLKEAR-FLAEEADR--KYDEVARKLAM 171
               E   ++    +V +   +SDE R+  L  +LK  + +L EE +R  K + V + L  
Sbjct  655  LESEFSALQADYDEVHKELRISDE-RVQKLTIELKSTKDLLIEEQERLVKLETVKKSLEQ 713
Query  172  ----VEADLERAEERAESGESKIV-ELEEELRVVGNNLKSLEVSEEKANQREETYKEQIK 226
                +   +E  E  A +G  +++ +LE  +R V      +EV EE+  +R    ++ ++
Sbjct  714  EVRTLHVRIEEVEANALAGGKRVIAKLESRIRDV-----EIEVEEER--RRHAETEKMLR 766
Query  227  TLANKLKAAEARAEFAERSVQKLQKEVDRLEDELVNEKEKYK 268
               +++K    + E   + +Q LQ+  D+L +++   K + +
Sbjct  767  KKDHRVKELLLQNEEDHKQIQLLQEMTDKLNEKVKVYKRQMQ 808

Sequence Alignment: 43. Allergen Name: Blo t 11 Sequence ID: AAM83103

 Score = 53.8 bits 208,  Expect = 3e-08
 Identities = 59/255 23%, Positives = 122/255 47%, Gaps = 10/255 3%
Query  6    KKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQAQEQLS 65
            K+++  K+  DNA      + QQ ++   R E  E +  + +   + +E EL+  + QL 
Sbjct  213  KEVHEYKISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLE 272
Query  66   AANTKLDEKEKALQNAEGEVAALNRRIQL-LEEDLERSEERLNTATTKLAEASQAADESE 124
              +    E E+ L  A G+ A+   + +  L+  ++  EE       K++E  +  +   
Sbjct  273  EESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALL 332
Query  125  RMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAE 184
                 LE +    +  ++ L   L++A   A+  +++  ++ +    +  DL+   E   
Sbjct  333  NKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEK----INLDLKSKLEEV- 387
Query  185  SGESKIVE-LEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAEFAE 243
               S ++E  +++LRV   +L+ L+   EK   ++E    + K LA+ L  A+++   A 
Sbjct  388  ---SMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAH 444
Query  244  RSVQKLQKEVDRLEDELVNEKEKYK 268
            R +++ + E+ RLE+E       YK
Sbjct  445  RRIHEQEIEIKRLENEREELAAAYK 469
 Score = 45.6 bits 172,  Expect = 8e-06
 Identities = 62/225 27%, Positives = 107/225 47%, Gaps = 25/225 11%
Query  22   ADTLEQQNKEANLRAEKTEEEIRAT-QKKMQQVENELD----QAQEQLSAANTKLDEKEK 76
            A+TL +Q +  N R      + R   +K++ Q E E++    Q Q ++   N +L E E 
Sbjct  471  AETLRKQEEAKNQRLTAELAQTRHDYEKRLAQKEEEIEALRKQYQIEIEQLNMRLAEAEA 530
Query  77   ALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVLENRSLS 136
             L+    EVA L ++ Q    +LE S +  N A   L +  +        ++ L+   L 
Sbjct  531  KLKT---EVARLKKKYQAQITELELSLDAANKANIDLQKTIK--------KQALQITGL- 578
Query  137  DEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAESGESKIVELEEE 196
             +   D +  QL++A        R+   +  +L  +  +LE+A     + E    ++ EE
Sbjct  579  -QAHYDEVHRQLQQAVDQLGVTQRRCQALTAELEEMRVNLEQALRAKRAAE----QMHEE 633
Query  197  LRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAEFAERSVQKLQKEVDRL 256
              V  N L ++ V+   A  + ET   +   L N           ++  VQKL  EV   
Sbjct  634  AVVRVNELTTINVNLASAKSKLET---EFSALQNDYDEVHKELRISDERVQKLTIEVKST 690
Query  257  EDELVNEKEK 266
            +D L +E E+
Sbjct  691  KDLLESETER 700

Sequence Alignment: 44. Allergen Name: Rap v 2.0101 Sequence ID: QPB41107

 Score = 53.3 bits 206,  Expect = 4e-08
 Identities = 82/265 30%, Positives = 155/265 58%, Gaps = 68/265 25%
Query  4    IKKKMQAMKLEKDNAMDRADTLEQQNK-------EANLRAEKTEEEIRATQKKMQQVENE 56
            +++ +Q +++      +R D L+++NK       EANL  +    E+      ++Q+ ++
Sbjct  397  LEQDVQKLRVSNAELTERNDNLQRENKHLSDQLREANLALKDANREL----ADLRQLRSQ 452
Query  57   LDQAQEQLSAANTKLDEKEKALQNAEGEVA----ALNR-------RIQLLEEDLE---RS 102
            L+  ++ L+AA   L + E+AL++AE ++A    ALN+       R++  +E++E   RS
Sbjct  453  LEAERDSLAAA---LKDTEEALRDAEAKLASAQAALNQLKIDMENRLREKDEEIENVRRS 509
Query  103  EER-LNTATTKLAEA-SQAADESERMRKVLE-------------NRSLSD--------EE 139
              R +      L E  ++   E  RM+K +E             NR+ S+        ++
Sbjct  510  SARAIEELQRTLVEVETRYKTEISRMKKKFESDIRELEAALDNANRANSEYLKQIKSLQQ 569
Query  140  RMDALENQLKEARFLAEE-------ADRKYDEVARKLAMVEADLERAEERAESGESKIVE 192
            R+  LE  L+E R ++++       A+RK   +A++L    A LE AE   ++ E+++ +
Sbjct  570  RVKELETLLEEERRVSDDLRNQLGVAERKRVALAQELEDARALLEGAERARKNAETELAD 629
Query  193  LEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAEFAERSVQKLQKE 252
                L  +   + SL   + +        +  +    N  + AE RAE       +L  E
Sbjct  630  TSTRLSEITLQVTSLTNDKRRLEADLSAMQSDLDDAINNQRGAEERAE-------RLAAE 682
Query  253  VDRLEDELVNEKEKYK---SITDELDQTFSELS 282
              RL DEL  E+E YK   S+  +L+    E++
Sbjct  683  NGRLADELRQEQENYKNAESLRKQLEVEIREIT 715

Sequence Alignment: 45. Allergen Name: Der f 11.0101 Sequence ID: AAK39511

 Score = 43.3 bits 162,  Expect = 3e-05
 Identities = 64/256 25%, Positives = 128/256 50%, Gaps = 8/256 3%
Query  6    KKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQAQEQLS 65
            K+++ +KL+ DNA      + QQ ++   R E+ E +  + +   + +E EL+  + QL 
Sbjct  127  KEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLD 186
Query  66   AANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESER 125
              +    E E+ L  A G+ A+   +    E +L+   + +     K+A   Q   E E 
Sbjct  187  EESEARLELERQLTKANGDAASWKSK---YEAELQAHADEVEELRRKMA---QKISEYEE 240
Query  126  MRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAES 185
              + L N+  S E++   L+++++      E+A R   ++ +++A +E      + + E 
Sbjct  241  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE 300
Query  186  GESKIVELEEELRVVGNNLKSLEVSEEKA-NQREETYKEQIKTLANKLKAAEARAEFAER 244
                + + ++ELRV    L+ L+   EK  +QR++  +E  K L + L  A+++   A R
Sbjct  301  VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLAREN-KKLTDDLAEAKSQLNDAHR 359
Query  245  SVQKLQKEVDRLEDELVNEKEKYK 268
             +++ + E+ RLE+E       YK
Sbjct  360  RIHEQEIEIKRLENERDELSAAYK 383
 Score = 43.3 bits 162,  Expect = 3e-05
 Identities = 68/250 27%, Positives = 138/250 55%, Gaps = 32/250 12%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKE-ANLR----AEKTEEEIR--ATQKKMQQV 53
            ++A++K+ Q +++E+ N M  A+   +   E A L+    A+ TE E+   A  K    +
Sbjct  421  IEALRKQYQ-IEIEQLN-MRLAEAEAKLKTEIARLKKKYQAQITELELSLDAANKANIDL 478
Query  54   ENELDQAQEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKL 113
            +  + +   Q++      DE  + LQ A  ++    RR Q L+ +LE     L  A    
Sbjct  479  QKTIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEMRIALEQANRAK 538
Query  114  AEASQAADESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVE 173
             +A Q  +E+  + +V E  +++    + + +++L E+ F A +AD  YDEV ++L + +
Sbjct  539  RQAEQLHEEA--VVRVNELTTINVN--LASAKSKL-ESEFSALQAD--YDEVHKELRISD 591
Query  174  ADLERAEERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLK 233
              +++     +S +  ++E +E L  +    KSLE              ++++TL  +++
Sbjct  592  ERVQKLTIELKSTKDLLIEEQERLVKLETVKKSLE--------------QEVRTLHVRIE 637
Query  234  AAEARA-EFAERSVQKLQKEVDRLEDELVNEKEKYKSITDEL 274
              EA A    +R + KL+  +  +E E V E+ +  + TD++
Sbjct  638  EVEANALAGGKRVIAKLESRIRDVEIE-VEEERRRHAETDKM 678

Sequence Alignment: 46. Allergen Name: Ani s 2 Sequence ID: AAF72796

 Score = 42.8 bits 160,  Expect = 5e-05
 Identities = 69/258 26%, Positives = 131/258 50%, Gaps = 23/258 8%
Query  4    IKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQAQEQ 63
            +K ++  + +E + A   A     + ++     EK  E+  A  ++ ++++++L +A E 
Sbjct  382  MKSRIDELLVELEAAQREARAALAELQKMKQLYEKAVEQKEALARENKKLQDDLHEANEA 441
Query  64   LSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADES 123
            L+ AN KL E +  L+NA      L   I+ L+  L+ SE     A    A A +A  E 
Sbjct  442  LADANRKLHELD--LENAR-----LAGEIRDLQVALKESEAARRDAE---ARAQRALAEL 491
Query  124  ERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERA 183
            +++R  +E R    EE M+AL    K  +F   E DR    +A   A ++A++ R  ++ 
Sbjct  492  QQVRIEMERRLQEKEEEMEALR---KSMQF---EIDRLTAALADAEARMKAEIARLRKKY 545
Query  184  ESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQ--IKTLANKLKAAEARAEF 241
            ++   +I ELE  + V   N  +LE  +    Q E+  + Q  ++    +L+    +  +
Sbjct  546  QA---EIAELE--MTVDNLNRANLEAQKTIKKQSEQIIQLQANLEDTQRQLQQTLDQYAL 600
Query  242  AERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS 282
            A+R +  L  E++  +  L N     K    +L++    +S
Sbjct  601  AQRKISALSAELEECKTALDNAIRARKQAEADLEEAHVRIS 641

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.