The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV
QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA
DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE
ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE
FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9NFZ4 Lep d 10 284 1722 399.1 9.5e-113
AEX31649 Cho a 10.0101 284 1664 385.9 9e-109
ABU97466 Blo t 10.0101 284 1662 385.4 1.2e-108
O18416 Der p 10 284 1656 384.1 3.2e-108
BAA04557 Der f 10.0101 299 1655 383.8 4e-108
AAT40866 Tyr p 10.0101 284 1629 377.9 2.3e-106
O44119 Hom a 1.0101 284 1445 336.0 9.6e-94
A7L5V2 Scy p 1.0101 284 1442 335.3 1.5e-93
AAC48288 Hom a 1.0102 284 1440 334.8 2.1e-93
CBY17558 Pan b 1.0101 284 1428 332.1 1.4e-92
M1H607 Por p 1.0101 284 1425 331.4 2.3e-92
EU410072 Lit v 1.0101 284 1424 331.2 2.7e-92
AAX37288 Pen m 1 284 1424 331.2 2.7e-92
11893851 Pen a 1 284 1424 331.2 2.7e-92
C0LU07 Pro c 1.0101 284 1422 330.7 3.6e-92
D3XNR9 Mac r 1.0101 284 1420 330.3 5e-92
M4M2H6 Mel l 1.0101 284 1403 326.4 7.3e-91
AAD19606 Per a 7.0102 284 1390 323.4 5.7e-90
NP_001103782 Bomb m 3.0101 285 1387 322.7 9.2e-90
O61379 Pan s 1 274 1386 322.5 1e-89
AAF72534 Bla g 7.0101 284 1386 322.5 1.1e-89
Q9UB83 Per a 7 284 1383 321.8 1.7e-89
Q25456 Met e 1 274 1375 320.0 5.9e-89
Q17H75 Aed a 10.0101 285 1355 315.4 1.4e-87
Q9N2R3 Cha f 1 264 1322 308.0 2.4e-85
Q9NAS5 Ani s 3 284 1319 307.2 4.3e-85
ACN32322 Asc l 3.0101 287 1315 306.3 8.1e-85
CAA09938 Chi k 10 285 1313 305.9 1.1e-84
AGM32377.1 Copt f 7.0101 256 1221 284.9 2e-78
CAB38044 Hel as 1 284 1136 265.5 1.5e-72
CAC84590 Lep s 1 284 1134 265.1 2.1e-72
APG42675 Hal l 1.0101 284 1121 262.1 1.6e-71
AAG08987 Hal d 1 284 1104 258.2 2.4e-70
Q17H80 Aed a 10.0201 284 1101 257.5 3.9e-70
AVD53650 Sac g 1.0101 284 1050 245.9 1.2e-66
AAG08989 Mim n 1 284 1015 237.9 3.1e-64
NP_001117128 Sal s 4.0101 284 998 234.1 4.5e-63
XP_026775428 Pan h 4.0201 284 995 233.4 7.3e-63
XP_026781482 Pan h 4.0101 284 961 225.6 1.6e-60
AAG08988 Per v 1 284 958 225.0 2.5e-60
AAK96889 Cra g 1 233 920 216.4 7.9e-58
AAK39511 Der f 11.0101 692 232 59.3 4.6e-10
AAO73464 Der p 11 875 227 58.1 1.3e-09
QPB41107 Rap v 2.0101 859 217 55.8 6.2e-09
AAM83103 Blo t 11 875 212 54.7 1.4e-08
AAF72796 Ani s 2 869 195 50.8 2e-07
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Lep d 10 Sequence ID: Q9NFZ4

 Score = 399.1 bits 1722,  Expect = 9e-113
 Identities = 284/284 100%, Positives = 284/284 100%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV
Sbjct  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 2. Allergen Name: Cho a 10.0101 Sequence ID: AEX31649

 Score = 385.9 bits 1664,  Expect = 9e-109
 Identities = 272/284 95%, Positives = 281/284 98%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            MEAIK KMQAMKLEKDNAIDRAEIAEQKSRDANL+AEKSEEEVRGLQKKIQQIENELDQV
Sbjct  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            QES+TQANTKLEEKEK+LQTAEGDVAALNRRIQLIEEDLERSE RLK+AT+KLEEAS++A
Sbjct  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRKMLEHRSITDEERM+GLE+QLKEARMMAEDADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMT KLKEAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 3. Allergen Name: Blo t 10.0101 Sequence ID: ABU97466

 Score = 385.4 bits 1662,  Expect = 1e-108
 Identities = 273/284 96%, Positives = 280/284 98%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            MEAIK KMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVR LQKKIQQIENELDQV
Sbjct  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSE RLK+AT+KLEEAS+SA
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRKMLEHRSITDEERM+GLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIR+MT KLKEAEARAE
Sbjct  181  ERAETGETKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRMMTGKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSV+KLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY
Sbjct  241  FAERSVRKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 4. Allergen Name: Der p 10 Sequence ID: O18416

 Score = 384.1 bits 1656,  Expect = 3e-108
 Identities = 273/284 96%, Positives = 279/284 98%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            MEAIKNKMQAMKLEKDNAIDRAEIAEQK+RDANLRAEKSEEEVR LQKKIQQIENELDQV
Sbjct  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            QE L+ ANTKLEEKEK+LQTAEGDVAALNRRIQLIEEDLERSE RLKIAT+KLEEASQSA
Sbjct  61   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRKMLEHRSITDEERMEGLE+QLKEARMMAEDADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMEGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEA+EQQIRIMTTKLKEAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAHEQQIRIMTTKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEV RLEDELVHEKEKYKSISDELDQTFAELTGY
Sbjct  241  FAERSVQKLQKEVGRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 5. Allergen Name: Der f 10.0101 Sequence ID: BAA04557

 Score = 383.8 bits 1655,  Expect = 4e-108
 Identities = 272/284 95%, Positives = 278/284 97%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            MEAIK KMQAMKLEKDNAIDRAEIAEQK+RDANLRAEKSEEEVR LQKKIQQIENELDQV
Sbjct  16   MEAIKKKMQAMKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 75
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            QE L+ ANTKLEEKEK+LQTAEGDVAALNRRIQLIEEDLERSE RLKIAT+KLEEASQSA
Sbjct  76   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSA 135
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRKMLEHRSITDEERM+GLE+QLKEARMMAEDADRKYDEVARKLAMVEADLERAE
Sbjct  136  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 195
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMT KLKEAEARAE
Sbjct  196  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 255
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY
Sbjct  256  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 299

Sequence Alignment: 6. Allergen Name: Tyr p 10.0101 Sequence ID: AAT40866

 Score = 377.9 bits 1629,  Expect = 2e-106
 Identities = 265/284 93%, Positives = 280/284 98%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIKNKMQAMKLE+DNAIDRAEIAEQK+RDANL++EK+EEEVR LQKKIQQIENELDQV
Sbjct  1    MDAIKNKMQAMKLEEDNAIDRAEIAEQKARDANLKSEKTEEEVRALQKKIQQIENELDQV 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            QE+LTQA TKLEEKEK+LQTAE DVAALNRRIQLIEEDLERSE RLK+AT+KLEEAS+SA
Sbjct  61   QENLTQATTKLEEKEKALQTAEADVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRKMLEHRSITDEERM+GLESQLKEAR+MAEDADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLESQLKEARLMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMT+KLKEAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTSKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELVHEKEKY+SISDELDQTFAELTGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYESISDELDQTFAELTGY 284

Sequence Alignment: 7. Allergen Name: Hom a 1.0101 Sequence ID: O44119

 Score = 336.0 bits 1445,  Expect = 1e-93
 Identities = 230/284 80%, Positives = 265/284 93%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQAMKLEKDNA+DRA+  EQ++++AN+RAEK+EEE+R  +KK+QQ+ENELDQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKTEEEIRITHKKMQQVENELDQV 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            QE L+ ANTKLEEKEK+LQ AEG+VAALNRRIQL+EEDLERSE RL  AT+KL EASQ+A
Sbjct  61   QEQLSLANTKLEEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERM+ LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +  KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 8. Allergen Name: Scy p 1.0101 Sequence ID: A7L5V2

 Score = 335.3 bits 1442,  Expect = 2e-93
 Identities = 228/284 80%, Positives = 263/284 92%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQAMKLEKDNA+DRA+  EQ++++ANLRAEK+EEE+R  QKK+QQ+ENELDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            QE L+ ANTKL+EKEK+LQ AEG+VAALNRRIQL+EEDLERSE RL  AT+KL EASQ+A
Sbjct  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERM+ LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKA QREE Y++QI+ +  KLK AEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 9. Allergen Name: Hom a 1.0102 Sequence ID: AAC48288

 Score = 334.8 bits 1440,  Expect = 2e-93
 Identities = 229/284 80%, Positives = 265/284 93%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQAMKLEKDNA+DRA+  EQ++++AN+RAEKSEEEV  LQK++QQ+EN+LDQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            QESL +ANT+LEEK+K+L  AEG+VAALNRRIQL+EEDLERSE RL  AT+KL EASQ+A
Sbjct  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERM+ LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +  KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 10. Allergen Name: Pan b 1.0101 Sequence ID: CBY17558

 Score = 332.1 bits 1428,  Expect = 1e-92
 Identities = 229/284 80%, Positives = 263/284 92%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQAMKLEKDNA+DRA+  EQ++++AN RAEKSEEEV GLQKK+QQ+EN+LD V
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVFGLQKKLQQLENDLDSV 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            QE+L +AN  LEEK+K+L  AEG+VAALNRRIQL+EEDLERSE RL  AT+KL EASQ+A
Sbjct  61   QEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERM+ LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 11. Allergen Name: Por p 1.0101 Sequence ID: M1H607

 Score = 331.4 bits 1425,  Expect = 2e-92
 Identities = 226/284 79%, Positives = 264/284 92%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQAMKLEKD+A+DRA+  EQ++++AN+RAEK+EEEV  LQK++QQ+EN+LDQV
Sbjct  1    MDAIKKKMQAMKLEKDDAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQV 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            QESL +ANT+LEEK+K+L  AEG+VAALNRRIQL+EEDLERSE RL  AT+KL EASQ+A
Sbjct  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERM+ LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKS +DELDQ F+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSTTDELDQAFSELSGY 284

Sequence Alignment: 12. Allergen Name: Lit v 1.0101 Sequence ID: EU410072

 Score = 331.2 bits 1424,  Expect = 3e-92
 Identities = 228/284 80%, Positives = 263/284 92%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQAMKLEKDNA+DRA+  EQ++++AN RAEKSEEEV  LQK++QQ+EN+LDQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            QESL +AN +L EK+K+L  AEG+VAALNRRIQL+EEDLERSE RL  AT+KL EASQ+A
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERM+ LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 13. Allergen Name: Pen m 1 Sequence ID: AAX37288

 Score = 331.2 bits 1424,  Expect = 3e-92
 Identities = 228/284 80%, Positives = 263/284 92%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQAMKLEKDNA+DRA+  EQ++++AN RAEKSEEEV  LQK++QQ+EN+LDQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            QESL +AN +L EK+K+L  AEG+VAALNRRIQL+EEDLERSE RL  AT+KL EASQ+A
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERM+ LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 14. Allergen Name: Pen a 1 Sequence ID: 11893851

 Score = 331.2 bits 1424,  Expect = 3e-92
 Identities = 228/284 80%, Positives = 263/284 92%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQAMKLEKDNA+DRA+  EQ++++AN RAEKSEEEV  LQK++QQ+EN+LDQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            QESL +AN +L EK+K+L  AEG+VAALNRRIQL+EEDLERSE RL  AT+KL EASQ+A
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERM+ LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 15. Allergen Name: Pro c 1.0101 Sequence ID: C0LU07

 Score = 330.7 bits 1422,  Expect = 4e-92
 Identities = 226/284 79%, Positives = 264/284 92%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQA KLEKDNA+DRA+  EQ++++AN+RAEK+EEEV  LQK++Q++EN+LDQV
Sbjct  1    MDAIKKKMQATKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQHLENDLDQV 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            QESL +ANT+LEEK+K++  AEG+VAALNRRIQL+EEDLERSE RL  AT+KL EASQ+A
Sbjct  61   QESLLKANTQLEEKDKAISNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERM+ LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +  KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+ELTGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELTGY 284

Sequence Alignment: 16. Allergen Name: Mac r 1.0101 Sequence ID: D3XNR9

 Score = 330.3 bits 1420,  Expect = 5e-92
 Identities = 227/284 79%, Positives = 262/284 92%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQAMKLEKDNA+DRA+  EQ++++AN RAEKSEEEV  LQK++QQ+EN+LD V
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDSV 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            QE+L +AN  LEEK+K+L  AEG+VAALNRRIQL+EEDLERSE RL  AT+KL EASQ+A
Sbjct  61   QEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERM+ LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 17. Allergen Name: Mel l 1.0101 Sequence ID: M4M2H6

 Score = 326.4 bits 1403,  Expect = 7e-91
 Identities = 224/284 78%, Positives = 262/284 92%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQAMKLEKDNA+DRA+  EQ++++AN+RAEK+E++V  LQKK+QQ+EN++DQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            QE+L  ANT   EK+K+L  AEG+VAALNRRIQL+EEDLERSE RL  AT+KL EASQ+A
Sbjct  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERM+ LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 18. Allergen Name: Per a 7.0102 Sequence ID: AAD19606

 Score = 323.4 bits 1390,  Expect = 6e-90
 Identities = 224/283 79%, Positives = 251/283 88%, Gaps = 0/283 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQAMKLEKDNA+DRA + EQ++RDANLRAEK+EEE R LQKKIQQIEN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
             E L Q N KL+EK+K+LQ AE +VAALNRRIQL+EEDLERSE RL  AT+KL EASQ+A
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE + + DEERM+ LE+QLKEAR MAE+AD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKA  REE Y+QQI+ +TT+LKEAEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTG 283
            FAERSVQKLQKEVDRLEDELVHEKEKYK I D+LD TF EL G
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTELIG 283

Sequence Alignment: 19. Allergen Name: Bomb m 3.0101 Sequence ID: NP_001103782

 Score = 322.7 bits 1387,  Expect = 9e-90
 Identities = 225/281 80%, Positives = 251/281 89%, Gaps = 0/281 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQAMKLEKDNA+DRA + EQ+++DANLRAEK+EEE R LQKKIQ IENELDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            QESL Q N KLEEKEK+LQ AE +VAALNRRIQL+EEDLERSE RL  AT+KL EASQ+A
Sbjct  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE+RS+ DEERM+ LE+QLKEAR +AE+AD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKA QREE Y+ QI+ +TT+LKEAEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAEL 281
            FAERSVQKLQKEVDRLEDELV EKEKYK I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281

Sequence Alignment: 20. Allergen Name: Pan s 1 Sequence ID: O61379

 Score = 322.5 bits 1386,  Expect = 1e-89
 Identities = 220/274 80%, Positives = 256/274 93%, Gaps = 0/274 0%
Query  11   MKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQVQESLTQANTK 70
            MKLEKDNA+DRA+  EQ++++AN+RAEK+EEEV  LQK++QQ+EN+LDQVQESL +ANT+
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
Query  71   LEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSADESERMRKML 130
            LEEK+K+L  AEG+VAALNRRIQL+EEDLERSE RL  AT+KL EASQ+ADESERMRK+L
Sbjct  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  131  EHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAETGESKI 190
            E+RS++DEERM+ LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAEERAETGESK 
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
Query  191  VELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAEFAERSVQKLQ 250
            VELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAEFAERSVQKLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  251  KEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            KEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 21. Allergen Name: Bla g 7.0101 Sequence ID: AAF72534

 Score = 322.5 bits 1386,  Expect = 1e-89
 Identities = 223/283 78%, Positives = 250/283 88%, Gaps = 0/283 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQAMKLEKDNA+DRA + EQ++RDAN+RAEK+EEE R LQKKIQQIEN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
             E L Q N KL+EK+K+LQ AE +VAALNRRIQL+EEDLERSE RL  AT+KL EASQ+A
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE + + DEERM+ LE+QLKEAR MAE+AD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA  REE Y+QQI+ + T+LKEAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTG 283
            FAERSVQKLQKEVDRLEDELVHEKEKYK I D+LD TF EL G
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKYICDDLDMTFTELIG 283

Sequence Alignment: 22. Allergen Name: Per a 7 Sequence ID: Q9UB83

 Score = 321.8 bits 1383,  Expect = 2e-89
 Identities = 223/284 78%, Positives = 250/284 88%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQAMKLEKDNA+D A + EQ++RDANLRAEK+EEE R LQKKIQQIEN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDCALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
             E L Q N KL+EK+K+LQ AE +VAALNRRIQL+EEDLERSE RL  AT+KL EASQ+ 
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAV 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE + + DEERM+ LE+QLKEAR MAE+AD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKA  REE Y+QQI+ +TT+LKEAEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELVHEKEKYK I D+LD TF EL GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTELAGY 284

Sequence Alignment: 23. Allergen Name: Met e 1 Sequence ID: Q25456

 Score = 320.0 bits 1375,  Expect = 6e-89
 Identities = 220/274 80%, Positives = 254/274 92%, Gaps = 0/274 0%
Query  11   MKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQVQESLTQANTK 70
            MKLEKDNA+DRA+  EQ++++AN RAEKSEEEV  LQK++QQ+EN+LDQVQESL +AN +
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
Query  71   LEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSADESERMRKML 130
            L EK+K+L  AEG+VAALNRRIQL+EEDLERSE RL  AT+KL EASQ+ADESERMRK+L
Sbjct  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  131  EHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAETGESKI 190
            E+RS++DEERM+ LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAEERAETGESKI
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
Query  191  VELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAEFAERSVQKLQ 250
            VELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAEFAERSVQKLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  251  KEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            KEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 24. Allergen Name: Aed a 10.0101 Sequence ID: Q17H75

 Score = 315.4 bits 1355,  Expect = 1e-87
 Identities = 220/281 78%, Positives = 247/281 87%, Gaps = 0/281 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQAMKLEKDNA+DRA + EQ++RDANLRAEK+EEE R LQKKIQ IEN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRALLCEQQARDANLRAEKAEEEARQLQKKIQAIENDLDQT 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            QE+L   N KLEEKEK+LQ AE +VAALNRRIQL+EEDLERSE RL  AT+KL EAS +A
Sbjct  61   QEALMAVNAKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLASATAKLSEASAAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE+R++ DEERM+ LE+QLKEAR MAE+AD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKVLENRALADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAE GE KIVELEEELRVVGNNLKSLEVSEEKA QREE Y+ QI+ +TT+LKEAEARAE
Sbjct  181  ERAEAGEGKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAEL 281
            FAERSVQKLQKEVDRLEDELV EKEKY+ I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVMEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 25. Allergen Name: Cha f 1 Sequence ID: Q9N2R3

 Score = 308.0 bits 1322,  Expect = 2e-85
 Identities = 211/264 79%, Positives = 242/264 91%, Gaps = 0/264 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQAMKLEKDNA+DRA+  EQ++++ANLRAEK+EEE+R  QKK+QQ+ENELDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            QE L+ ANTKL+EKEK+LQ AEG+VAALNRRIQL EEDLERSE RL  AT+KL EASQ+A
Sbjct  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLPEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERM+ LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKA QREE Y++QI+ +  KLK AEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEK 264
            FAERSVQKLQKEVDRLEDELV+EK
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEK 264

Sequence Alignment: 26. Allergen Name: Ani s 3 Sequence ID: Q9NAS5

 Score = 307.2 bits 1319,  Expect = 4e-85
 Identities = 209/284 73%, Positives = 251/284 88%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQAMK+EKDNA+DRA+ AE+K R    + E+ EEE+R  QKK+ Q EN+LD+ 
Sbjct  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            QE L+ AN+ LEEKEK +Q AE +VAALNRR+ L+EE+LER+E RLK+AT+KLEEA+++A
Sbjct  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER+RK++E+RS  DEER   +ESQLKEA+M+AE+ADRKYDEVARKL MVEADLERAE
Sbjct  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++YE+QIR ++ +LKEAE RAE
Sbjct  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELVHEKE+YKSIS+ELDQTF EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 27. Allergen Name: Asc l 3.0101 Sequence ID: ACN32322

 Score = 306.3 bits 1315,  Expect = 8e-85
 Identities = 209/284 73%, Positives = 250/284 88%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQAMK+EKDNA+DRA+ AE+K R    + E+ EEE+R  QKK+ Q EN+LD+ 
Sbjct  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            QE L+ AN+ LEEKEK +Q AE +VAALNRR+ L+EE+LER+E RLK+AT KLEEA+++A
Sbjct  61   QEDLSVANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATEKLEEATHTA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER+RK++E+RS  DEER   +ESQLKEA+M+AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAE GE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++YE+QIR ++ +LKEAE RAE
Sbjct  181  ERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            FAERSVQKLQKEVDRLEDELVHEKE+YKSIS+ELDQTF EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 28. Allergen Name: Chi k 10 Sequence ID: CAA09938

 Score = 305.9 bits 1313,  Expect = 1e-84
 Identities = 215/281 76%, Positives = 243/281 86%, Gaps = 0/281 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQAMKLEKDNA+DRA + E ++RDANLRAEK+EEE R LQKKIQ IEN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRALLCENQARDANLRAEKAEEEARTLQKKIQTIENDLDQT 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            Q   T  N KLE KEK+LQ AE +VAALNRRIQL+ EDL+RSE RL  AT+KL EAS +A
Sbjct  61   QGQETLVNGKLEGKEKALQNAESEVAALNRRIQLLGEDLDRSEERLASATAKLSEASAAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE+RS+ DEERM+ LE+QLKEAR +AE+AD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAE GE+KIVELEEELRVVGNNLKSLEVSEEKA QREE Y+ QI+ +TT+LKEAEARAE
Sbjct  181  ERAEAGEAKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAEL 281
            FAERSVQKLQKEVDRLEDELV EKEKY+ I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVSEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 29. Allergen Name: Copt f 7.0101 Sequence ID: AGM32377.1

 Score = 284.9 bits 1221,  Expect = 2e-78
 Identities = 197/251 78%, Positives = 223/251 88%, Gaps = 0/251 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQAMKLEKDN +DRA + EQ++RDANLRAEK+EEE R LQKKIQQIEN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNTMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
             E L Q N KL+EK+K+LQ AE +VAALNRRIQL+EEDLERSE RL  AT+KL EASQ+A
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE + + DEERM+ LE+QLKEAR MAE+AD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKA  REE Y+QQI+ +TT+LKEAEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQK 251
            FAERSVQKLQK
Sbjct  241  FAERSVQKLQK 251

Sequence Alignment: 30. Allergen Name: Hel as 1 Sequence ID: CAB38044

 Score = 265.5 bits 1136,  Expect = 2e-72
 Identities = 182/284 64%, Positives = 225/284 79%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KM AMK+EK+NA+DRAE  EQK RD      K EE++  LQKK   +EN++D +
Sbjct  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
             E L  ANTKLE  EK     E + A L RRIQL+EEDLERSE RL+ AT KLEEAS++A
Sbjct  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE RS+ D+ER++GLE+QLKEA+ +AEDA+RK+DE ARKLA+ E DLERAE
Sbjct  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A QRE++YE+ IR +T +LK+AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+ SDELD TFAEL GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284

Sequence Alignment: 31. Allergen Name: Lep s 1 Sequence ID: CAC84590

 Score = 265.1 bits 1134,  Expect = 2e-72
 Identities = 181/284 63%, Positives = 236/284 83%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            MEAIK KMQAMKLEKDNA+D+A+  E ++RDAN +A+K  EEV+ L+KK  Q+E ++   
Sbjct  1    MEAIKKKMQAMKLEKDNAMDKADALEAQARDANRKADKILEEVQDLKKKPSQVETDFTTT 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            +E+L  AN  LE+KEK+L   E +VA+LNR++Q+IEE+LERSE RL  A +KL EAS++A
Sbjct  61   KENLATANKNLEDKEKTLTNTESEVASLNRKVQMIEENLERSEERLGTALTKLGEASHAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DE+ RM K+LE+RS  DEERM+ L +QLKEARM+AEDAD K DEV+RK+A VE DLE AE
Sbjct  121  DEASRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADGKSDEVSRKMAQVEDDLEVAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            +R ++G+SKI+ELEEEL+VVGN+LKSLEVSEEKA QR E Y++QI+ +T KLKEAEARAE
Sbjct  181  DRVKSGDSKIMELEEELKVVGNSLKSLEVSEEKANQRVEEYKRQIKTLTVKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
            +AE+ V+KLQKEVDRLEDEL   K++Y++++DE+DQTFAEL+GY
Sbjct  241  YAEKYVKKLQKEVDRLEDELGINKDRYRALADEMDQTFAELSGY 284

Sequence Alignment: 32. Allergen Name: Hal l 1.0101 Sequence ID: APG42675

 Score = 262.1 bits 1121,  Expect = 2e-71
 Identities = 180/284 63%, Positives = 227/284 79%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KM AMK+EK+NA+DRAE  EQK RD   +  K EE++  LQKK   +EN++D V
Sbjct  1    MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNV 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
             E L +A TKLE  EK +   E +V+   R+I L+EEDLER+E RL+ AT +LEEAS++A
Sbjct  61   NEQLQEAMTKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE RS+ D+ER++ LE+QLKEA+ +AEDA+RKYDE ARKLA+ E DLERAE
Sbjct  121  DESERGRKVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A QRE++YE+ IR +T +LK+AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+ISDELDQTFAEL GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 33. Allergen Name: Hal d 1 Sequence ID: AAG08987

 Score = 258.2 bits 1104,  Expect = 2e-70
 Identities = 177/284 62%, Positives = 225/284 79%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KM AMK+EK+NA+DRAE  EQK RD   +  K EE++  LQKK   +EN++D V
Sbjct  1    MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNV 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
             E L +A  KLE  EK +   E +V+   R+I L+EEDLER+E RL+ AT +LEEAS++A
Sbjct  61   NEQLQEAMAKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER  ++LE RS+ D+ER++ LE+QLKEA+ +AEDA+RKYDE ARKLA+ E DLERAE
Sbjct  121  DESERGARVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A QRE++YE+ IR +T +LK+AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+ISDELDQTFAEL GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 34. Allergen Name: Aed a 10.0201 Sequence ID: Q17H80

 Score = 257.5 bits 1101,  Expect = 4e-70
 Identities = 178/284 62%, Positives = 232/284 81%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQAMKLEKDNA D+A+  E ++++ANLRA+K  EEV  L K++ Q+  + ++ 
Sbjct  1    MDAIKKKMQAMKLEKDNAADKADTCENQAKEANLRADKIMEEVAELTKRLTQVTEDHEKF 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            + +L QAN  LEEKEK L + E +VAAL R++Q +EEDLE+SE R   A SKL EA+QSA
Sbjct  61   KNTLEQANKDLEEKEKLLTSTEANVAALTRKVQQVEEDLEKSEERSGAALSKLLEATQSA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DE+ RM K+LE+RS  DEERM+ L +QLKEARM+AEDAD K DEV+RKLA VE +LE AE
Sbjct  121  DENNRMCKVLENRSQQDEERMDQLSNQLKEARMLAEDADGKSDEVSRKLAFVEDELEVAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            +R ++GE+KI+ELEEEL+VVGN+LKSLEVSE+KA QR E +++Q++ +T KLKEAE RAE
Sbjct  181  DRVKSGEAKIMELEEELKVVGNSLKSLEVSEDKANQRVEEFKRQLKSLTIKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
             AE++V+KLQKEVDRLED+L++EK+KYK+I D+LD TFAELTGY
Sbjct  241  NAEKNVKKLQKEVDRLEDKLMNEKDKYKAICDDLDSTFAELTGY 284

Sequence Alignment: 35. Allergen Name: Sac g 1.0101 Sequence ID: AVD53650

 Score = 245.9 bits 1050,  Expect = 1e-66
 Identities = 169/284 59%, Positives = 218/284 76%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M++IK KM AMK+EK+NA DRAE  EQ+ RD   +  K EE++  LQKK   +ENE+D V
Sbjct  1    MDSIKKKMIAMKMEKENAQDRAEQLEQQLRDTEEQKAKIEEDLTTLQKKHSNLENEFDIV 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
             E       K EE EK    +E ++ +LNRRIQL+EED+ERSE RL+ AT KLEEAS++A
Sbjct  61   NEKYQDCQAKYEEAEKKASESEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEASKAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE+ +   EER + LE QL EA+++AE+AD+KYDE ARKLA+ E DLERAE
Sbjct  121  DESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
             R E  E+K+++LEE+L VVGNN+K+L+V  ++A QRE++YE+ IR +T +LK+AE RA 
Sbjct  181  ARLEAAEAKVIDLEEQLSVVGNNIKTLQVQNDQASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+ISDELDQTFAEL GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 284

Sequence Alignment: 36. Allergen Name: Mim n 1 Sequence ID: AAG08989

 Score = 237.9 bits 1015,  Expect = 3e-64
 Identities = 167/284 58%, Positives = 209/284 73%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQAMK++++NA D AE  EQK +D      K EEE   LQKK+   EN  D V
Sbjct  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
             E L +ANTKLE  EK +   E DV  L RR+ L+EED ERSE +L   T KLEEAS++A
Sbjct  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE RS + EER++ LE QL+ A+ +A DAD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
             R E  ++K++ELEEEL VVG N+K+L+V  ++A QRE++YE+ IR +T  LK+AE RA 
Sbjct  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
             AER V KLQKEVDRLEDEL+ EKE+YK+ISD+LDQTFAE+ GY
Sbjct  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284

Sequence Alignment: 37. Allergen Name: Sal s 4.0101 Sequence ID: NP_001117128

 Score = 234.1 bits 998,  Expect = 5e-63
 Identities = 161/282 57%, Positives = 217/282 76%, Gaps = 0/282 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQ +KL+K+NA+DRAE AE   + A  ++++ E+++  LQKK++  E+ELD+ 
Sbjct  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
             ESL  A  KLE  EK+   AE DVA+LNRRIQL+EE+L+R++ RL  A +KLEEA ++A
Sbjct  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER  K++E+R+  DEE+ME  + QLKEA+ +AE+ADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK  Q+E+ YE++I+++T KLKEAE RAE
Sbjct  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELT 282
            FAERSV KL+K +D LEDEL  +K KYK+IS+ELD  + ++T
Sbjct  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282

Sequence Alignment: 38. Allergen Name: Pan h 4.0201 Sequence ID: XP_026775428

 Score = 233.4 bits 995,  Expect = 7e-63
 Identities = 160/282 56%, Positives = 215/282 76%, Gaps = 0/282 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KMQ +KL+K+NA+DRAE AE   + A  R+++ E+++  LQKK++  E+ELD+ 
Sbjct  1    MDAIKKKMQMLKLDKENALDRAEQAESDKKAAEDRSKQLEDDLVALQKKLKGTEDELDKY 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
             E+L  A  KLE  EK    AE DVA+LNRRIQL+EE+L+R++ RL  A  KLEEA ++A
Sbjct  61   SEALKDAQEKLELSEKKAADAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER  K++E+R++ DEE+ME  E QLKEA+ +AE+ADRKY+EVARKL +VE +LER E
Sbjct  121  DESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAE  E K  ELEEEL+ V N LKSLE   EK  Q+E+ YE++I+++T KLKEAE RAE
Sbjct  181  ERAELSEGKCAELEEELKTVTNTLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELT 282
            FAER+V KL+K +D LEDEL  +K KYK+IS+ELD+ + ++T
Sbjct  241  FAERTVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMT 282

Sequence Alignment: 39. Allergen Name: Pan h 4.0101 Sequence ID: XP_026781482

 Score = 225.6 bits 961,  Expect = 2e-60
 Identities = 157/282 55%, Positives = 210/282 74%, Gaps = 0/282 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            MEAIK KMQ +K +K+NA DRAE AE   + +  + ++ E+E+ GLQKK++  E+E+D+ 
Sbjct  1    MEAIKKKMQMLKGDKENAFDRAEQAELDKKVSEDKCKQLEDELLGLQKKLKGTEDEVDKY 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
             E+L  A  KLE  EK    AEG+VAALNRRIQLIEE+L+R++GRL  A  KLEEA + A
Sbjct  61   SEALKDAQEKLELSEKKATDAEGEVAALNRRIQLIEEELDRAQGRLGTALQKLEEAEKQA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER  K++E+R++ DEE+ME  E QLKEA+ +AED+DRKYDEVARKL ++E +LERAE
Sbjct  121  DESERGMKVIENRAMKDEEKMEIQELQLKEAKQIAEDSDRKYDEVARKLVVIEGELERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
            ERAE  E K  +LEEEL+ V N LKSLE   EK   +E+ YE++I ++  KLKEAE RAE
Sbjct  181  ERAEVSELKSGDLEEELKNVTNTLKSLEAQAEKYSDKEDKYEEEINLLNEKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELT 282
            FAE++V KL+K +D LEDEL ++K K K+I +ELD  + ++T
Sbjct  241  FAEKTVSKLEKTIDDLEDELYNQKLKVKAICEELDNALNDMT 282

Sequence Alignment: 40. Allergen Name: Per v 1 Sequence ID: AAG08988

 Score = 225.0 bits 958,  Expect = 3e-60
 Identities = 155/284 54%, Positives = 207/284 72%, Gaps = 0/284 0%
Query  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            M+AIK KM AMK+EK NA+DRAE  EQK R+      K E++   L KK  Q EN+ D  
Sbjct  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
               L     K E  EK +Q  E ++ +L R+I L+EE + ++E R+  A+ KLEEAS++A
Sbjct  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE+ +  ++ER++ LE QL EA+ +AE+AD+KY+E ARKLA+ E DLERAE
Sbjct  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
             R E  E+K+++LEE+L VVG N+K+L+V  ++A QRE++YE+ IR +T +LK+AE RA 
Sbjct  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+ISDELD TFAEL GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284

Sequence Alignment: 41. Allergen Name: Cra g 1 Sequence ID: AAK96889

 Score = 216.4 bits 920,  Expect = 8e-58
 Identities = 146/228 64%, Positives = 186/228 81%, Gaps = 0/228 0%
Query  57   LDQVQESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEA 116
            +D V E   +  TK+EE EK+   AE ++ +LNRRIQL+EED+ERSE RL+ AT KLEEA
Sbjct  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
Query  117  SQSADESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADL 176
            S++ADESER RK+LE+ +   EER + LE QL EA+++AE+AD+KYDE ARKLA+ E DL
Sbjct  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
Query  177  ERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAE 236
            ERAE R E  E+K++ELEEEL+VVGNN+KSLE+SE++A QRE++YE+ IR +T +LK+AE
Sbjct  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
Query  237  ARAEFAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK+ISDELDQTFAEL GY
Sbjct  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233

Sequence Alignment: 42. Allergen Name: Der f 11.0101 Sequence ID: AAK39511

 Score = 59.3 bits 232,  Expect = 5e-10
 Identities = 65/259 25%, Positives = 132/259 50%, Gaps = 9/259 3%
Query  2    EAIKNKMQAMKLEKDNAID-RAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            E IK +++ +KL+ DNA   + +IA+Q   D   R E+ E +   L+   + +E EL+ +
Sbjct  124  ELIK-EVHEVKLQLDNANHLKTQIAQQL-EDTRHRLEEEERKRASLENHAHTLEVELESL 181
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            +  L + +    E E+ L  A GD A+   +    E +L+     ++    K+   +Q  
Sbjct  182  KVQLDEESEARLELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKM---AQKI 235
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
             E E   + L ++  + E++   L+S+++   M  E A R   ++ +++A +E      +
Sbjct  236  SEYEEQLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLK 295
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
             + E     + + ++ELRV    L+ L+   EK + + +   ++ + +T  L EA+++  
Sbjct  296  NKLEEVTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLN 355
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYK 268
             A R +++ + E+ RLE+E       YK
Sbjct  356  DAHRRIHEQEIEIKRLENERDELSAAYK 383
 Score = 39.4 bits 145,  Expect = 0.0004
 Identities = 68/251 27%, Positives = 136/251 54%, Gaps = 33/251 13%
Query  7    KMQAMKLEKDNAIDRA---EIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQVQES 63
            K  A K E+  A+ +    EI +   R A   A K + E+  L+KK Q    EL+   ++
Sbjct  412  KRLAQKDEEIEALRKQYQIEIEQLNMRLAEAEA-KLKTEIARLKKKYQAQITELELSLDA 470
Query  64   LTQANTKLEE--KEKSLQTAE--GDVAALNRRIQLIEEDLERSEGRLKIATSKLEE---A 116
              +AN  L++  K+++LQ  E       ++R++Q   + L  ++ R +   ++LEE   A
Sbjct  471  ANKANIDLQKTIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEMRIA 530
Query  117  SQSADESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDA----DRKYDEVARKLAMV 172
             + A+ ++R  + L   ++     +  +   L  A+   E         YDEV ++L + 
Sbjct  531  LEQANRAKRQAEQLHEEAVVRVNELTTINVNLASAKSKLESEFSALQADYDEVHKELRIS 590
Query  173  EADLERAEE-RAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTK 231
            +   ER ++   E   +K + +EE+ R+V            K +  +++ EQ++R +  +
Sbjct  591  D---ERVQKLTIELKSTKDLLIEEQERLV------------KLETVKKSLEQEVRTLHVR 635
Query  232  LKEAEARA-EFAERSVQKLQKEVDRLEDELVHEKEKYKSISDEL 274
            ++E EA A    +R + KL+  +  +E E V E+ +  + +D++
Sbjct  636  IEEVEANALAGGKRVIAKLESRIRDVEIE-VEEERRRHAETDKM 678

Sequence Alignment: 43. Allergen Name: Der p 11 Sequence ID: AAO73464

 Score = 58.1 bits 227,  Expect = 1e-09
 Identities = 61/260 23%, Positives = 128/260 49%, Gaps = 7/260 2%
Query  2    EAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQVQ 61
            E IK +++ +KL+ DNA    +   Q+  D   R E+ E +   L+   + +E EL+ ++
Sbjct  210  ELIK-EVHEVKLQLDNANHLKQQIAQQLEDTRHRLEEEERKRSSLENHAHTLEVELESLK 268
Query  62   ESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSAD 121
              L   +    E E+ L  A GD A+   +    E +L+     ++    K+   +Q   
Sbjct  269  VQLDDESEARLELERQLTKANGDAASWKSKY---EAELQAHADEVEELRRKM---AQKIS 322
Query  122  ESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAEE 181
            E E   + L ++  + E++   L+S+++   M  E A     ++ +++A +E      ++
Sbjct  323  EYEEQLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKAAAHAQQLEKRVAQLEKINLDLKD 382
Query  182  RAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAEF 241
            + E     + + ++ELR+    L+ L+   EK + + +   ++ + +T  L EA+++   
Sbjct  383  KLEEVTMLMEQAQKELRIKIGELQKLQHEYEKVRDQRDQLARENKKLTDDLAEAKSQLND 442
Query  242  AERSVQKLQKEVDRLEDELVHEKEKYK 268
            A R +++ + E+ RLE+E       YK
Sbjct  443  AHRRIHEQEIEIKRLENERDELSAAYK 469
 Score = 49.2 bits 188,  Expect = 6e-07
 Identities = 66/245 26%, Positives = 131/245 53%, Gaps = 32/245 13%
Query  7    KMQAMKLEKDNAIDRA---EIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQVQES 63
            K  A K E+  A+ +    EI +   R A   A K + E+  L+KK Q    EL+   ++
Sbjct  498  KRLAQKDEEIEALRKQYQIEIEQLNMRLAEAEA-KLKTEIARLKKKYQAQITELELSLDA 556
Query  64   LTQANTKLEE--KEKSLQTAE--GDVAALNRRIQLIEEDLERSEGRLKIATSKLEE---A 116
              +AN  L++  K+++LQ  E       ++R++Q   + L  ++ R +   ++LEE   A
Sbjct  557  ANKANIDLQKTIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEMRIA 616
Query  117  SQSADESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDA----DRKYDEVARKLAMV 172
             + A  ++R  + L   ++     +  +   L  A+   E         YDEV ++L + 
Sbjct  617  LEQASRAKRQAEQLHEEAVVRVNELTTINVNLASAKSKLESEFSALQADYDEVHKELRIS 676
Query  173  EADLERAEE-RAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTK 231
            +   ER ++   E   +K + +EE+ R+V            K +  +++ EQ++R +  +
Sbjct  677  D---ERVQKLTIELKSTKDLLIEEQERLV------------KLETVKKSLEQEVRTLHVR 721
Query  232  LKEAEARA-EFAERSVQKLQKEVDRLEDELVHEKEKY 267
            ++E EA A    +R + KL+  +  +E E+  E+ ++
Sbjct  722  IEEVEANALAGGKRVIAKLESRIRDVEIEVEEERRRH 758

Sequence Alignment: 44. Allergen Name: Rap v 2.0101 Sequence ID: QPB41107

 Score = 55.8 bits 217,  Expect = 6e-09
 Identities = 67/249 26%, Positives = 126/249 50%, Gaps = 21/249 8%
Query  25   AEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQVQESL-TQANTKLEEKEKSLQTAEG 83
            AE+ S  A L+   +EE +R  + K+   +  L+Q++  +  +   K EE E   +++  
Sbjct  455  AERDSLAAALK--DTEEALRDAEAKLASAQAALNQLKIDMENRLREKDEEIENVRRSSAR 512
Query  84   DVAALNRRIQLIEEDLERSEGRLKIA-TSKLEEASQSADESERMRKMLEHRSITDEERME 142
             +  L R +  +E   +    R+K    S + E   + D + R       +  + ++R++
Sbjct  513  AIEELQRTLVEVETRYKTEISRMKKKFESDIRELEAALDNANRANSEYLKQIKSLQQRVK 572
Query  143  GLESQLKEARMMAED-------ADRKYDEVARKLAMVEADLERAEERAETGESKIVELEE 195
             LE+ L+E R +++D       A+RK   +A++L    A LE AE   +  E+++ +   
Sbjct  573  ELETLLEEERRVSDDLRNQLGVAERKRVALAQELEDARALLEGAERARKNAETELADTST 632
Query  196  ELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAEFAERSVQKLQKEVDR 255
             L  +     +L+V+     +R    E  +  M + L +A      AE   ++L  E  R
Sbjct  633  RLSEI-----TLQVTSLTNDKRR--LEADLSAMQSDLDDAINNQRGAEERAERLAAENGR 685
Query  256  LEDELVHEKEKYK---SISDELDQTFAELT 282
            L DEL +E+E YK   S+  +L+    E+T
Sbjct  686  LADELRQEQENYKNAESLRKQLEVEIREIT 715

Sequence Alignment: 45. Allergen Name: Blo t 11 Sequence ID: AAM83103

 Score = 54.7 bits 212,  Expect = 1e-08
 Identities = 61/259 23%, Positives = 131/259 50%, Gaps = 9/259 3%
Query  2    EAIKNKMQAMKLEKDNAID-RAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
            E IK +++  K+  DNA   + +IA+Q   D   R E  E +   L+   + +E EL+ +
Sbjct  210  ELIK-EVHEYKISLDNANHLKGQIAQQL-EDTRHRLEDEERKRSSLENHAHTLEVELESL 267
Query  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
            +  L + +    E E+ L  A GD A+   +    E +L+     ++    K+  A + +
Sbjct  268  KVQLEEESEARLELERQLTKANGDAASWKSKY---EAELQAHVDEVEELRRKM--AQKIS 322
Query  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
            +  E++  +L   S  ++++   L+S+++   M  E A      + ++++ +E      +
Sbjct  323  EYGEQLEALLNKCSALEKQKAR-LQSEVEVLIMDLEKATAHAQALEKRVSQLEKINLDLK 381
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
             + E     + + +++LRV   +L+ L+   EK + ++EA  ++ + +   L EA+++  
Sbjct  382  SKLEEVSMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLN 441
Query  241  FAERSVQKLQKEVDRLEDELVHEKEKYK 268
             A R +++ + E+ RLE+E       YK
Sbjct  442  DAHRRIHEQEIEIKRLENEREELAAAYK 469
 Score = 44.9 bits 169,  Expect = 1e-05
 Identities = 56/253 22%, Positives = 130/253 51%, Gaps = 16/253 6%
Query  7    KMQAMKLEKDNAIDRA---EIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQVQES 63
            K  A K E+  A+ +    EI +   R A   A K + EV  L+KK Q    EL+   ++
Sbjct  498  KRLAQKEEEIEALRKQYQIEIEQLNMRLAEAEA-KLKTEVARLKKKYQAQITELELSLDA 556
Query  64   LTQANTKLEE--KEKSLQTA--EGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQS 119
              +AN  L++  K+++LQ    +     ++R++Q   + L  ++ R +  T++LEE   +
Sbjct  557  ANKANIDLQKTIKKQALQITGLQAHYDEVHRQLQQAVDQLGVTQRRCQALTAELEEMRVN 616
Query  120  ADESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERA 179
             +++ R ++  E+     EE +     ++ E   +  +      ++  +++ ++ D +  
Sbjct  617  LEQALRAKRAAEQ---MHEEAV----VRVNELTTINVNLASAKSKLETEFSALQNDYDEV 669
Query  180  EERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARA 239
             +     + ++ +L  E++   + L+S      K +  +++ E ++R +  +++E EA A
Sbjct  670  HKELRISDERVQKLTIEVKSTKDLLESETERVTKLETIKKSLETEVRNLQIRIEEVEANA 729
Query  240  -EFAERSVQKLQKEVDRLEDELVHEKEKY 267
                +R + KL+  +  +E E+  E+ ++
Sbjct  730  LAGGKRVIAKLESRIRDVEIEVEEERRRH 758

Sequence Alignment: 46. Allergen Name: Ani s 2 Sequence ID: AAF72796

 Score = 50.8 bits 195,  Expect = 2e-07
 Identities = 72/248 29%, Positives = 133/248 53%, Gaps = 31/248 12%
Query  6    NKMQAMKLEKDNAIDRA--EIAEQKSR-DANLRAEKSEEEVRGLQKKIQQIENELDQVQE 62
            ++  A ++E ++ +  A  EI + KS+ DA +      EEV  L+KK+ Q + E ++  E
Sbjct  274  DEESAARVEAEHKLSLANTEITQWKSKFDAEVALHH--EEVEDLRKKMMQKQAEYEEQIE 331
Query  63   SLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKI-ATSKLEEASQSAD 121
             + Q  ++LE+ +  LQ+           ++++  DLE+++  + I   +K +   Q  +
Sbjct  332  IMLQKVSQLEKAKARLQS----------EVEVLIVDLEKAQNTIAILERAKEQLEKQVLE 381
Query  122  ESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAEE 181
               R+ ++L        E    L ++L++ + + E A  + + +AR+   ++ DL  A E
Sbjct  382  MKSRIDELLVELEAAQREARAAL-AELQKMKQLYEKAVEQKEALARENKKLQDDLHEANE 440
Query  182  RAETGESKIVELE-EELRVVGN------NLKSLEVSEEKAQ---QREEAYEQQIRI-MTT 230
                   K+ EL+ E  R+ G        LK  E +   A+   QR  A  QQ+RI M  
Sbjct  441  ALADANRKLHELDLENARLAGEIRDLQVALKESEAARRDAEARAQRALAELQQVRIEMER 500
Query  231  KLKEAEARAEFAERSVQKLQKEVDRLEDELVHEKEKYKS 269
            +L+E E   E   +S   +Q E+DRL   L   + + K+
Sbjct  501  RLQEKEEEMEALRKS---MQFEIDRLTAALADAEARMKA 536
 Score = 42.6 bits 159,  Expect = 6e-05
 Identities = 60/217 27%, Positives = 114/217 52%, Gaps = 30/217 13%
Query  42   EVRGLQKKIQQIENELDQVQESLTQANTKLEE--KEKSLQTAE--GDVAALNRRIQLIEE 97
            E+  L+KK Q    EL+   ++L +AN + ++  K++S Q  +   ++    R++Q   +
Sbjct  537  EIARLRKKYQAEIAELEMTVDNLNRANLEAQKTIKKQSEQIIQLQANLEDTQRQLQQTLD 596
Query  98   DLERSEGRLKIATSKLEEASQSADESERMRKMLE------HRSITDEERMEGLESQLK-- 149
                ++ ++   +++LEE   + D + R RK  E      H  I+D   +    + +K  
Sbjct  597  QYALAQRKISALSAELEECKTALDNAIRARKQAEADLEEAHVRISDLTSINSNLTAIKNK 656
Query  150  -EARMMAEDADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVVGNNLKSLE 208
             E  +    AD   DEV ++L    AD ERA          + EL EE         S++
Sbjct  657  LETELSTAQAD--LDEVTKELHA--AD-ERANRALADAARAVQELHEEQE------HSMK 705
Query  209  VSEEKAQQREEAYEQQIRIMTTKLKEAEARAEFA-ERSVQKLQKEVDRLEDELVHEKEKY 267
            +   +     ++ E+Q++ +  +++EAEA A +  +R + KL+  +  LE  L  E  ++
Sbjct  706  IDALR-----KSLEEQVKQLQVQIQEAEAAALLGGKRVIAKLETRIRDLEVALDEETRRH 760
Query  268  KSISDEL 274
            K     L
Sbjct  761  KETQSAL 767

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.