The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV
QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA
DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE
ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE
FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY
Sequence Info Allergen Name Length Opt Bits Score E Value
AEX31649 Cho a 10.0101 284 1728 400.5 3.7e-113
ABU97466 Blo t 10.0101 284 1679 389.3 8.5e-110
BAA04557 Der f 10.0101 299 1676 388.6 1.4e-109
Q9NFZ4 Lep d 10 284 1664 385.9 9e-109
AAT40866 Tyr p 10.0101 284 1645 381.6 1.8e-107
O18416 Der p 10 284 1644 381.3 2.1e-107
O44119 Hom a 1.0101 284 1464 340.3 4.8e-95
A7L5V2 Scy p 1.0101 284 1461 339.6 7.7e-95
AAC48288 Hom a 1.0102 284 1459 339.2 1.1e-94
CBY17558 Pan b 1.0101 284 1447 336.4 7e-94
M1H607 Por p 1.0101 284 1444 335.7 1.1e-93
EU410072 Lit v 1.0101 284 1443 335.5 1.3e-93
AAX37288 Pen m 1 284 1443 335.5 1.3e-93
11893851 Pen a 1 284 1443 335.5 1.3e-93
C0LU07 Pro c 1.0101 284 1441 335.0 1.8e-93
D3XNR9 Mac r 1.0101 284 1439 334.6 2.5e-93
M4M2H6 Mel l 1.0101 284 1422 330.7 3.6e-92
AAD19606 Per a 7.0102 284 1411 328.2 2.1e-91
NP_001103782 Bomb m 3.0101 285 1408 327.5 3.3e-91
AAF72534 Bla g 7.0101 284 1407 327.3 3.9e-91
Q9UB83 Per a 7 284 1404 326.6 6.3e-91
O61379 Pan s 1 274 1399 325.5 1.3e-90
Q25456 Met e 1 274 1388 323.0 7.5e-90
Q17H75 Aed a 10.0101 285 1381 321.4 2.4e-89
Q9NAS5 Ani s 3 284 1345 313.2 7e-87
CAA09938 Chi k 10 285 1343 312.7 9.7e-87
Q9N2R3 Cha f 1 264 1341 312.3 1.2e-86
ACN32322 Asc l 3.0101 287 1337 311.3 2.5e-86
AGM32377.1 Copt f 7.0101 256 1242 289.7 7.2e-80
CAC84590 Lep s 1 284 1170 273.3 7.1e-75
CAB38044 Hel as 1 284 1154 269.6 9e-74
APG42675 Hal l 1.0101 284 1139 266.2 9.6e-73
AAG08987 Hal d 1 284 1122 262.3 1.4e-71
Q17H80 Aed a 10.0201 284 1108 259.1 1.3e-70
AVD53650 Sac g 1.0101 284 1079 252.5 1.3e-68
AAG08989 Mim n 1 284 1035 242.5 1.3e-65
NP_001117128 Sal s 4.0101 284 1006 235.9 1.3e-63
XP_026775428 Pan h 4.0201 284 998 234.1 4.5e-63
AAG08988 Per v 1 284 977 229.3 1.3e-61
XP_026781482 Pan h 4.0101 284 946 222.2 1.7e-59
AAK96889 Cra g 1 233 941 221.2 2.9e-59
AAK39511 Der f 11.0101 692 221 56.8 2.6e-09
AAO73464 Der p 11 875 216 55.6 7.4e-09
QPB41107 Rap v 2.0101 859 213 54.9 1.2e-08
AAM83103 Blo t 11 875 202 52.4 6.7e-08
AAF72796 Ani s 2 869 191 49.9 3.8e-07
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cho a 10.0101 Sequence ID: AEX31649

 Score = 400.5 bits 1728,  Expect = 4e-113
 Identities = 284/284 100%, Positives = 284/284 100%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV
Sbjct  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
            QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA
Sbjct  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 2. Allergen Name: Blo t 10.0101 Sequence ID: ABU97466

 Score = 389.3 bits 1679,  Expect = 8e-110
 Identities = 274/284 96%, Positives = 282/284 99%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANL+AEKSEEEVR LQKKIQQIENELDQV
Sbjct  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
            QES+TQANTKLEEKEK+LQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASH+A
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRKMLEHRSITDEERMDGLE+QLKEARMMAEDADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIR+MT KLKEAEARAE
Sbjct  181  ERAETGETKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRMMTGKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSV+KLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY
Sbjct  241  FAERSVRKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 3. Allergen Name: Der f 10.0101 Sequence ID: BAA04557

 Score = 388.6 bits 1676,  Expect = 1e-109
 Identities = 274/284 96%, Positives = 281/284 98%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            MEAIKKKMQAMKLEKDNAIDRAEIAEQK+RDANL+AEKSEEEVR LQKKIQQIENELDQV
Sbjct  16   MEAIKKKMQAMKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 75
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
            QE ++ ANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLK+ATAKLEEAS++A
Sbjct  76   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSA 135
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE
Sbjct  136  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 195
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE
Sbjct  196  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 255
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY
Sbjct  256  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 299

Sequence Alignment: 4. Allergen Name: Lep d 10 Sequence ID: Q9NFZ4

 Score = 385.9 bits 1664,  Expect = 9e-109
 Identities = 272/284 95%, Positives = 281/284 98%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            MEAIK KMQAMKLEKDNAIDRAEIAEQKSRDANL+AEKSEEEVRGLQKKIQQIENELDQV
Sbjct  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
            QES+TQANTKLEEKEK+LQTAEGDVAALNRRIQLIEEDLERSE RLK+AT+KLEEAS++A
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRKMLEHRSITDEERM+GLE+QLKEARMMAEDADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMT KLKEAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 5. Allergen Name: Tyr p 10.0101 Sequence ID: AAT40866

 Score = 381.6 bits 1645,  Expect = 2e-107
 Identities = 268/284 94%, Positives = 280/284 98%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQAMKLE+DNAIDRAEIAEQK+RDANLK+EK+EEEVR LQKKIQQIENELDQV
Sbjct  1    MDAIKNKMQAMKLEEDNAIDRAEIAEQKARDANLKSEKTEEEVRALQKKIQQIENELDQV 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
            QE++TQA TKLEEKEKALQTAE DVAALNRRIQLIEEDLERSEERLKVATAKLEEASH+A
Sbjct  61   QENLTQATTKLEEKEKALQTAEADVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRKMLEHRSITDEERMDGLE+QLKEAR+MAEDADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLESQLKEARLMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMT+KLKEAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTSKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELVHEKEKY+SISDELDQTFAELTGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYESISDELDQTFAELTGY 284

Sequence Alignment: 6. Allergen Name: Der p 10 Sequence ID: O18416

 Score = 381.3 bits 1644,  Expect = 2e-107
 Identities = 269/284 94%, Positives = 278/284 97%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            MEAIK KMQAMKLEKDNAIDRAEIAEQK+RDANL+AEKSEEEVR LQKKIQQIENELDQV
Sbjct  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
            QE ++ ANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLK+ATAKLEEAS++A
Sbjct  61   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRKMLEHRSITDEERM+GLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMEGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEA+EQQIRIMT KLKEAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAHEQQIRIMTTKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEV RLEDELVHEKEKYKSISDELDQTFAELTGY
Sbjct  241  FAERSVQKLQKEVGRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 7. Allergen Name: Hom a 1.0101 Sequence ID: O44119

 Score = 340.3 bits 1464,  Expect = 5e-95
 Identities = 233/284 82%, Positives = 266/284 93%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKMQAMKLEKDNA+DRA+  EQ++++AN++AEK+EEE+R  +KK+QQ+ENELDQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKTEEEIRITHKKMQQVENELDQV 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
            QE ++ ANTKLEEKEKALQ AEG+VAALNRRIQL+EEDLERSEERL  AT KL EAS+AA
Sbjct  61   QEQLSLANTKLEEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +  KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 8. Allergen Name: Scy p 1.0101 Sequence ID: A7L5V2

 Score = 339.6 bits 1461,  Expect = 8e-95
 Identities = 231/284 81%, Positives = 264/284 92%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKMQAMKLEKDNA+DRA+  EQ++++ANL+AEK+EEE+R  QKK+QQ+ENELDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
            QE ++ ANTKL+EKEKALQ AEG+VAALNRRIQL+EEDLERSEERL  AT KL EAS+AA
Sbjct  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKA QREE Y++QI+ +  KLK AEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 9. Allergen Name: Hom a 1.0102 Sequence ID: AAC48288

 Score = 339.2 bits 1459,  Expect = 1e-94
 Identities = 232/284 81%, Positives = 266/284 93%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKMQAMKLEKDNA+DRA+  EQ++++AN++AEKSEEEV  LQK++QQ+EN+LDQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
            QES+ +ANT+LEEK+KAL  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EAS+AA
Sbjct  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +  KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 10. Allergen Name: Pan b 1.0101 Sequence ID: CBY17558

 Score = 336.4 bits 1447,  Expect = 7e-94
 Identities = 232/284 81%, Positives = 264/284 92%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKMQAMKLEKDNA+DRA+  EQ++++AN +AEKSEEEV GLQKK+QQ+EN+LD V
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVFGLQKKLQQLENDLDSV 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
            QE++ +AN  LEEK+KAL  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EAS+AA
Sbjct  61   QEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 11. Allergen Name: Por p 1.0101 Sequence ID: M1H607

 Score = 335.7 bits 1444,  Expect = 1e-93
 Identities = 229/284 80%, Positives = 265/284 93%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKMQAMKLEKD+A+DRA+  EQ++++AN++AEK+EEEV  LQK++QQ+EN+LDQV
Sbjct  1    MDAIKKKMQAMKLEKDDAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQV 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
            QES+ +ANT+LEEK+KAL  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EAS+AA
Sbjct  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKS +DELDQ F+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSTTDELDQAFSELSGY 284

Sequence Alignment: 12. Allergen Name: Lit v 1.0101 Sequence ID: EU410072

 Score = 335.5 bits 1443,  Expect = 1e-93
 Identities = 231/284 81%, Positives = 264/284 92%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKMQAMKLEKDNA+DRA+  EQ++++AN +AEKSEEEV  LQK++QQ+EN+LDQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
            QES+ +AN +L EK+KAL  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EAS+AA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 13. Allergen Name: Pen m 1 Sequence ID: AAX37288

 Score = 335.5 bits 1443,  Expect = 1e-93
 Identities = 231/284 81%, Positives = 264/284 92%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKMQAMKLEKDNA+DRA+  EQ++++AN +AEKSEEEV  LQK++QQ+EN+LDQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
            QES+ +AN +L EK+KAL  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EAS+AA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 14. Allergen Name: Pen a 1 Sequence ID: 11893851

 Score = 335.5 bits 1443,  Expect = 1e-93
 Identities = 231/284 81%, Positives = 264/284 92%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKMQAMKLEKDNA+DRA+  EQ++++AN +AEKSEEEV  LQK++QQ+EN+LDQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
            QES+ +AN +L EK+KAL  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EAS+AA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 15. Allergen Name: Pro c 1.0101 Sequence ID: C0LU07

 Score = 335.0 bits 1441,  Expect = 2e-93
 Identities = 229/284 80%, Positives = 265/284 93%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKMQA KLEKDNA+DRA+  EQ++++AN++AEK+EEEV  LQK++Q++EN+LDQV
Sbjct  1    MDAIKKKMQATKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQHLENDLDQV 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
            QES+ +ANT+LEEK+KA+  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EAS+AA
Sbjct  61   QESLLKANTQLEEKDKAISNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +  KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+ELTGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELTGY 284

Sequence Alignment: 16. Allergen Name: Mac r 1.0101 Sequence ID: D3XNR9

 Score = 334.6 bits 1439,  Expect = 2e-93
 Identities = 230/284 80%, Positives = 263/284 92%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKMQAMKLEKDNA+DRA+  EQ++++AN +AEKSEEEV  LQK++QQ+EN+LD V
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDSV 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
            QE++ +AN  LEEK+KAL  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EAS+AA
Sbjct  61   QEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 17. Allergen Name: Mel l 1.0101 Sequence ID: M4M2H6

 Score = 330.7 bits 1422,  Expect = 4e-92
 Identities = 227/284 79%, Positives = 263/284 92%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKMQAMKLEKDNA+DRA+  EQ++++AN++AEK+E++V  LQKK+QQ+EN++DQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
            QE++  ANT   EK+KAL  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EAS+AA
Sbjct  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 18. Allergen Name: Per a 7.0102 Sequence ID: AAD19606

 Score = 328.2 bits 1411,  Expect = 2e-91
 Identities = 227/283 80%, Positives = 252/283 89%, Gaps = 0/283 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKMQAMKLEKDNA+DRA + EQ++RDANL+AEK+EEE R LQKKIQQIEN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
             E + Q N KL+EK+KALQ AE +VAALNRRIQL+EEDLERSEERL  ATAKL EAS+AA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE + + DEERMD LENQLKEAR MAE+AD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKA  REE Y+QQI+ +T +LKEAEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTG 283
            FAERSVQKLQKEVDRLEDELVHEKEKYK I D+LD TF EL G
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTELIG 283

Sequence Alignment: 19. Allergen Name: Bomb m 3.0101 Sequence ID: NP_001103782

 Score = 327.5 bits 1408,  Expect = 3e-91
 Identities = 228/281 81%, Positives = 252/281 89%, Gaps = 0/281 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKMQAMKLEKDNA+DRA + EQ+++DANL+AEK+EEE R LQKKIQ IENELDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
            QES+ Q N KLEEKEKALQ AE +VAALNRRIQL+EEDLERSEERL  ATAKL EAS+AA
Sbjct  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE+RS+ DEERMD LENQLKEAR +AE+AD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKA QREE Y+ QI+ +T +LKEAEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAEL 281
            FAERSVQKLQKEVDRLEDELV EKEKYK I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281

Sequence Alignment: 20. Allergen Name: Bla g 7.0101 Sequence ID: AAF72534

 Score = 327.3 bits 1407,  Expect = 4e-91
 Identities = 226/283 79%, Positives = 251/283 88%, Gaps = 0/283 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKMQAMKLEKDNA+DRA + EQ++RDAN++AEK+EEE R LQKKIQQIEN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
             E + Q N KL+EK+KALQ AE +VAALNRRIQL+EEDLERSEERL  ATAKL EAS+AA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE + + DEERMD LENQLKEAR MAE+AD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA  REE Y+QQI+ +  +LKEAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTG 283
            FAERSVQKLQKEVDRLEDELVHEKEKYK I D+LD TF EL G
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKYICDDLDMTFTELIG 283

Sequence Alignment: 21. Allergen Name: Per a 7 Sequence ID: Q9UB83

 Score = 326.6 bits 1404,  Expect = 6e-91
 Identities = 226/284 79%, Positives = 251/284 88%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKMQAMKLEKDNA+D A + EQ++RDANL+AEK+EEE R LQKKIQQIEN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDCALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
             E + Q N KL+EK+KALQ AE +VAALNRRIQL+EEDLERSEERL  ATAKL EAS+A 
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAV 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE + + DEERMD LENQLKEAR MAE+AD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKA  REE Y+QQI+ +T +LKEAEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELVHEKEKYK I D+LD TF EL GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTELAGY 284

Sequence Alignment: 22. Allergen Name: Pan s 1 Sequence ID: O61379

 Score = 325.5 bits 1399,  Expect = 1e-90
 Identities = 222/274 81%, Positives = 256/274 93%, Gaps = 0/274 0%
Query  11   MKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQVQESFTQANTK 70
            MKLEKDNA+DRA+  EQ++++AN++AEK+EEEV  LQK++QQ+EN+LDQVQES+ +ANT+
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
Query  71   LEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAADESERMRKML 130
            LEEK+KAL  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EAS+AADESERMRK+L
Sbjct  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  131  EHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAETGESKI 190
            E+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAEERAETGESK 
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
Query  191  VELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAEFAERSVQKLQ 250
            VELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAEFAERSVQKLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  251  KEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            KEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 23. Allergen Name: Met e 1 Sequence ID: Q25456

 Score = 323.0 bits 1388,  Expect = 8e-90
 Identities = 222/274 81%, Positives = 254/274 92%, Gaps = 0/274 0%
Query  11   MKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQVQESFTQANTK 70
            MKLEKDNA+DRA+  EQ++++AN +AEKSEEEV  LQK++QQ+EN+LDQVQES+ +AN +
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
Query  71   LEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAADESERMRKML 130
            L EK+KAL  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EAS+AADESERMRK+L
Sbjct  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  131  EHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAETGESKI 190
            E+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAEERAETGESKI
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
Query  191  VELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAEFAERSVQKLQ 250
            VELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAEFAERSVQKLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  251  KEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            KEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 24. Allergen Name: Aed a 10.0101 Sequence ID: Q17H75

 Score = 321.4 bits 1381,  Expect = 2e-89
 Identities = 224/281 79%, Positives = 248/281 88%, Gaps = 0/281 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKMQAMKLEKDNA+DRA + EQ++RDANL+AEK+EEE R LQKKIQ IEN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRALLCEQQARDANLRAEKAEEEARQLQKKIQAIENDLDQT 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
            QE++   N KLEEKEKALQ AE +VAALNRRIQL+EEDLERSEERL  ATAKL EAS AA
Sbjct  61   QEALMAVNAKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLASATAKLSEASAAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE+R++ DEERMD LENQLKEAR MAE+AD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKVLENRALADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAE GE KIVELEEELRVVGNNLKSLEVSEEKA QREE Y+ QI+ +T +LKEAEARAE
Sbjct  181  ERAEAGEGKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAEL 281
            FAERSVQKLQKEVDRLEDELV EKEKY+ I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVMEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 25. Allergen Name: Ani s 3 Sequence ID: Q9NAS5

 Score = 313.2 bits 1345,  Expect = 7e-87
 Identities = 213/284 75%, Positives = 254/284 89%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKMQAMK+EKDNA+DRA+ AE+K R    K E+ EEE+R  QKK+ Q EN+LD+ 
Sbjct  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
            QE ++ AN+ LEEKEK +Q AE +VAALNRR+ L+EE+LER+EERLK+ATAKLEEA+H A
Sbjct  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER+RK++E+RS  DEER + +E+QLKEA+M+AE+ADRKYDEVARKL MVEADLERAE
Sbjct  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++YE+QIR ++A+LKEAE RAE
Sbjct  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELVHEKE+YKSIS+ELDQTF EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 26. Allergen Name: Chi k 10 Sequence ID: CAA09938

 Score = 312.7 bits 1343,  Expect = 1e-86
 Identities = 220/281 78%, Positives = 244/281 86%, Gaps = 0/281 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKMQAMKLEKDNA+DRA + E ++RDANL+AEK+EEE R LQKKIQ IEN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRALLCENQARDANLRAEKAEEEARTLQKKIQTIENDLDQT 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
            Q   T  N KLE KEKALQ AE +VAALNRRIQL+ EDL+RSEERL  ATAKL EAS AA
Sbjct  61   QGQETLVNGKLEGKEKALQNAESEVAALNRRIQLLGEDLDRSEERLASATAKLSEASAAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE+RS+ DEERMD LENQLKEAR +AE+AD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAE GE+KIVELEEELRVVGNNLKSLEVSEEKA QREE Y+ QI+ +T +LKEAEARAE
Sbjct  181  ERAEAGEAKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAEL 281
            FAERSVQKLQKEVDRLEDELV EKEKY+ I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVSEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 27. Allergen Name: Cha f 1 Sequence ID: Q9N2R3

 Score = 312.3 bits 1341,  Expect = 1e-86
 Identities = 214/264 81%, Positives = 243/264 92%, Gaps = 0/264 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKMQAMKLEKDNA+DRA+  EQ++++ANL+AEK+EEE+R  QKK+QQ+ENELDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
            QE ++ ANTKL+EKEKALQ AEG+VAALNRRIQL EEDLERSEERL  AT KL EAS+AA
Sbjct  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLPEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKA QREE Y++QI+ +  KLK AEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEK 264
            FAERSVQKLQKEVDRLEDELV+EK
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEK 264

Sequence Alignment: 28. Allergen Name: Asc l 3.0101 Sequence ID: ACN32322

 Score = 311.3 bits 1337,  Expect = 3e-86
 Identities = 212/284 74%, Positives = 253/284 89%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKMQAMK+EKDNA+DRA+ AE+K R    K E+ EEE+R  QKK+ Q EN+LD+ 
Sbjct  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
            QE ++ AN+ LEEKEK +Q AE +VAALNRR+ L+EE+LER+EERLK+AT KLEEA+H A
Sbjct  61   QEDLSVANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATEKLEEATHTA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER+RK++E+RS  DEER + +E+QLKEA+M+AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAE GE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++YE+QIR ++A+LKEAE RAE
Sbjct  181  ERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELVHEKE+YKSIS+ELDQTF EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 29. Allergen Name: Copt f 7.0101 Sequence ID: AGM32377.1

 Score = 289.7 bits 1242,  Expect = 7e-80
 Identities = 200/251 79%, Positives = 224/251 89%, Gaps = 0/251 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKMQAMKLEKDN +DRA + EQ++RDANL+AEK+EEE R LQKKIQQIEN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNTMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
             E + Q N KL+EK+KALQ AE +VAALNRRIQL+EEDLERSEERL  ATAKL EAS+AA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE + + DEERMD LENQLKEAR MAE+AD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKA  REE Y+QQI+ +T +LKEAEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQK 251
            FAERSVQKLQK
Sbjct  241  FAERSVQKLQK 251

Sequence Alignment: 30. Allergen Name: Lep s 1 Sequence ID: CAC84590

 Score = 273.3 bits 1170,  Expect = 7e-75
 Identities = 187/284 65%, Positives = 236/284 83%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            MEAIKKKMQAMKLEKDNA+D+A+  E ++RDAN KA+K  EEV+ L+KK  Q+E ++   
Sbjct  1    MEAIKKKMQAMKLEKDNAMDKADALEAQARDANRKADKILEEVQDLKKKPSQVETDFTTT 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
            +E++  AN  LE+KEK L   E +VA+LNR++Q+IEE+LERSEERL  A  KL EASHAA
Sbjct  61   KENLATANKNLEDKEKTLTNTESEVASLNRKVQMIEENLERSEERLGTALTKLGEASHAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DE+ RM K+LE+RS  DEERMD L NQLKEARM+AEDAD K DEV+RK+A VE DLE AE
Sbjct  121  DEASRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADGKSDEVSRKMAQVEDDLEVAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            +R ++G+SKI+ELEEEL+VVGN+LKSLEVSEEKA QR E Y++QI+ +T KLKEAEARAE
Sbjct  181  DRVKSGDSKIMELEEELKVVGNSLKSLEVSEEKANQRVEEYKRQIKTLTVKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            +AE+ V+KLQKEVDRLEDEL   K++Y++++DE+DQTFAEL+GY
Sbjct  241  YAEKYVKKLQKEVDRLEDELGINKDRYRALADEMDQTFAELSGY 284

Sequence Alignment: 31. Allergen Name: Hel as 1 Sequence ID: CAB38044

 Score = 269.6 bits 1154,  Expect = 9e-74
 Identities = 185/284 65%, Positives = 225/284 79%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKM AMK+EK+NA+DRAE  EQK RD      K EE++  LQKK   +EN++D +
Sbjct  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
             E +  ANTKLE  EK     E + A L RRIQL+EEDLERSEERL+ AT KLEEAS AA
Sbjct  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE RS+ D+ER+DGLE QLKEA+ +AEDA+RK+DE ARKLA+ E DLERAE
Sbjct  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A QRE++YE+ IR +T +LK+AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+ SDELD TFAEL GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284

Sequence Alignment: 32. Allergen Name: Hal l 1.0101 Sequence ID: APG42675

 Score = 266.2 bits 1139,  Expect = 1e-72
 Identities = 183/284 64%, Positives = 227/284 79%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKM AMK+EK+NA+DRAE  EQK RD   +  K EE++  LQKK   +EN++D V
Sbjct  1    MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNV 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
             E + +A TKLE  EK +   E +V+   R+I L+EEDLER+EERL+ AT +LEEAS AA
Sbjct  61   NEQLQEAMTKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE RS+ D+ER+D LE QLKEA+ +AEDA+RKYDE ARKLA+ E DLERAE
Sbjct  121  DESERGRKVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A QRE++YE+ IR +T +LK+AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+ISDELDQTFAEL GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 33. Allergen Name: Hal d 1 Sequence ID: AAG08987

 Score = 262.3 bits 1122,  Expect = 1e-71
 Identities = 180/284 63%, Positives = 225/284 79%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKM AMK+EK+NA+DRAE  EQK RD   +  K EE++  LQKK   +EN++D V
Sbjct  1    MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNV 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
             E + +A  KLE  EK +   E +V+   R+I L+EEDLER+EERL+ AT +LEEAS AA
Sbjct  61   NEQLQEAMAKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER  ++LE RS+ D+ER+D LE QLKEA+ +AEDA+RKYDE ARKLA+ E DLERAE
Sbjct  121  DESERGARVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A QRE++YE+ IR +T +LK+AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+ISDELDQTFAEL GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 34. Allergen Name: Aed a 10.0201 Sequence ID: Q17H80

 Score = 259.1 bits 1108,  Expect = 1e-70
 Identities = 177/284 62%, Positives = 234/284 82%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKMQAMKLEKDNA D+A+  E ++++ANL+A+K  EEV  L K++ Q+  + ++ 
Sbjct  1    MDAIKKKMQAMKLEKDNAADKADTCENQAKEANLRADKIMEEVAELTKRLTQVTEDHEKF 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
            + ++ QAN  LEEKEK L + E +VAAL R++Q +EEDLE+SEER   A +KL EA+++A
Sbjct  61   KNTLEQANKDLEEKEKLLTSTEANVAALTRKVQQVEEDLEKSEERSGAALSKLLEATQSA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DE+ RM K+LE+RS  DEERMD L NQLKEARM+AEDAD K DEV+RKLA VE +LE AE
Sbjct  121  DENNRMCKVLENRSQQDEERMDQLSNQLKEARMLAEDADGKSDEVSRKLAFVEDELEVAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            +R ++GE+KI+ELEEEL+VVGN+LKSLEVSE+KA QR E +++Q++ +T KLKEAE RAE
Sbjct  181  DRVKSGEAKIMELEEELKVVGNSLKSLEVSEDKANQRVEEFKRQLKSLTIKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
             AE++V+KLQKEVDRLED+L++EK+KYK+I D+LD TFAELTGY
Sbjct  241  NAEKNVKKLQKEVDRLEDKLMNEKDKYKAICDDLDSTFAELTGY 284

Sequence Alignment: 35. Allergen Name: Sac g 1.0101 Sequence ID: AVD53650

 Score = 252.5 bits 1079,  Expect = 1e-68
 Identities = 173/284 60%, Positives = 220/284 77%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M++IKKKM AMK+EK+NA DRAE  EQ+ RD   +  K EE++  LQKK   +ENE+D V
Sbjct  1    MDSIKKKMIAMKMEKENAQDRAEQLEQQLRDTEEQKAKIEEDLTTLQKKHSNLENEFDIV 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
             E +     K EE EK    +E ++ +LNRRIQL+EED+ERSEERL+ AT KLEEAS AA
Sbjct  61   NEKYQDCQAKYEEAEKKASESEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEASKAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE+ +   EER D LE QL EA+++AE+AD+KYDE ARKLA+ E DLERAE
Sbjct  121  DESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
             R E  E+K+++LEE+L VVGNN+K+L+V  ++A QRE++YE+ IR +T +LK+AE RA 
Sbjct  181  ARLEAAEAKVIDLEEQLSVVGNNIKTLQVQNDQASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+ISDELDQTFAEL GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 284

Sequence Alignment: 36. Allergen Name: Mim n 1 Sequence ID: AAG08989

 Score = 242.5 bits 1035,  Expect = 1e-65
 Identities = 170/284 59%, Positives = 210/284 73%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKMQAMK++++NA D AE  EQK +D      K EEE   LQKK+   EN  D V
Sbjct  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
             E + +ANTKLE  EK +   E DV  L RR+ L+EED ERSEE+L   T KLEEAS AA
Sbjct  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE RS + EER+D LE QL+ A+ +A DAD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
             R E  ++K++ELEEEL VVG N+K+L+V  ++A QRE++YE+ IR +T  LK+AE RA 
Sbjct  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
             AER V KLQKEVDRLEDEL+ EKE+YK+ISD+LDQTFAE+ GY
Sbjct  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284

Sequence Alignment: 37. Allergen Name: Sal s 4.0101 Sequence ID: NP_001117128

 Score = 235.9 bits 1006,  Expect = 1e-63
 Identities = 163/282 57%, Positives = 216/282 76%, Gaps = 0/282 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKMQ +KL+K+NA+DRAE AE   + A  K+++ E+++  LQKK++  E+ELD+ 
Sbjct  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
             ES+  A  KLE  EK    AE DVA+LNRRIQL+EE+L+R++ERL  A  KLEEA  AA
Sbjct  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER  K++E+R+  DEE+M+  + QLKEA+ +AE+ADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK  Q+E+ YE++I+++T KLKEAE RAE
Sbjct  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELT 282
            FAERSV KL+K +D LEDEL  +K KYK+IS+ELD  + ++T
Sbjct  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282

Sequence Alignment: 38. Allergen Name: Pan h 4.0201 Sequence ID: XP_026775428

 Score = 234.1 bits 998,  Expect = 5e-63
 Identities = 160/282 56%, Positives = 216/282 76%, Gaps = 0/282 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKMQ +KL+K+NA+DRAE AE   + A  ++++ E+++  LQKK++  E+ELD+ 
Sbjct  1    MDAIKKKMQMLKLDKENALDRAEQAESDKKAAEDRSKQLEDDLVALQKKLKGTEDELDKY 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
             E++  A  KLE  EK    AE DVA+LNRRIQL+EE+L+R++ERL  A  KLEEA  AA
Sbjct  61   SEALKDAQEKLELSEKKAADAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER  K++E+R++ DEE+M+  E QLKEA+ +AE+ADRKY+EVARKL +VE +LER E
Sbjct  121  DESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAE  E K  ELEEEL+ V N LKSLE   EK  Q+E+ YE++I+++T KLKEAE RAE
Sbjct  181  ERAELSEGKCAELEEELKTVTNTLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELT 282
            FAER+V KL+K +D LEDEL  +K KYK+IS+ELD+ + ++T
Sbjct  241  FAERTVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMT 282

Sequence Alignment: 39. Allergen Name: Per v 1 Sequence ID: AAG08988

 Score = 229.3 bits 977,  Expect = 1e-61
 Identities = 158/284 55%, Positives = 208/284 73%, Gaps = 0/284 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKKKM AMK+EK NA+DRAE  EQK R+      K E++   L KK  Q EN+ D  
Sbjct  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
               +     K E  EK +Q  E ++ +L R+I L+EE + ++EER+  A+ KLEEAS AA
Sbjct  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE+ +  ++ER+D LE QL EA+ +AE+AD+KY+E ARKLA+ E DLERAE
Sbjct  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
             R E  E+K+++LEE+L VVG N+K+L+V  ++A QRE++YE+ IR +T +LK+AE RA 
Sbjct  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+ISDELD TFAEL GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284

Sequence Alignment: 40. Allergen Name: Pan h 4.0101 Sequence ID: XP_026781482

 Score = 222.2 bits 946,  Expect = 2e-59
 Identities = 156/282 55%, Positives = 209/282 74%, Gaps = 0/282 0%
Query  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
            MEAIKKKMQ +K +K+NA DRAE AE   + +  K ++ E+E+ GLQKK++  E+E+D+ 
Sbjct  1    MEAIKKKMQMLKGDKENAFDRAEQAELDKKVSEDKCKQLEDELLGLQKKLKGTEDEVDKY 60
Query  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
             E++  A  KLE  EK    AEG+VAALNRRIQLIEE+L+R++ RL  A  KLEEA   A
Sbjct  61   SEALKDAQEKLELSEKKATDAEGEVAALNRRIQLIEEELDRAQGRLGTALQKLEEAEKQA 120
Query  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER  K++E+R++ DEE+M+  E QLKEA+ +AED+DRKYDEVARKL ++E +LERAE
Sbjct  121  DESERGMKVIENRAMKDEEKMEIQELQLKEAKQIAEDSDRKYDEVARKLVVIEGELERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
            ERAE  E K  +LEEEL+ V N LKSLE   EK   +E+ YE++I ++  KLKEAE RAE
Sbjct  181  ERAEVSELKSGDLEEELKNVTNTLKSLEAQAEKYSDKEDKYEEEINLLNEKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELT 282
            FAE++V KL+K +D LEDEL ++K K K+I +ELD  + ++T
Sbjct  241  FAEKTVSKLEKTIDDLEDELYNQKLKVKAICEELDNALNDMT 282

Sequence Alignment: 41. Allergen Name: Cra g 1 Sequence ID: AAK96889

 Score = 221.2 bits 941,  Expect = 3e-59
 Identities = 149/228 65%, Positives = 186/228 81%, Gaps = 0/228 0%
Query  57   LDQVQESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEA 116
            +D V E + +  TK+EE EK    AE ++ +LNRRIQL+EED+ERSEERL+ AT KLEEA
Sbjct  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
Query  117  SHAADESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADL 176
            S AADESER RK+LE+ +   EER D LE QL EA+++AE+AD+KYDE ARKLA+ E DL
Sbjct  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
Query  177  ERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAE 236
            ERAE R E  E+K++ELEEEL+VVGNN+KSLE+SE++A QRE++YE+ IR +T +LK+AE
Sbjct  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
Query  237  ARAEFAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK+ISDELDQTFAEL GY
Sbjct  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233

Sequence Alignment: 42. Allergen Name: Der f 11.0101 Sequence ID: AAK39511

 Score = 56.8 bits 221,  Expect = 3e-09
 Identities = 60/256 23%, Positives = 132/256 51%, Gaps = 8/256 3%
Query  6    KKMQAMKLEKDNAID-RAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQVQESF 64
            K+++ +KL+ DNA   + +IA+Q   D   + E+ E +   L+   + +E EL+ ++  +
Sbjct  127  KEVHEVKLQLDNANHLKTQIAQQL-EDTRHRLEEEERKRASLENHAHTLEVELESLKVQL 185
Query  65   TQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAADESE 124
             + +    E E+ L  A GD A+   +    E +L+   + ++    K+  A   ++  E
Sbjct  186  DEESEARLELERQLTKANGDAASWKSK---YEAELQAHADEVEELRRKM--AQKISEYEE 240
Query  125  RMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAE 184
            ++  +L   S + E++   L+++++   M  E A R   ++ +++A +E      + + E
Sbjct  241  QLEALLNKCS-SLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLE 299
Query  185  TGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAEFAER 244
                 + + ++ELRV    L+ L+   EK + + +   ++ + +T  L EA+++   A R
Sbjct  300  EVTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLNDAHR 359
Query  245  SVQKLQKEVDRLEDELVHEKEKYK 268
             +++ + E+ RLE+E       YK
Sbjct  360  RIHEQEIEIKRLENERDELSAAYK 383
 Score = 53.1 bits 205,  Expect = 3e-08
 Identities = 65/260 25%, Positives = 137/260 52%, Gaps = 17/260 6%
Query  6    KKMQAMKLEKDNAIDRA---EIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQVQE 62
            +K  A K E+  A+ +    EI +   R A  +A K + E+  L+KK Q    EL+   +
Sbjct  411  EKRLAQKDEEIEALRKQYQIEIEQLNMRLAEAEA-KLKTEIARLKKKYQAQITELELSLD 469
Query  63   SFTQANTKLEE--KEKALQTAE--GDVAALNRRIQLIEEDLERSEERLKVATAKLEEASH 118
            +  +AN  L++  K++ALQ  E       ++R++Q   + L  ++ R +   A+LEE   
Sbjct  470  AANKANIDLQKTIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEMRI 529
Query  119  AADESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLER 178
            A +++ R ++  E+     EE +  + N+L    +    A  K +    +++ ++AD + 
Sbjct  530  ALEQANRAKRQAEQ---LHEEAVVRV-NELTTINVNLASAKSKLES---EFSALQADYDE 582
Query  179  AEERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEAR 238
              +     + ++ +L  EL+   + L   +    K +  +++ EQ++R +  +++E EA 
Sbjct  583  VHKELRISDERVQKLTIELKSTKDLLIEEQERLVKLETVKKSLEQEVRTLHVRIEEVEAN 642
Query  239  A-EFAERSVQKLQKEVDRLEDELVHEKEKYKSISDEL 274
            A    +R + KL+  +  +E E V E+ +  + +D++
Sbjct  643  ALAGGKRVIAKLESRIRDVEIE-VEEERRRHAETDKM 678

Sequence Alignment: 43. Allergen Name: Der p 11 Sequence ID: AAO73464

 Score = 55.6 bits 216,  Expect = 7e-09
 Identities = 78/256 30%, Positives = 130/256 50%, Gaps = 26/256 10%
Query  5    KKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIEN---ELDQVQ 61
            K+K QA  +E    + + E A ++   A    EK E  V  L  KI++I     EL   +
Sbjct  145  KQKFQAEVFE---LLSQLETANKEKLTALKSVEKLEYTVHELNIKIEEINRTVIELTSHK 201
Query  62   ESFTQANTKLEEKEKALQTAEGDVAALNRRI-QLIEEDLERSEERLKVATAKLEEASHAA 120
            + +TQ NT+L ++   ++    +   L ++I Q +E+   R EE  +   + LE  +H  
Sbjct  202  QRLTQENTELIKEVHEVKLQLDNANHLKQQIAQQLEDTRHRLEEEER-KRSSLENHAHTL 260
Query  121  D-ESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERA 179
            + E E ++  L+  S   E R++ LE QL +A   A     KY+      A ++A  +  
Sbjct  261  EVELESLKVQLDDES---EARLE-LERQLTKANGDAASWKSKYE------AELQAHADEV 310
Query  180  EERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARA 239
            EE       KI E EE+L  + N   SL    EK + R    + ++ ++   L++A A A
Sbjct  311  EELRRKMAQKISEYEEQLEALLNKCSSL----EKQKSR---LQSEVEVLIMDLEKAAAHA 363
Query  240  EFAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAEL 281
            +  E+ V +L+K    L+D+L       +    EL     EL
Sbjct  364  QQLEKRVAQLEKINLDLKDKLEEVTMLMEQAQKELRIKIGEL 405

Sequence Alignment: 44. Allergen Name: Rap v 2.0101 Sequence ID: QPB41107

 Score = 54.9 bits 213,  Expect = 1e-08
 Identities = 84/256 32%, Positives = 142/256 55%, Gaps = 45/256 17%
Query  1    MEAIKKKMQAMKLEKDNA-----IDRAEIAEQKSRDAN------LKAEKSEEEVRGLQKK 49
            ME +K++MQ    E ++      +  + + + K++ AN      ++ E ++  V+ L K+
Sbjct  306  MEDLKRRMQVRITELEDTCEQLRVKNSSLEKAKTKLANEIKEITIELENTQIIVQDLTKR 365
Query  50   IQQIENELDQVQ---ESFTQANTKLEEKEKALQTAEGDVAAL---NRRIQLIEEDLERSE 103
             +Q+ENE   +Q   E +T  N  L   EKAL   E DV  L   N  +    ++L+R  
Sbjct  366  NRQLENENAGLQRRIEELTGENNTLRN-EKAL--LEQDVQKLRVSNAELTERNDNLQREN 422
Query  104  ERLKVATAKLEEASHAADESER-MRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKY 162
            + L   + +L EA+ A  ++ R +  + + RS  + ER D L   LK+      DA+ K 
Sbjct  423  KHL---SDQLREANLALKDANRELADLRQLRSQLEAER-DSLAAALKDTEEALRDAEAKL 478
Query  163  DEVARKLAMVEADLE-RAEERAETGES-------KIVELEEELRVVGNNLKSLEVSEEKA 214
                  L  ++ D+E R  E+ E  E+        I EL+  L  V    K+ E+S  K 
Sbjct  479  ASAQAALNQLKIDMENRLREKDEEIENVRRSSARAIEELQRTLVEVETRYKT-EISRMKK 537
Query  215  QQREEAYEQQIRIMTAKLKEAE-ARAEFAERSVQKLQKEVDRLEDELVHEKEKYKSISDE 273
            +     +E  IR + A L  A  A +E+  + ++ LQ+ V  LE  L    E+ + +SD+
Sbjct  538  K-----FESDIRELEAALDNANRANSEYL-KQIKSLQQRVKELETLL----EEERRVSDD 587
Query  274  L 274
            L
Sbjct  588  L 588

Sequence Alignment: 45. Allergen Name: Blo t 11 Sequence ID: AAM83103

 Score = 52.4 bits 202,  Expect = 7e-08
 Identities = 56/256 21%, Positives = 129/256 50%, Gaps = 8/256 3%
Query  6    KKMQAMKLEKDNAID-RAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQVQESF 64
            K+++  K+  DNA   + +IA+Q   D   + E  E +   L+   + +E EL+ ++  +
Sbjct  213  KEVHEYKISLDNANHLKGQIAQQL-EDTRHRLEDEERKRSSLENHAHTLEVELESLKVQL 271
Query  65   TQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAADESE 124
             + +    E E+ L  A GD A+   +    E +L+   + ++    K+  A   ++  E
Sbjct  272  EEESEARLELERQLTKANGDAASWKSK---YEAELQAHVDEVEELRRKM--AQKISEYGE 326
Query  125  RMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAE 184
            ++  +L   S  ++++   L+++++   M  E A      + ++++ +E      + + E
Sbjct  327  QLEALLNKCSALEKQKAR-LQSEVEVLIMDLEKATAHAQALEKRVSQLEKINLDLKSKLE 385
Query  185  TGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAEFAER 244
                 + + +++LRV   +L+ L+   EK + ++EA  ++ + +   L EA+++   A R
Sbjct  386  EVSMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAHR 445
Query  245  SVQKLQKEVDRLEDELVHEKEKYK 268
             +++ + E+ RLE+E       YK
Sbjct  446  RIHEQEIEIKRLENEREELAAAYK 469
 Score = 42.4 bits 158,  Expect = 7e-05
 Identities = 61/254 24%, Positives = 132/254 51%, Gaps = 16/254 6%
Query  6    KKMQAMKLEKDNAIDRA---EIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQVQE 62
            +K  A K E+  A+ +    EI +   R A  +A K + EV  L+KK Q    EL+   +
Sbjct  497  EKRLAQKEEEIEALRKQYQIEIEQLNMRLAEAEA-KLKTEVARLKKKYQAQITELELSLD 555
Query  63   SFTQANTKLEE--KEKALQTA--EGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASH 118
            +  +AN  L++  K++ALQ    +     ++R++Q   + L  ++ R +  TA+LEE   
Sbjct  556  AANKANIDLQKTIKKQALQITGLQAHYDEVHRQLQQAVDQLGVTQRRCQALTAELEEMRV 615
Query  119  AADESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLER 178
              +++ R ++  E+     EE +  + N+L    +    A  K +    +++ ++ D + 
Sbjct  616  NLEQALRAKRAAEQ---MHEEAVVRV-NELTTINVNLASAKSKLET---EFSALQNDYDE 668
Query  179  AEERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEAR 238
              +     + ++ +L  E++   + L+S      K +  +++ E ++R +  +++E EA 
Sbjct  669  VHKELRISDERVQKLTIEVKSTKDLLESETERVTKLETIKKSLETEVRNLQIRIEEVEAN 728
Query  239  A-EFAERSVQKLQKEVDRLEDELVHEKEKY 267
            A    +R + KL+  +  +E E+  E+ ++
Sbjct  729  ALAGGKRVIAKLESRIRDVEIEVEEERRRH 758

Sequence Alignment: 46. Allergen Name: Ani s 2 Sequence ID: AAF72796

 Score = 49.9 bits 191,  Expect = 4e-07
 Identities = 71/244 29%, Positives = 129/244 52%, Gaps = 31/244 12%
Query  10   AMKLEKDNAIDRA--EIAEQKSR-DANLKAEKSEEEVRGLQKKIQQIENELDQVQESFTQ 66
            A ++E ++ +  A  EI + KS+ DA +      EEV  L+KK+ Q + E ++  E   Q
Sbjct  278  AARVEAEHKLSLANTEITQWKSKFDAEVALH--HEEVEDLRKKMMQKQAEYEEQIEIMLQ 335
Query  67   ANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKV-ATAKLEEASHAADESER 125
              ++LE+ +  LQ+           ++++  DLE+++  + +   AK +   +  +   R
Sbjct  336  KVSQLEKAKARLQS----------EVEVLIVDLEKAQNTIAILERAKEQLEKQVLEMKSR 385
Query  126  MRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAET 185
            + ++L        E    L  +L++ + + E A  + + +AR+   ++ DL  A E    
Sbjct  386  IDELLVELEAAQREARAALA-ELQKMKQLYEKAVEQKEALARENKKLQDDLHEANEALAD 444
Query  186  GESKIVELE-EELRVVGN------NLKSLEVSEEKAQ---QREEAYEQQIRI-MTAKLKE 234
               K+ EL+ E  R+ G        LK  E +   A+   QR  A  QQ+RI M  +L+E
Sbjct  445  ANRKLHELDLENARLAGEIRDLQVALKESEAARRDAEARAQRALAELQQVRIEMERRLQE 504
Query  235  AEARAEFAERSVQKLQKEVDRLEDELVHEKEKYKS 269
             E   E   +S   +Q E+DRL   L   + + K+
Sbjct  505  KEEEMEALRKS---MQFEIDRLTAALADAEARMKA 536
 Score = 41.5 bits 154,  Expect = 0.0001
 Identities = 61/216 28%, Positives = 116/216 53%, Gaps = 32/216 14%
Query  42   EVRGLQKKIQQIENELDQVQESFTQANTKLEE--KEKALQTAE--GDVAALNRRIQLIEE 97
            E+  L+KK Q    EL+   +++ +AN + ++  K+++ Q  +   ++    R++Q   +
Sbjct  537  EIARLRKKYQAEIAELEMTVDNLNRANLEAQKTIKKQSEQIIQLQANLEDTQRQLQQTLD 596
Query  98   DLERSEERLKVATAKLEEASHAADESERMRKMLE------HRSITD----EERMDGLENQ 147
                ++ ++   +A+LEE   A D + R RK  E      H  I+D       +  ++N+
Sbjct  597  QYALAQRKISALSAELEECKTALDNAIRARKQAEADLEEAHVRISDLTSINSNLTAIKNK 656
Query  148  LKEARMMAEDADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVVGNNLKSL 207
            L E  +    AD   DEV ++L    AD ERA          + EL EE         S+
Sbjct  657  L-ETELSTAQAD--LDEVTKELHA--AD-ERANRALADAARAVQELHEEQE------HSM 704
Query  208  EVSEEKAQQREEAYEQQIRIMTAKLKEAEARAEFA-ERSVQKLQKEVDRLEDELVHEKEK 266
            ++   +     ++ E+Q++ +  +++EAEA A +  +R + KL+  +  LE  L  E  +
Sbjct  705  KIDALR-----KSLEEQVKQLQVQIQEAEAAALLGGKRVIAKLETRIRDLEVALDEETRR 759
Query  267  YKSISDEL 274
            +K     L
Sbjct  760  HKETQSAL 767

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.