The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV
NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA
DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE
TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT
EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY
Sequence Info Allergen Name Length Opt Bits Score E Value
AAG08989 Mim n 1 284 1721 398.9 1.1e-112
APG42675 Hal l 1.0101 284 1290 300.6 4.2e-83
AVD53650 Sac g 1.0101 284 1278 297.9 2.8e-82
CAB38044 Hel as 1 284 1274 297.0 5.2e-82
AAG08987 Hal d 1 284 1273 296.8 6.1e-82
AAG08988 Per v 1 284 1223 285.4 1.6e-78
BAA04557 Der f 10.0101 299 1043 244.3 3.9e-66
AAK96889 Cra g 1 233 1039 243.5 5.4e-66
AEX31649 Cho a 10.0101 284 1035 242.5 1.3e-65
ABU97466 Blo t 10.0101 284 1035 242.5 1.3e-65
A7L5V2 Scy p 1.0101 284 1034 242.3 1.5e-65
AAC48288 Hom a 1.0102 284 1033 242.0 1.8e-65
D3XNR9 Mac r 1.0101 284 1033 242.0 1.8e-65
O44119 Hom a 1.0101 284 1030 241.4 2.9e-65
CBY17558 Pan b 1.0101 284 1030 241.4 2.9e-65
C0LU07 Pro c 1.0101 284 1027 240.7 4.6e-65
AAT40866 Tyr p 10.0101 284 1026 240.5 5.4e-65
M4M2H6 Mel l 1.0101 284 1025 240.2 6.4e-65
11893851 Pen a 1 284 1024 240.0 7.5e-65
EU410072 Lit v 1.0101 284 1024 240.0 7.5e-65
AAX37288 Pen m 1 284 1024 240.0 7.5e-65
M1H607 Por p 1.0101 284 1023 239.8 8.7e-65
O18416 Der p 10 284 1016 238.2 2.6e-64
ACN32322 Asc l 3.0101 287 1016 238.2 2.7e-64
Q9NFZ4 Lep d 10 284 1015 237.9 3.1e-64
Q9NAS5 Ani s 3 284 1001 234.8 2.8e-63
NP_001103782 Bomb m 3.0101 285 993 232.9 1e-62
Q9UB83 Per a 7 284 982 230.4 5.7e-62
Q17H75 Aed a 10.0101 285 982 230.4 5.7e-62
O61379 Pan s 1 274 972 228.2 2.6e-61
AAD19606 Per a 7.0102 284 972 228.1 2.8e-61
AAF72534 Bla g 7.0101 284 967 227.0 6.1e-61
Q25456 Met e 1 274 963 226.1 1.1e-60
CAA09938 Chi k 10 285 950 223.1 9e-60
Q9N2R3 Cha f 1 264 925 217.5 4.2e-58
CAC84590 Lep s 1 284 900 211.7 2.4e-56
Q17H80 Aed a 10.0201 284 876 206.3 1.1e-54
NP_001117128 Sal s 4.0101 284 860 202.6 1.3e-53
XP_026775428 Pan h 4.0201 284 854 201.2 3.4e-53
AGM32377.1 Copt f 7.0101 256 819 193.3 7.6e-51
XP_026781482 Pan h 4.0101 284 787 186.0 1.4e-48
QPB41107 Rap v 2.0101 859 258 65.2 9.5e-12
AAF72796 Ani s 2 869 248 62.9 4.7e-11
AAO73464 Der p 11 875 225 57.7 1.8e-09
AAK39511 Der f 11.0101 692 222 57.0 2.2e-09
AAM83103 Blo t 11 875 165 44.0 2.3e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Mim n 1 Sequence ID: AAG08989

 Score = 398.9 bits 1721,  Expect = 1e-112
 Identities = 284/284 100%, Positives = 284/284 100%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV
Sbjct  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
            NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA
Sbjct  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE
Sbjct  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
            TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT
Sbjct  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
            EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY
Sbjct  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284

Sequence Alignment: 2. Allergen Name: Hal l 1.0101 Sequence ID: APG42675

 Score = 300.6 bits 1290,  Expect = 4e-83
 Identities = 207/284 72%, Positives = 245/284 86%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKM AMK+++ENA D AEQ EQKL+DTE  KAK+EE++N LQKK    EN++D V
Sbjct  1    MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNV 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
            NEQLQEA TKLE SEK++T++E +V G  R++TLLEED ER+EE+L + TE+LEEASKAA
Sbjct  61   NEQLQEAMTKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RKVLE RS + +ERID+LE QL+ AK +A DA+ K+DEAARKLAITEVDLERAE
Sbjct  121  DESERGRKVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             RLEAA+AK+LELEEEL VVG N+K+L++   +ASQREDSYEETIRDLT+ LKDAENRAT
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
            EAER V KLQKEVDRLEDELLAEKE+YKAISD+LDQTFAE+AGY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 3. Allergen Name: Sac g 1.0101 Sequence ID: AVD53650

 Score = 297.9 bits 1278,  Expect = 3e-82
 Identities = 206/284 72%, Positives = 242/284 85%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MD+IKKKM AMK+++ENAQD AEQ+EQ+L+DTE  KAK+EE++  LQKK +  EN +D V
Sbjct  1    MDSIKKKMIAMKMEKENAQDRAEQLEQQLRDTEEQKAKIEEDLTTLQKKHSNLENEFDIV 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
            NE+ Q+   K E +EK+ ++ E ++  L RR+ LLEED ERSEE+L + TEKLEEASKAA
Sbjct  61   NEKYQDCQAKYEEAEKKASESEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEASKAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESERNRKVLE  +N+ EER D LEKQL  AK +A +AD K+DEAARKLAITEVDLERAE
Sbjct  121  DESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             RLEAA+AKV++LEE+L+VVG NIKTLQVQNDQASQREDSYEETIRDLT+ LKDAENRAT
Sbjct  181  ARLEAAEAKVIDLEEQLSVVGNNIKTLQVQNDQASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
            EAER V KLQKEVDRLEDELLAEKERYKAISD+LDQTFAE+AGY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 284

Sequence Alignment: 4. Allergen Name: Hel as 1 Sequence ID: CAB38044

 Score = 297.0 bits 1274,  Expect = 5e-82
 Identities = 205/284 72%, Positives = 242/284 85%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKM AMK+++ENA D AEQ+EQKL+D E  K K+EE++N LQKK+   EN++D++
Sbjct  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
            NEQL +ANTKLE SEK+  ++ES+  GLQRR+ LLEED ERSEE+L S TEKLEEASKAA
Sbjct  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RKVLE RS + +ER+D LE QL+ AK +A DA+ KFDEAARKLAITEVDLERAE
Sbjct  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             RLEAA+AK+LELEEEL VVG N+K+L++   +ASQREDSYEETIRDLT+ LKDAENRA+
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
            EAER V KLQKEVDRLEDELLAEKERYKA SD+LD TFAE+AGY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284

Sequence Alignment: 5. Allergen Name: Hal d 1 Sequence ID: AAG08987

 Score = 296.8 bits 1273,  Expect = 6e-82
 Identities = 204/284 71%, Positives = 243/284 85%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKM AMK+++ENA D AEQ EQKL+DTE  KAK+EE++N LQKK    EN++D V
Sbjct  1    MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNV 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
            NEQLQEA  KLE SEK++T++E +V G  R++TLLEED ER+EE+L + TE+LEEASKAA
Sbjct  61   NEQLQEAMAKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER  +VLE RS + +ERID+LE QL+ AK +A DA+ K+DEAARKLAITEVDLERAE
Sbjct  121  DESERGARVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             RLEAA+AK+LELEEEL VVG N+K+L++   +ASQREDSYEETIRDLT+ LKDAENRAT
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
            EAER V KLQKEVDRLEDELLAEKE+YKAISD+LDQTFAE+AGY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 6. Allergen Name: Per v 1 Sequence ID: AAG08988

 Score = 285.4 bits 1223,  Expect = 2e-78
 Identities = 198/284 69%, Positives = 239/284 84%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKM AMK++++NA D AEQ+EQKL++TE AKAK+E+++N L KK   TEN+YD  
Sbjct  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
            N QLQ+   K E +EKQI + E ++  L R+++LLEE   ++EE++ + + KLEEASKAA
Sbjct  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESERNRKVLE  ++  +ERID+LEKQL  AK +A +AD K++EAARKLAITEVDLERAE
Sbjct  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             RLEAA+AKV++LEE+LTVVGANIKTLQVQNDQASQREDSYEETIRDLT  LKDAENRAT
Sbjct  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
            EAER V KLQKEVDRLEDELL EKE+YKAISD+LD TFAE+AGY
Sbjct  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284

Sequence Alignment: 7. Allergen Name: Der f 10.0101 Sequence ID: BAA04557

 Score = 244.3 bits 1043,  Expect = 4e-66
 Identities = 171/284 60%, Positives = 211/284 74%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            M+AIKKKMQAMK++++NA D AE  EQK +D      K EEE   LQKK+   EN  D V
Sbjct  16   MEAIKKKMQAMKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 75
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             EQL  ANTKLE  EK +   E DV  L RR+ L+EED ERSEE+L   T KLEEAS++A
Sbjct  76   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSA 135
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RK+LE RS + EER+D LE QL+ A+ +A DAD K+DE ARKLA+ E DLERAE
Sbjct  136  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 195
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E  ++K++ELEEEL VVG N+K+L+V  ++A QRE++YE+ IR +T  LK+AE RA 
Sbjct  196  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 255
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
             AER V KLQKEVDRLEDEL+ EKE+YK+ISD+LDQTFAE+ GY
Sbjct  256  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 299

Sequence Alignment: 8. Allergen Name: Cra g 1 Sequence ID: AAK96889

 Score = 243.5 bits 1039,  Expect = 5e-66
 Identities = 169/228 74%, Positives = 194/228 85%, Gaps = 0/228 0%
Query  57   YDTVNEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEA 116
            +DTVNE+ QE  TK+E +EK  ++ E ++  L RR+ LLEED ERSEE+L + TEKLEEA
Sbjct  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
Query  117  SKAADESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDL 176
            SKAADESERNRKVLE  +N+ EER D LEKQL  AK +A +AD K+DEAARKLAITEVDL
Sbjct  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
Query  177  ERAETRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAE 236
            ERAE RLEAA+AKVLELEEEL VVG N+K+L++   +ASQREDSYEETIRDLT+ LKDAE
Sbjct  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
Query  237  NRATEAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
            NRATEAER V KLQKEVDRLEDELLAEKERYKAISD+LDQTFAE+AGY
Sbjct  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233

Sequence Alignment: 9. Allergen Name: Cho a 10.0101 Sequence ID: AEX31649

 Score = 242.5 bits 1035,  Expect = 1e-65
 Identities = 170/284 59%, Positives = 210/284 73%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            M+AIKKKMQAMK++++NA D AE  EQK +D      K EEE   LQKK+   EN  D V
Sbjct  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             E + +ANTKLE  EK +   E DV  L RR+ L+EED ERSEE+L   T KLEEAS AA
Sbjct  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RK+LE RS + EER+D LE QL+ A+ +A DAD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E  ++K++ELEEEL VVG N+K+L+V  ++A QRE++YE+ IR +T  LK+AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
             AER V KLQKEVDRLEDEL+ EKE+YK+ISD+LDQTFAE+ GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 10. Allergen Name: Blo t 10.0101 Sequence ID: ABU97466

 Score = 242.5 bits 1035,  Expect = 1e-65
 Identities = 170/284 59%, Positives = 209/284 73%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            M+AIKKKMQAMK++++NA D AE  EQK +D      K EEE   LQKK+   EN  D V
Sbjct  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             E L +ANTKLE  EK +   E DV  L RR+ L+EED ERSEE+L   T KLEEAS +A
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RK+LE RS + EER+D LE QL+ A+ +A DAD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E  + K++ELEEEL VVG N+K+L+V  ++A QRE++YE+ IR +T  LK+AE RA 
Sbjct  181  ERAETGETKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRMMTGKLKEAEARAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
             AER V KLQKEVDRLEDEL+ EKE+YK+ISD+LDQTFAE+ GY
Sbjct  241  FAERSVRKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 11. Allergen Name: Scy p 1.0101 Sequence ID: A7L5V2

 Score = 242.3 bits 1034,  Expect = 2e-65
 Identities = 166/284 58%, Positives = 212/284 74%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKMQAMK++++NA D A+ +EQ+ K+      K EEE    QKK+   EN  D  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             EQL  ANTKL+  EK +   E +V  L RR+ LLEED ERSEE+LN+ T KL EAS+AA
Sbjct  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RKVLE RS S EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E+ ++K++ELEEEL VVG N+K+L+V  ++A+QRE++Y+E I+ L   LK AE RA 
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
             AER V KLQKEVDRLEDEL+ EKE+YK+I+D+LDQTF+E++GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 12. Allergen Name: Hom a 1.0102 Sequence ID: AAC48288

 Score = 242.0 bits 1033,  Expect = 2e-65
 Identities = 165/284 58%, Positives = 216/284 76%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKMQAMK++++NA D A+ +EQ+ K+      K EEE + LQK++   EN+ D V
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             E L +ANT+LE  +K ++  E +V  L RR+ LLEED ERSEE+LN+ T KL EAS+AA
Sbjct  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RKVLE RS S EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E  ++K++ELEEEL VVG N+K+L+V  ++A+QRE++Y+E I+ L   LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
             AER V KLQKEVDRLEDEL+ EKE+YK+I+D+LDQTF+E++GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 13. Allergen Name: Mac r 1.0101 Sequence ID: D3XNR9

 Score = 242.0 bits 1033,  Expect = 2e-65
 Identities = 165/284 58%, Positives = 216/284 76%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKMQAMK++++NA D A+ +EQ+ K+      K EEE + LQK++   EN+ D+V
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDSV 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             E L +AN  LE  +K ++  E +V  L RR+ LLEED ERSEE+LN+ T KL EAS+AA
Sbjct  61   QEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RKVLE RS S EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E  ++K++ELEEEL VVG N+K+L+V  ++A+QRE++Y+E I+ LT  LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
             AER V KLQKEVDRLEDEL+ EKE+YK+I+D+LDQTF+E++GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 14. Allergen Name: Hom a 1.0101 Sequence ID: O44119

 Score = 241.4 bits 1030,  Expect = 3e-65
 Identities = 167/284 58%, Positives = 212/284 74%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKMQAMK++++NA D A+ +EQ+ K+      K EEE    +KK+   EN  D V
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKTEEEIRITHKKMQQVENELDQV 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             EQL  ANTKLE  EK +   E +V  L RR+ LLEED ERSEE+LN+ T KL EAS+AA
Sbjct  61   QEQLSLANTKLEEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RKVLE RS S EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E  ++K++ELEEEL VVG N+K+L+V  ++A+QRE++Y+E I+ L   LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
             AER V KLQKEVDRLEDEL+ EKE+YK+I+D+LDQTF+E++GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 15. Allergen Name: Pan b 1.0101 Sequence ID: CBY17558

 Score = 241.4 bits 1030,  Expect = 3e-65
 Identities = 167/284 58%, Positives = 215/284 75%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKMQAMK++++NA D A+ +EQ+ K+      K EEE   LQKKL   EN+ D+V
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVFGLQKKLQQLENDLDSV 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             E L +AN  LE  +K ++  E +V  L RR+ LLEED ERSEE+LN+ T KL EAS+AA
Sbjct  61   QEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RKVLE RS S EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E  ++K++ELEEEL VVG N+K+L+V  ++A+QRE++Y+E I+ LT  LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
             AER V KLQKEVDRLEDEL+ EKE+YK+I+D+LDQTF+E++GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 16. Allergen Name: Pro c 1.0101 Sequence ID: C0LU07

 Score = 240.7 bits 1027,  Expect = 5e-65
 Identities = 165/284 58%, Positives = 214/284 75%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKMQA K++++NA D A+ +EQ+ K+      K EEE + LQK++   EN+ D V
Sbjct  1    MDAIKKKMQATKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQHLENDLDQV 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             E L +ANT+LE  +K I+  E +V  L RR+ LLEED ERSEE+LN+ T KL EAS+AA
Sbjct  61   QESLLKANTQLEEKDKAISNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RKVLE RS S EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E  ++K++ELEEEL VVG N+K+L+V  ++A+QRE++Y+E I+ L   LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
             AER V KLQKEVDRLEDEL+ EKE+YK+I+D+LDQTF+E+ GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELTGY 284

Sequence Alignment: 17. Allergen Name: Tyr p 10.0101 Sequence ID: AAT40866

 Score = 240.5 bits 1026,  Expect = 5e-65
 Identities = 168/284 59%, Positives = 208/284 73%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIK KMQAMK++ +NA D AE  EQK +D      K EEE   LQKK+   EN  D V
Sbjct  1    MDAIKNKMQAMKLEEDNAIDRAEIAEQKARDANLKSEKTEEEVRALQKKIQQIENELDQV 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             E L +A TKLE  EK +   E+DV  L RR+ L+EED ERSEE+L   T KLEEAS +A
Sbjct  61   QENLTQATTKLEEKEKALQTAEADVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RK+LE RS + EER+D LE QL+ A+ +A DAD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLESQLKEARLMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E  ++K++ELEEEL VVG N+K+L+V  ++A QRE++YE+ IR +T  LK+AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTSKLKEAEARAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
             AER V KLQKEVDRLEDEL+ EKE+Y++ISD+LDQTFAE+ GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYESISDELDQTFAELTGY 284

Sequence Alignment: 18. Allergen Name: Mel l 1.0101 Sequence ID: M4M2H6

 Score = 240.2 bits 1025,  Expect = 6e-65
 Identities = 165/284 58%, Positives = 215/284 75%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKMQAMK++++NA D A+ +EQ+ K+      K E++ N+LQKKL   EN++D V
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             E L  ANT     +K ++  E +V  L RR+ LLEED ERSEE+LN+ T KL EAS+AA
Sbjct  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RKVLE RS S EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E  ++K++ELEEEL VVG N+K+L+V  ++A+QRE++Y+E I+ LT  LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
             AER V KLQKEVDRLEDEL+ EKE+YK+I+D+LDQTF+E++GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 19. Allergen Name: Pen a 1 Sequence ID: 11893851

 Score = 240.0 bits 1024,  Expect = 7e-65
 Identities = 164/284 57%, Positives = 215/284 75%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKMQAMK++++NA D A+ +EQ+ K+      K EEE + LQK++   EN+ D V
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             E L +AN +L   +K ++  E +V  L RR+ LLEED ERSEE+LN+ T KL EAS+AA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RKVLE RS S EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E  ++K++ELEEEL VVG N+K+L+V  ++A+QRE++Y+E I+ LT  LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
             AER V KLQKEVDRLEDEL+ EKE+YK+I+D+LDQTF+E++GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 20. Allergen Name: Lit v 1.0101 Sequence ID: EU410072

 Score = 240.0 bits 1024,  Expect = 7e-65
 Identities = 164/284 57%, Positives = 215/284 75%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKMQAMK++++NA D A+ +EQ+ K+      K EEE + LQK++   EN+ D V
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             E L +AN +L   +K ++  E +V  L RR+ LLEED ERSEE+LN+ T KL EAS+AA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RKVLE RS S EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E  ++K++ELEEEL VVG N+K+L+V  ++A+QRE++Y+E I+ LT  LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
             AER V KLQKEVDRLEDEL+ EKE+YK+I+D+LDQTF+E++GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 21. Allergen Name: Pen m 1 Sequence ID: AAX37288

 Score = 240.0 bits 1024,  Expect = 7e-65
 Identities = 164/284 57%, Positives = 215/284 75%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKMQAMK++++NA D A+ +EQ+ K+      K EEE + LQK++   EN+ D V
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             E L +AN +L   +K ++  E +V  L RR+ LLEED ERSEE+LN+ T KL EAS+AA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RKVLE RS S EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E  ++K++ELEEEL VVG N+K+L+V  ++A+QRE++Y+E I+ LT  LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
             AER V KLQKEVDRLEDEL+ EKE+YK+I+D+LDQTF+E++GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 22. Allergen Name: Por p 1.0101 Sequence ID: M1H607

 Score = 239.8 bits 1023,  Expect = 9e-65
 Identities = 163/284 57%, Positives = 215/284 75%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKMQAMK+++++A D A+ +EQ+ K+      K EEE + LQK++   EN+ D V
Sbjct  1    MDAIKKKMQAMKLEKDDAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQV 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             E L +ANT+LE  +K ++  E +V  L RR+ LLEED ERSEE+LN+ T KL EAS+AA
Sbjct  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RKVLE RS S EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E  ++K++ELEEEL VVG N+K+L+V  ++A+QRE++Y+E I+ LT  LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
             AER V KLQKEVDRLEDEL+ EKE+YK+ +D+LDQ F+E++GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSTTDELDQAFSELSGY 284

Sequence Alignment: 23. Allergen Name: Der p 10 Sequence ID: O18416

 Score = 238.2 bits 1016,  Expect = 3e-64
 Identities = 167/284 58%, Positives = 209/284 73%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            M+AIK KMQAMK++++NA D AE  EQK +D      K EEE   LQKK+   EN  D V
Sbjct  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             EQL  ANTKLE  EK +   E DV  L RR+ L+EED ERSEE+L   T KLEEAS++A
Sbjct  61   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RK+LE RS + EER++ LE QL+ A+ +A DAD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMEGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E  ++K++ELEEEL VVG N+K+L+V  ++A QRE+++E+ IR +T  LK+AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAHEQQIRIMTTKLKEAEARAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
             AER V KLQKEV RLEDEL+ EKE+YK+ISD+LDQTFAE+ GY
Sbjct  241  FAERSVQKLQKEVGRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 24. Allergen Name: Asc l 3.0101 Sequence ID: ACN32322

 Score = 238.2 bits 1016,  Expect = 3e-64
 Identities = 162/284 57%, Positives = 213/284 75%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKMQAMK++++NA D A+  E+K++       ++EEE+ + QKK+  TEN+ D  
Sbjct  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             E L  AN+ LE  EK++ + E++V  L RR+TLLEE+ ER+EE+L   TEKLEEA+  A
Sbjct  61   QEDLSVANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATEKLEEATHTA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RKV+E RS   EER + +E QL+ A+ +A +AD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R EA + K++ELEEEL VVG N+K+L+V  ++A QREDSYEE IR ++  LK+AE RA 
Sbjct  181  ERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
             AER V KLQKEVDRLEDEL+ EKERYK+IS++LDQTF E++GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 25. Allergen Name: Lep d 10 Sequence ID: Q9NFZ4

 Score = 237.9 bits 1015,  Expect = 3e-64
 Identities = 167/284 58%, Positives = 209/284 73%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            M+AIK KMQAMK++++NA D AE  EQK +D      K EEE   LQKK+   EN  D V
Sbjct  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             E L +ANTKLE  EK +   E DV  L RR+ L+EED ERSE +L   T KLEEAS++A
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RK+LE RS + EER++ LE QL+ A+ +A DAD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E  ++K++ELEEEL VVG N+K+L+V  ++A QRE++YE+ IR +T  LK+AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
             AER V KLQKEVDRLEDEL+ EKE+YK+ISD+LDQTFAE+ GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 26. Allergen Name: Ani s 3 Sequence ID: Q9NAS5

 Score = 234.8 bits 1001,  Expect = 3e-63
 Identities = 159/284 55%, Positives = 210/284 73%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKMQAMK++++NA D A+  E+K++       ++EEE+ + QKK+  TEN+ D  
Sbjct  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             E L  AN+ LE  EK++ + E++V  L RR+TLLEE+ ER+EE+L   T KLEEA+  A
Sbjct  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RKV+E RS   EER + +E QL+ A+ +A +AD K+DE ARKL + E DLERAE
Sbjct  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E  + K++ELEEEL VVG N+K+L+V  ++A QREDSYEE IR ++  LK+AE RA 
Sbjct  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
             AER V KLQKEVDRLEDEL+ EKERYK+IS++LDQTF E++GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 27. Allergen Name: Bomb m 3.0101 Sequence ID: NP_001103782

 Score = 232.9 bits 993,  Expect = 1e-62
 Identities = 163/281 58%, Positives = 203/281 72%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKMQAMK++++NA D A   EQ+ KD      K EEE  +LQKK+   EN  D  
Sbjct  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             E L + N KLE  EK +   ES+V  L RR+ LLEED ERSEE+L + T KL EAS+AA
Sbjct  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RKVLE RS + EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E+ ++K++ELEEEL VVG N+K+L+V  ++A+QRE+ Y+  I+ LT  LK+AE RA 
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEI 281
             AER V KLQKEVDRLEDEL+AEKE+YK I DDLD  F E+
Sbjct  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281

Sequence Alignment: 28. Allergen Name: Per a 7 Sequence ID: Q9UB83

 Score = 230.4 bits 982,  Expect = 6e-62
 Identities = 159/284 55%, Positives = 205/284 72%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKMQAMK++++NA D A   EQ+ +D      K EEE   LQKK+   EN+ D  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDCALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             EQL + N KL+  +K +   ES+V  L RR+ LLEED ERSEE+L + T KL EAS+A 
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAV 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RK+LE +  + EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E+ ++K++ELEEEL VVG N+K+L+V  ++A+ RE+ Y++ I+ LT  LK+AE RA 
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
             AER V KLQKEVDRLEDEL+ EKE+YK I DDLD TF E+AGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTELAGY 284

Sequence Alignment: 29. Allergen Name: Aed a 10.0101 Sequence ID: Q17H75

 Score = 230.4 bits 982,  Expect = 6e-62
 Identities = 162/281 57%, Positives = 201/281 71%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKMQAMK++++NA D A   EQ+ +D      K EEE  +LQKK+ A EN+ D  
Sbjct  1    MDAIKKKMQAMKLEKDNALDRALLCEQQARDANLRAEKAEEEARQLQKKIQAIENDLDQT 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             E L   N KLE  EK +   ES+V  L RR+ LLEED ERSEE+L S T KL EAS AA
Sbjct  61   QEALMAVNAKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLASATAKLSEASAAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RKVLE R+ + EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERARKVLENRALADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R EA + K++ELEEEL VVG N+K+L+V  ++A+QRE+ Y+  I+ LT  LK+AE RA 
Sbjct  181  ERAEAGEGKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEI 281
             AER V KLQKEVDRLEDEL+ EKE+Y+ I DDLD  F E+
Sbjct  241  FAERSVQKLQKEVDRLEDELVMEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 30. Allergen Name: Pan s 1 Sequence ID: O61379

 Score = 228.2 bits 972,  Expect = 3e-61
 Identities = 156/274 56%, Positives = 206/274 75%, Gaps = 0/274 0%
Query  11   MKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTVNEQLQEANTK 70
            MK++++NA D A+ +EQ+ K+      K EEE + LQK++   EN+ D V E L +ANT+
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
Query  71   LENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAADESERNRKVL 130
            LE  +K ++  E +V  L RR+ LLEED ERSEE+LN+ T KL EAS+AADESER RKVL
Sbjct  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  131  EGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAETRLEAADAKV 190
            E RS S EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE R E  ++K 
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
Query  191  LELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRATEAERQVVKLQ 250
            +ELEEEL VVG N+K+L+V  ++A+QRE++Y+E I+ LT  LK AE RA  AER V KLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  251  KEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
            KEVDRLEDEL+ EKE+YK+I+D+LDQTF+E++GY
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 31. Allergen Name: Per a 7.0102 Sequence ID: AAD19606

 Score = 228.1 bits 972,  Expect = 3e-61
 Identities = 158/283 55%, Positives = 204/283 72%, Gaps = 0/283 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKMQAMK++++NA D A   EQ+ +D      K EEE   LQKK+   EN+ D  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             EQL + N KL+  +K +   ES+V  L RR+ LLEED ERSEE+L + T KL EAS+AA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RK+LE +  + EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E+ ++K++ELEEEL VVG N+K+L+V  ++A+ RE+ Y++ I+ LT  LK+AE RA 
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAG 283
             AER V KLQKEVDRLEDEL+ EKE+YK I DDLD TF E+ G
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTELIG 283

Sequence Alignment: 32. Allergen Name: Bla g 7.0101 Sequence ID: AAF72534

 Score = 227.0 bits 967,  Expect = 6e-61
 Identities = 157/283 55%, Positives = 202/283 71%, Gaps = 0/283 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKMQAMK++++NA D A   EQ+ +D      K EEE   LQKK+   EN+ D  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             EQL + N KL+  +K +   ES+V  L RR+ LLEED ERSEE+L + T KL EAS+AA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RK+LE +  + EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E  ++K++ELEEEL VVG N+K+L+V  ++A+ RE+ Y++ I+ L   LK+AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAG 283
             AER V KLQKEVDRLEDEL+ EKE+YK I DDLD TF E+ G
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKYICDDLDMTFTELIG 283

Sequence Alignment: 33. Allergen Name: Met e 1 Sequence ID: Q25456

 Score = 226.1 bits 963,  Expect = 1e-60
 Identities = 154/274 56%, Positives = 205/274 74%, Gaps = 0/274 0%
Query  11   MKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTVNEQLQEANTK 70
            MK++++NA D A+ +EQ+ K+      K EEE + LQK++   EN+ D V E L +AN +
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
Query  71   LENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAADESERNRKVL 130
            L   +K ++  E +V  L RR+ LLEED ERSEE+LN+ T KL EAS+AADESER RKVL
Sbjct  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  131  EGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAETRLEAADAKV 190
            E RS S EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE R E  ++K+
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
Query  191  LELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRATEAERQVVKLQ 250
            +ELEEEL VVG N+K+L+V  ++A+QRE++Y+E I+ LT  LK AE RA  AER V KLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  251  KEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
            KEVDRLEDEL+ EKE+YK+I+D+LDQTF+E++GY
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 34. Allergen Name: Chi k 10 Sequence ID: CAA09938

 Score = 223.1 bits 950,  Expect = 9e-60
 Identities = 158/281 56%, Positives = 198/281 70%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKMQAMK++++NA D A   E + +D      K EEE   LQKK+   EN+ D  
Sbjct  1    MDAIKKKMQAMKLEKDNALDRALLCENQARDANLRAEKAEEEARTLQKKIQTIENDLDQT 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
              Q    N KLE  EK +   ES+V  L RR+ LL ED +RSEE+L S T KL EAS AA
Sbjct  61   QGQETLVNGKLEGKEKALQNAESEVAALNRRIQLLGEDLDRSEERLASATAKLSEASAAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RK+LE RS + EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERARKILENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R EA +AK++ELEEEL VVG N+K+L+V  ++A+QRE+ Y+  I+ LT  LK+AE RA 
Sbjct  181  ERAEAGEAKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEI 281
             AER V KLQKEVDRLEDEL++EKE+Y+ I DDLD  F E+
Sbjct  241  FAERSVQKLQKEVDRLEDELVSEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 35. Allergen Name: Cha f 1 Sequence ID: Q9N2R3

 Score = 217.5 bits 925,  Expect = 4e-58
 Identities = 152/264 57%, Positives = 191/264 72%, Gaps = 0/264 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKMQAMK++++NA D A+ +EQ+ K+      K EEE    QKK+   EN  D  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             EQL  ANTKL+  EK +   E +V  L RR+ L EED ERSEE+LN+ T KL EAS+AA
Sbjct  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLPEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RKVLE RS S EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E+ ++K++ELEEEL VVG N+K+L+V  ++A+QRE++Y+E I+ L   LK AE RA 
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEK 264
             AER V KLQKEVDRLEDEL+ EK
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEK 264

Sequence Alignment: 36. Allergen Name: Lep s 1 Sequence ID: CAC84590

 Score = 211.7 bits 900,  Expect = 2e-56
 Identities = 144/284 50%, Positives = 203/284 71%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            M+AIKKKMQAMK++++NA D A+ +E + +D      K+ EE  +L+KK +  E ++ T 
Sbjct  1    MEAIKKKMQAMKLEKDNAMDKADALEAQARDANRKADKILEEVQDLKKKPSQVETDFTTT 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             E L  AN  LE+ EK +T  ES+V  L R++ ++EE+ ERSEE+L +   KL EAS AA
Sbjct  61   KENLATANKNLEDKEKTLTNTESEVASLNRKVQMIEENLERSEERLGTALTKLGEASHAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DE+ R  KVLE RS   EER+D+L  QL+ A+ +A DAD K DE +RK+A  E DLE AE
Sbjct  121  DEASRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADGKSDEVSRKMAQVEDDLEVAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R+++ D+K++ELEEEL VVG ++K+L+V  ++A+QR + Y+  I+ LT  LK+AE RA 
Sbjct  181  DRVKSGDSKIMELEEELKVVGNSLKSLEVSEEKANQRVEEYKRQIKTLTVKLKEAEARAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
             AE+ V KLQKEVDRLEDEL   K+RY+A++D++DQTFAE++GY
Sbjct  241  YAEKYVKKLQKEVDRLEDELGINKDRYRALADEMDQTFAELSGY 284

Sequence Alignment: 37. Allergen Name: Aed a 10.0201 Sequence ID: Q17H80

 Score = 206.3 bits 876,  Expect = 1e-54
 Identities = 141/284 49%, Positives = 199/284 70%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKMQAMK++++NA D A+  E + K+      K+ EE  EL K+LT    +++  
Sbjct  1    MDAIKKKMQAMKLEKDNAADKADTCENQAKEANLRADKIMEEVAELTKRLTQVTEDHEKF 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
               L++AN  LE  EK +T  E++V  L R++  +EED E+SEE+  +   KL EA+++A
Sbjct  61   KNTLEQANKDLEEKEKLLTSTEANVAALTRKVQQVEEDLEKSEERSGAALSKLLEATQSA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DE+ R  KVLE RS   EER+D+L  QL+ A+ +A DAD K DE +RKLA  E +LE AE
Sbjct  121  DENNRMCKVLENRSQQDEERMDQLSNQLKEARMLAEDADGKSDEVSRKLAFVEDELEVAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R+++ +AK++ELEEEL VVG ++K+L+V  D+A+QR + ++  ++ LT  LK+AE RA 
Sbjct  181  DRVKSGEAKIMELEEELKVVGNSLKSLEVSEDKANQRVEEFKRQLKSLTIKLKEAETRAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284
             AE+ V KLQKEVDRLED+L+ EK++YKAI DDLD TFAE+ GY
Sbjct  241  NAEKNVKKLQKEVDRLEDKLMNEKDKYKAICDDLDSTFAELTGY 284

Sequence Alignment: 38. Allergen Name: Sal s 4.0101 Sequence ID: NP_001117128

 Score = 202.6 bits 860,  Expect = 1e-53
 Identities = 142/281 50%, Positives = 195/281 69%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKMQ +K+D+ENA D AE  E   K  E    +LE+++  LQKKL  TE+  D  
Sbjct  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
            +E L++A  KLE +EK  T  E+DV  L RR+ L+EE+ +R++E+L +   KLEEA KAA
Sbjct  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER  KV+E R++  EE+++  + QL+ AK++A +AD K++E ARKL I E DLER E
Sbjct  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E ++ K  ELEEEL  V  N+K+L+ Q ++ SQ+ED YEE I+ LT  LK+AE RA 
Sbjct  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEI 281
             AER V KL+K +D LEDEL A+K +YKAIS++LD  + ++
Sbjct  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDM 281

Sequence Alignment: 39. Allergen Name: Pan h 4.0201 Sequence ID: XP_026775428

 Score = 201.2 bits 854,  Expect = 3e-53
 Identities = 141/281 50%, Positives = 196/281 69%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKMQ +K+D+ENA D AEQ E   K  E    +LE+++  LQKKL  TE+  D  
Sbjct  1    MDAIKKKMQMLKLDKENALDRAEQAESDKKAAEDRSKQLEDDLVALQKKLKGTEDELDKY 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
            +E L++A  KLE SEK+    E+DV  L RR+ L+EE+ +R++E+L +  +KLEEA KAA
Sbjct  61   SEALKDAQEKLELSEKKAADAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER  KV+E R+   EE+++  E QL+ AK++A +AD K++E ARKL I E +LER E
Sbjct  121  DESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E ++ K  ELEEEL  V   +K+L+ Q ++ SQ+ED YEE I+ LT  LK+AE RA 
Sbjct  181  ERAELSEGKCAELEEELKTVTNTLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEI 281
             AER V KL+K +D LEDEL ++K +YKAIS++LD+ + ++
Sbjct  241  FAERTVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDM 281

Sequence Alignment: 40. Allergen Name: Copt f 7.0101 Sequence ID: AGM32377.1

 Score = 193.3 bits 819,  Expect = 8e-51
 Identities = 134/251 53%, Positives = 177/251 70%, Gaps = 0/251 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            MDAIKKKMQAMK++++N  D A   EQ+ +D      K EEE   LQKK+   EN+ D  
Sbjct  1    MDAIKKKMQAMKLEKDNTMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
             EQL + N KL+  +K +   ES+V  L RR+ LLEED ERSEE+L + T KL EAS+AA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER RK+LE +  + EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E+ ++K++ELEEEL VVG N+K+L+V  ++A+ RE+ Y++ I+ LT  LK+AE RA 
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  EAERQVVKLQK 251
             AER V KLQK
Sbjct  241  FAERSVQKLQK 251

Sequence Alignment: 41. Allergen Name: Pan h 4.0101 Sequence ID: XP_026781482

 Score = 186.0 bits 787,  Expect = 1e-48
 Identities = 134/281 47%, Positives = 188/281 66%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
            M+AIKKKMQ +K D+ENA D AEQ E   K +E    +LE+E+  LQKKL  TE+  D  
Sbjct  1    MEAIKKKMQMLKGDKENAFDRAEQAELDKKVSEDKCKQLEDELLGLQKKLKGTEDEVDKY 60
Query  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
            +E L++A  KLE SEK+ T  E +V  L RR+ L+EE+ +R++ +L +  +KLEEA K A
Sbjct  61   SEALKDAQEKLELSEKKATDAEGEVAALNRRIQLIEEELDRAQGRLGTALQKLEEAEKQA 120
Query  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
            DESER  KV+E R+   EE+++  E QL+ AK +A D+D K+DE ARKL + E +LERAE
Sbjct  121  DESERGMKVIENRAMKDEEKMEIQELQLKEAKQIAEDSDRKYDEVARKLVVIEGELERAE 180
Query  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
             R E ++ K  +LEEEL  V   +K+L+ Q ++ S +ED YEE I  L + LK+AE RA 
Sbjct  181  ERAEVSELKSGDLEEELKNVTNTLKSLEAQAEKYSDKEDKYEEEINLLNEKLKEAETRAE 240
Query  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEI 281
             AE+ V KL+K +D LEDEL  +K + KAI ++LD  + ++
Sbjct  241  FAEKTVSKLEKTIDDLEDELYNQKLKVKAICEELDNALNDM 281

Sequence Alignment: 42. Allergen Name: Rap v 2.0101 Sequence ID: QPB41107

 Score = 65.2 bits 258,  Expect = 9e-12
 Identities = 78/273 28%, Positives = 134/273 49%, Gaps = 19/273 6%
Query  2    DAIKKKMQAMK-VDRENA--QDLAEQMEQKLKDTETAKAK-LEEEFNELQKKLTATENNY 57
            D +++   A+K  +RE A  + L  Q+E + +D+  A  K  EE + + + KL + +   
Sbjct  427  DQLREANLALKDANRELADLRQLRSQLEAE-RDSLAAALKDTEEALRDAEAKLASAQAAL 485
Query  58   DTVN----EQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYE----RSEEKLNST 109
            + +      +L+E + ++EN  +   +    +  LQR L  +E  Y+    R ++K+ S 
Sbjct  486  NQLKIDMENRLREKDEEIENVRRSSAR---AIEELQRTLVEVETRYKTEISRMKKKFESD 542
Query  110  TEKLEEASKAADESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKL 169
              +LE A   A+ +  N + L+ +  S ++R+ ELE  LE  + V+ D  +++  A RK 
Sbjct  543  IRELEAALDNANRA--NSEYLK-QIKSLQQRVKELETLLEEERRVSDDLRNQLGVAERKR 599
Query  170  AITEVDLERAETRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLT 229
                 +LE A   LE A+      E EL      +  + +Q    +  +   E  +  + 
Sbjct  600  VALAQELEDARALLEGAERARKNAETELADTSTRLSEITLQVTSLTNDKRRLEADLSAMQ 659
Query  230  KSLKDAENRATEAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEI 281
              L DA N    AE +  +L  E  RL DEL  E+E YK       Q   EI
Sbjct  660  SDLDDAINNQRGAEERAERLAAENGRLADELRQEQENYKNAESLRKQLEVEI 711

Sequence Alignment: 43. Allergen Name: Ani s 2 Sequence ID: AAF72796

 Score = 62.9 bits 248,  Expect = 5e-11
 Identities = 77/261 29%, Positives = 132/261 50%, Gaps = 32/261 12%
Query  4    IKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTAT----ENNYDT 59
            +++K + M+  R++ Q   +++   L D E   A+++ E   L+KK  A     E   D 
Sbjct  502  LQEKEEEMEALRKSMQFEIDRLTAALADAE---ARMKAEIARLRKKYQAEIAELEMTVDN 558
Query  60   VNEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKA 119
            +N    EA   ++   +QI QL++++   QR+L    + Y  ++ K+++ + +LEE   A
Sbjct  559  LNRANLEAQKTIKKQSEQIIQLQANLEDTQRQLQQTLDQYALAQRKISALSAELEECKTA 618
Query  120  ADESERNRKVLEGRSNSYEERIDEL---EKQLETAKN-VATD---ADHKFDEAARKLAIT 172
             D + R RK  E        RI +L      L   KN + T+   A   +DE  ++L   
Sbjct  619  LDNAIRARKQAEADLEEAHVRISDLTSINSNLTAIKNKLETELSTAQADLDEVTKELHAA 678
Query  173  EVDLERAETRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSL 232
            +   ERA   L  A   V EL EE           Q ++ +      S EE ++ L   +
Sbjct  679  D---ERANRALADAARAVQELHEE-----------QEHSMKIDALRKSLEEQVKQLQVQI 724
Query  233  KDAENRATEAERQVV-KLQKEVDRLEDELLAEKERYKAISDDL---DQTFAEI 281
            ++AE  A    ++V+ KL+  +  LE  L  E  R+K     L   D+   E+
Sbjct  725  QEAEAAALLGGKRVIAKLETRIRDLEVALDEETRRHKETQSALRKKDRRIKEV 777
 Score = 41.9 bits 156,  Expect = 0.0001
 Identities = 69/269 25%, Positives = 135/269 50%, Gaps = 33/269 12%
Query  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEE-------FNELQKKLTAT 53
            M+ ++KK Q + +D     +  EQ+++K    +  + +L+ E        ++LQK     
Sbjct  115  MNVLRKKHQDVCLDYT---EQIEQLQKKNSKIDRERQRLQHEVIELTATIDQLQKDKHVA 171
Query  54   ENNYDTVNEQLQEANTKLENSEKQITQLESDVGGLQRRLT-LLEEDYERSEEKLN----- 107
            E       +Q  E + K+E+  K++  L      LQ   + LL E +++  +  N     
Sbjct  172  EKMAQKFEQQTIELSNKVEDLNKHVNDLAQQRQRLQAENSDLLAEIHDQKVQLDNLQHVK 231
Query  108  -STTEKLEEASKAADESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAA 166
                ++LEE+ +  +++ER R  ++ + +  +  +D +   L+       +A+HK+  A 
Sbjct  232  YQLAQQLEESRRRLEDAERERSQMQAQLHQVQLELDSVRVALDEESAARVEAEHKLSLAN 291
Query  167  RKLAI--TEVDLERAETRLEAAD------AKVLELEEELTVVGANIKTLQVQNDQASQRE 218
             ++    ++ D E A    E  D       K  E EE++ ++   +  L    ++A  R 
Sbjct  292  TEITQWKSKFDAEVALHHEEVEDLRKKMMQKQAEYEEQIEIMLQKVSQL----EKAKARL 347
Query  219  DSYEET-IRDLTKSLKDAE--NRATEA-ERQVVKLQKEVDRLEDELLAEKERYKAISDDL 274
             S  E  I DL K+        RA E  E+QV++++  +D L  EL A +   +A   +L
Sbjct  348  QSEVEVLIVDLEKAQNTIAILERAKEQLEKQVLEMKSRIDELLVELEAAQREARAALAEL 407
Query  275  DQ 276
             +
Sbjct  408  QK 409

Sequence Alignment: 44. Allergen Name: Der p 11 Sequence ID: AAO73464

 Score = 57.7 bits 225,  Expect = 2e-09
 Identities = 55/246 22%, Positives = 127/246 51%, Gaps = 10/246 4%
Query  6    KKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTVNEQLQ 65
            K+++ +K+  +NA  L +Q+ Q+L+DT   + +LEEE    ++K ++ EN+  T+  +L+
Sbjct  213  KEVHEVKLQLDNANHLKQQIAQQLEDT---RHRLEEE----ERKRSSLENHAHTLEVELE 265
Query  66   EANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLE-EASKAADESE 124
                +L++  +   +LE  +          +  YE   +      E+L  + ++   E E
Sbjct  266  SLKVQLDDESEARLELERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMAQKISEYE 325
Query  125  RNRKVLEGRSNSYEERIDELEKQLET-AKNVATDADHKFDEAARKLAITEVDLERAETRL 183
               + L  + +S E++   L+ ++E    ++   A H      R   + +++L+  + +L
Sbjct  326  EQLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKAAAHAQQLEKRVAQLEKINLD-LKDKL 384
Query  184  EAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRATEAE 243
            E     + + ++EL +    ++ LQ + ++   + D      + LT  L +A+++  +A 
Sbjct  385  EEVTMLMEQAQKELRIKIGELQKLQHEYEKVRDQRDQLARENKKLTDDLAEAKSQLNDAH 444
Query  244  RQVVKLQKEVDRLEDE 259
            R++ + + E+ RLE+E
Sbjct  445  RRIHEQEIEIKRLENE 460
 Score = 45.6 bits 172,  Expect = 8e-06
 Identities = 63/237 26%, Positives = 123/237 51%, Gaps = 25/237 10%
Query  2    DAIKKKMQA----MKVDRENAQDL-AEQMEQKLKDTETAKAKLEEEFNELQKKLTATENN 56
            D + +++Q     + V +   Q L AE  E ++   + ++AK + E  +L+++     N 
Sbjct  583  DEVHRQLQQAVDQLGVTQRRCQALQAELEEMRIALEQASRAKRQAE--QLHEEAVVRVNE 640
Query  57   YDTVNEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEA 116
              T+N  L  A +KLE+   + + L++D   +++ L + +E  ++   +L ST + L E 
Sbjct  641  LTTINVNLASAKSKLES---EFSALQADYDEVHKELRISDERVQKLTIELKSTKDLLIEE 697
Query  117  SKAADESERNRKVLEGRSNSYEERIDELEKQ-LETAKNVAT-------DADHKFDEAARK 168
             +   + E  +K LE    +   RI+E+E   L   K V         D + + +E  R+
Sbjct  698  QERLVKLETVKKSLEQEVRTLHVRIEEVEANALAGGKRVIAKLESRIRDVEIEVEEERRR 757
Query  169  LAITEVDLERAETRLEA------ADAKVLELEEELT-VVGANIKTLQVQNDQASQREDSY 221
             A TE  L + + R++        D K ++L +E+T  +   +K  + Q  +        
Sbjct  758  HAETEKMLRKKDHRVKELLLQNEEDHKQIQLLQEMTDKLNEKVKVYKRQMQEQEGMSQQN 817
Query  222  EETIRDLTKSLKDAENRATEAE 243
               +R + + L+ AE+RA +AE
Sbjct  818  LTRVRRFQRELEAAEDRADQAE 839

Sequence Alignment: 45. Allergen Name: Der f 11.0101 Sequence ID: AAK39511

 Score = 57.0 bits 222,  Expect = 2e-09
 Identities = 63/239 26%, Positives = 134/239 56%, Gaps = 24/239 10%
Query  6    KKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTVNEQLQ 65
            K+++ +K+  +NA  L  Q+ Q+L+DT   + +LEEE    ++K  + EN+  T+  +L+
Sbjct  127  KEVHEVKLQLDNANHLKTQIAQQLEDT---RHRLEEE----ERKRASLENHAHTLEVELE 179
Query  66   EANTKLENSEKQITQLESDVGGLQRRLTLLEEDYE----RSEEKLNSTTEKLEE----AS 117
                +L+  E+   +LE     L+R+LT    D      + E +L +  +++EE     +
Sbjct  180  SLKVQLD--EESEARLE-----LERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMA 232
Query  118  KAADESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITE-VDL 176
            +   E E   + L  + +S E++   L+ ++E        A     +  +++A  E ++L
Sbjct  233  QKISEYEEQLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINL 292
Query  177  ERAETRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAE 236
            +  + +LE     + + ++EL V  A ++ LQ + ++   + D      + LT  L +A+
Sbjct  293  D-LKNKLEEVTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAK 351
Query  237  NRATEAERQVVKLQKEVDRLEDE 259
            ++  +A R++ + + E+ RLE+E
Sbjct  352  SQLNDAHRRIHEQEIEIKRLENE 374
 Score = 45.6 bits 172,  Expect = 6e-06
 Identities = 62/259 23%, Positives = 127/259 49%, Gaps = 18/259 6%
Query  4    IKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTVNEQ 63
            + +K + ++  R+  Q   EQ+  +L + E   AKL+ E   L+KK  A     +   + 
Sbjct  414  LAQKDEEIEALRKQYQIEIEQLNMRLAEAE---AKLKTEIARLKKKYQAQITELELSLDA 470
Query  64   LQEANTKLENSEK----QITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKA 119
              +AN  L+ + K    QIT+L++    ++R+L    +    ++ +  +   +LEE   A
Sbjct  471  ANKANIDLQKTIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEMRIA 530
Query  120  ADESERNRKVLEGRSNSYEERIDELEKQLETAKNVA-TDADHKFDEAARKLAITEVDLER 178
             +++ R ++  E        R++EL     T  NV    A  K++    +++  + D + 
Sbjct  531  LEQANRAKRQAEQLHEEAVVRVNEL-----TTINVNLASAKSKLES---EFSALQADYDE 582
Query  179  AETRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENR 238
                L  +D +V +L  EL      +   Q +  +    + S E+ +R L   +++ E  
Sbjct  583  VHKELRISDERVQKLTIELKSTKDLLIEEQERLVKLETVKKSLEQEVRTLHVRIEEVEAN 642
Query  239  ATEAERQVV-KLQKEVDRLEDELLAEKERYKAISDDL 274
            A    ++V+ KL+  +  +E E+  E+ R+ A +D +
Sbjct  643  ALAGGKRVIAKLESRIRDVEIEVEEERRRH-AETDKM 678

Sequence Alignment: 46. Allergen Name: Blo t 11 Sequence ID: AAM83103

 Score = 44.0 bits 165,  Expect = 2e-05
 Identities = 56/240 23%, Positives = 127/240 52%, Gaps = 22/240 9%
Query  6    KKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTVNEQLQ 65
            K+++  K+  +NA  L  Q+ Q+L+DT   + +LE+E    ++K ++ EN+  T+  +L+
Sbjct  213  KEVHEYKISLDNANHLKGQIAQQLEDT---RHRLEDE----ERKRSSLENHAHTLEVELE 265
Query  66   EANTKLENS-------EKQITQLESDVGGLQRRLTL-LEEDYERSEEKLNSTTEKLEEAS 117
                +LE         E+Q+T+   D    + +    L+   +  EE      +K+ E  
Sbjct  266  SLKVQLEEESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYG 325
Query  118  KAADESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLE 177
            +  +        LE +    +  ++ L   LE A   A    + +++   +L    +DL 
Sbjct  326  EQLEALLNKCSALEKQKARLQSEVEVLIMDLEKATAHA----QALEKRVSQLEKINLDL- 380
Query  178  RAETRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAEN 237
              +++LE     + + +++L V  A+++ LQ + ++   ++++     + L   L +A++
Sbjct  381  --KSKLEEVSMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKS 438
Query  238  RATEAERQVVKLQKEVDRLEDE 259
            +  +A R++ + + E+ RLE+E
Sbjct  439  QLNDAHRRIHEQEIEIKRLENE 460
 Score = 39.4 bits 145,  Expect = 0.0005
 Identities = 66/261 25%, Positives = 136/261 52%, Gaps = 32/261 12%
Query  4    IKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTVNEQ 63
            + +K + ++  R+  Q   EQ+  +L + E   AKL+ E   L+KK  A     +   + 
Sbjct  500  LAQKEEEIEALRKQYQIEIEQLNMRLAEAE---AKLKTEVARLKKKYQAQITELELSLDA 556
Query  64   LQEANTKLENSEK----QITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKA 119
              +AN  L+ + K    QIT L++    ++R+L    +    ++ +  + T +LEE    
Sbjct  557  ANKANIDLQKTIKKQALQITGLQAHYDEVHRQLQQAVDQLGVTQRRCQALTAELEEMRVN 616
Query  120  ADESERNRKVLEGRSNSYEERIDELEK---QLETAKN-VATD---ADHKFDEAARKLAIT 172
             +++ R ++  E        R++EL      L +AK+ + T+     + +DE  ++L I+
Sbjct  617  LEQALRAKRAAEQMHEEAVVRVNELTTINVNLASAKSKLETEFSALQNDYDEVHKELRIS 676
Query  173  E-------VDLERAETRLEAADAKVLELEEELTVVGANIKTLQVQ------NDQASQRE- 218
            +       ++++  +  LE+   +V +LE     +   ++ LQ++      N  A  +  
Sbjct  677  DERVQKLTIEVKSTKDLLESETERVTKLETIKKSLETEVRNLQIRIEEVEANALAGGKRV 736
Query  219  -DSYEETIRDLTKSLKDAENRATEAERQVVKLQKEVDRLEDELLAEKERYKAI 270
                E  IRD+   +++   R  E E+    L+K+  R+++ LL  +E +K I
Sbjct  737  IAKLESRIRDVEIEVEEERRRHAETEKM---LRKKDHRVKELLLQNEEDHKQI 786

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.