The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MEIGGLVYLVIVVAIIHSSQGVDYCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPT
EEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFL
VHDKCRNTAKYPVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYT
QMVWGKTKEIGCGSLKYMENKMQNHYLICNYGPAGNYLGQLPNTKK
Sequence Info Allergen Name Length Opt Bits Score E Value
AAT95009 Pol e 5.0101 226 1559 323.4 3.7e-90
Q05109 Pol a 5 209 1432 297.8 1.8e-82
P35759 Pol e 5.0101 205 1414 294.1 2.2e-81
P35780 Pol f 5 205 1332 277.6 2e-76
P81656 Pol d 5 206 1213 253.6 3.4e-69
P83377 Pol g 5 206 1210 253.0 5.2e-69
Q7Z156 Poly s 5.0101 207 1102 231.3 1.8e-62
C0HJV9 Poly p 5.0101 206 1101 231.1 2.1e-62
P86686 Poly p 5.0102 207 1088 228.4 1.3e-61
Q05108 Dol a 5 203 955 201.6 1.5e-53
P10736 Dol m 5.0101 227 936 197.9 2.3e-52
Q05110 Ves v 5 227 926 195.8 9.2e-52
AAA28302 Dol m 5.02 212 909 192.4 9.5e-51
P10737 Dol m 5.02 215 909 192.4 9.6e-51
P35785 Ves p 5 204 884 187.3 3e-49
P35781 Vesp c 5 202 871 184.7 1.9e-48
P0DMB9 Vesp v 5.0101 202 868 184.1 2.8e-48
P35787 Ves vi 5 206 868 184.1 2.9e-48
P35786 Ves s 5 205 867 183.9 3.3e-48
P35784 Ves g 5 204 865 183.5 4.3e-48
P35783 Ves f 5 204 859 182.3 1e-47
P35782 Vesp c 5 202 857 181.9 1.3e-47
P81657 Vesp m 5 202 853 181.1 2.3e-47
P35760 Ves m 5 204 846 179.7 6.2e-47
C0ITL3 Pac c 3.0101 199 637 137.5 2.9e-34
P35779 Sol r 3 211 629 136.0 9.1e-34
P35778 Sol i 3 234 618 133.8 4.5e-33
QEA69430 Sco m 5.0101 210 338 77.3 4.1e-16
AAF65314 Cte f 2 264 306 71.0 4.1e-14
7065471 Pol m 5.0101 37 241 56.8 1.1e-10
ABC58726 Sol s 3.0101 90 244 57.9 1.2e-10
AAY32926 Sol g 3.0101 70 214 51.7 6.9e-09
AAU15051 Cyn d 24.0101 153 212 51.8 1.5e-08
AAF82096 Glo m 5 259 203 50.2 7.2e-08
AVD29826 Art la 2.0101 163 191 47.6 2.9e-07
A0A2L1DGQ3 Art ar 2.0101 163 191 47.6 2.9e-07
AVD29822 Art an 2.0101 163 191 47.6 2.9e-07
AVD29824 Art ca 2.0101 163 191 47.6 2.9e-07
AVD29827 Art si 2.0101 163 191 47.6 2.9e-07
AVD29825 Art gm 2.0101 163 191 47.6 2.9e-07
ADM18345 Tab y 5.0101 256 179 45.4 2e-06
XP_007199020 Pru p 9.0101 161 176 44.5 2.3e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pol e 5.0101 Sequence ID: AAT95009

 Score = 323.4 bits 1559,  Expect = 4e-90
 Identities = 226/226 100%, Positives = 226/226 100%, Gaps = 0/226 0%
Query  1    MEIGGLVYLVIVVAIIHSSQGVDYCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPT 60
            MEIGGLVYLVIVVAIIHSSQGVDYCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPT
Sbjct  1    MEIGGLVYLVIVVAIIHSSQGVDYCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPT 60
Query  61   EEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFL 120
            EEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFL
Sbjct  61   EEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFL 120
Query  121  VHDKCRNTAKYPVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYT 180
            VHDKCRNTAKYPVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYT
Sbjct  121  VHDKCRNTAKYPVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYT 180
Query  181  QMVWGKTKEIGCGSLKYMENKMQNHYLICNYGPAGNYLGQLPNTKK 226
            QMVWGKTKEIGCGSLKYMENKMQNHYLICNYGPAGNYLGQLPNTKK
Sbjct  181  QMVWGKTKEIGCGSLKYMENKMQNHYLICNYGPAGNYLGQLPNTKK 226

Sequence Alignment: 2. Allergen Name: Pol a 5 Sequence ID: Q05109

 Score = 297.8 bits 1432,  Expect = 2e-82
 Identities = 205/209 98%, Positives = 206/209 98%, Gaps = 0/209 0%
Query  18   SSQGVDYCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQK 77
            SSQGVDYCKI+CPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQK
Sbjct  1    SSQGVDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQK 60
Query  78   VAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNI 137
            VAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNI
Sbjct  61   VAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNI 120
Query  138  AYAGGSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKY 197
            AYAGGS LPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKY
Sbjct  121  AYAGGSNLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKY 180
Query  198  MENKMQNHYLICNYGPAGNYLGQLPNTKK 226
            MEN MQNHYLICNYGPAGNYLGQLP TKK
Sbjct  181  MENNMQNHYLICNYGPAGNYLGQLPYTKK 209

Sequence Alignment: 3. Allergen Name: Pol e 5.0101 Sequence ID: P35759

 Score = 294.1 bits 1414,  Expect = 2e-81
 Identities = 202/205 98%, Positives = 204/205 99%, Gaps = 0/205 0%
Query  22   VDYCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 81
            VDYCKI+CPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG
Sbjct  1    VDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 60
Query  82   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 141
            LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG
Sbjct  61   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 120
Query  142  GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENK 201
            GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKY+ENK
Sbjct  121  GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIENK 180
Query  202  MQNHYLICNYGPAGNYLGQLPNTKK 226
            MQNHYLICNYGPAGNYLGQLP TKK
Sbjct  181  MQNHYLICNYGPAGNYLGQLPYTKK 205

Sequence Alignment: 4. Allergen Name: Pol f 5 Sequence ID: P35780

 Score = 277.6 bits 1332,  Expect = 2e-76
 Identities = 189/205 92%, Positives = 196/205 95%, Gaps = 0/205 0%
Query  22   VDYCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 81
            VDYCKI+C SGIHTVCQYGESTKPSKNCA KVIKSVGPTEEEKKLIV+EHNRFRQKVAQG
Sbjct  1    VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQG 60
Query  82   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 141
            LETRGNPGPQPAASDMN+LVWNDELAHIAQVWASQCQ LVHDKCRNTAKY VGQNIAYAG
Sbjct  61   LETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAG 120
Query  142  GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENK 201
            GSKLPDVVSLIKLWENEVKDFNYN GITKQNF K+GHYTQM+W KTKEIGCGSLKYM+N 
Sbjct  121  GSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKNN 180
Query  202  MQNHYLICNYGPAGNYLGQLPNTKK 226
            MQ+HYLICNYGPAGNYLGQLP TKK
Sbjct  181  MQHHYLICNYGPAGNYLGQLPYTKK 205

Sequence Alignment: 5. Allergen Name: Pol d 5 Sequence ID: P81656

 Score = 253.6 bits 1213,  Expect = 3e-69
 Identities = 172/204 84%, Positives = 184/204 90%, Gaps = 1/204 0%
Query  23   DYCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 82
            DYCKI+C SG+HTVCQYGESTKPSKNCAGK+IKSVGPTEEEKKLIV EHNRFRQKVA+GL
Sbjct  2    DYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKGL 61
Query  83   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAGG 142
            ETRGNPGPQPAAS+MN+LVWNDELA IAQVWASQCQ LVHDKCRNT KY VGQNIAYAG 
Sbjct  62   ETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAGS 121
Query  143  SK-LPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENK 201
            S  +P V  LI+LWENEVKDFNYNTGIT +NF K+GHYTQMVWG TKE+GCGSLKY+E  
Sbjct  122  SNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKN 181
Query  202  MQNHYLICNYGPAGNYLGQLPNTKK 226
            MQ HYLICNYGPAGNYLGQ   TKK
Sbjct  182  MQIHYLICNYGPAGNYLGQPIYTKK 206

Sequence Alignment: 6. Allergen Name: Pol g 5 Sequence ID: P83377

 Score = 253.0 bits 1210,  Expect = 5e-69
 Identities = 172/204 84%, Positives = 183/204 89%, Gaps = 1/204 0%
Query  23   DYCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 82
            DYCKI+C SG+HTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIV EHNRFRQKVAQGL
Sbjct  2    DYCKIKCSSGVHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVEEHNRFRQKVAQGL 61
Query  83   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAGG 142
            ETRGNPGPQPAAS+MN+LVWNDE A IAQVWASQCQ LVHDKCRNT KY VGQNIAYAG 
Sbjct  62   ETRGNPGPQPAASNMNNLVWNDEQAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAGS 121
Query  143  SK-LPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENK 201
            S  +P V  LI+LWENEVKDFNYNTGIT +NF K+GHYTQMVWG TKE+GCGSLKY+E  
Sbjct  122  SNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKN 181
Query  202  MQNHYLICNYGPAGNYLGQLPNTKK 226
            M+ HYLICNYGPAGNYLGQ   TKK
Sbjct  182  MKIHYLICNYGPAGNYLGQPIYTKK 206

Sequence Alignment: 7. Allergen Name: Poly s 5.0101 Sequence ID: Q7Z156

 Score = 231.3 bits 1102,  Expect = 2e-62
 Identities = 158/203 77%, Positives = 177/203 87%, Gaps = 2/203 0%
Query  24   YCKIRCPSGIHTVCQYGESTKPS-KNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 82
            YC I+C    HTVCQYGESTKPS KNC    I SVG TEEEKKLIV EHNRFRQKVAQGL
Sbjct  3    YCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQGL 62
Query  83   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAY-AG 141
            ETRGNPGPQPAASDMN+LVWNDELA+IAQVWA+QCQF+VHDKCRNTA+Y VGQNIAY A 
Sbjct  63   ETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFFVHDKCRNTAQYQVGQNIAYSAS 122
Query  142  GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENK 201
             +  P +VSLI LWENEVKDFNY+ GITK+NFAK+GHYTQ+VW KTKE+GCGS+KY+E  
Sbjct  123  TAAYPGIVSLIVLWENEVKDFNYSQGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKG 182
Query  202  MQNHYLICNYGPAGNYLGQLPNTKK 226
            M++HYL+CNYGPAGNY+GQ   TKK
Sbjct  183  MKSHYLVCNYGPAGNYMGQPIYTKK 207

Sequence Alignment: 8. Allergen Name: Poly p 5.0101 Sequence ID: C0HJV9

 Score = 231.1 bits 1101,  Expect = 2e-62
 Identities = 156/203 76%, Positives = 175/203 86%, Gaps = 1/203 0%
Query  24   YCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGLE 83
            YC I+C    HTVCQYGESTKPS  C    I SVG TEEEKKLIV EHNRFRQKVAQGLE
Sbjct  3    YCNIKCSKVAHTVCQYGESTKPSSKCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQGLE 62
Query  84   TRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAY-AGG 142
            TRGNPGPQPAASDMN+LVWNDELA+IAQVWASQCQF+VHDKCRNTA+Y VGQNIAY A  
Sbjct  63   TRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFVHDKCRNTAQYQVGQNIAYSAST 122
Query  143  SKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENKM 202
            +  P +VSLI LWENEVKDFNY+ GITK+NF+K+GHYTQ+VW KTKE+GCGS+KY+E  M
Sbjct  123  AAYPGIVSLIVLWENEVKDFNYSQGITKENFSKVGHYTQVVWAKTKEVGCGSIKYIEKGM 182
Query  203  QNHYLICNYGPAGNYLGQLPNTKK 226
            ++HYL+CNYGPAGNY+GQ   TKK
Sbjct  183  KSHYLVCNYGPAGNYMGQPIYTKK 206

Sequence Alignment: 9. Allergen Name: Poly p 5.0102 Sequence ID: P86686

 Score = 228.4 bits 1088,  Expect = 1e-61
 Identities = 157/196 80%, Positives = 172/196 87%, Gaps = 2/196 1%
Query  24   YCKIRCPSGIHTVCQYGESTKPS-KNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 82
            YC I+C    HTVCQ GESTKPS KNCA   I SVG TEEEKKLIV EHNRFRQKVAQGL
Sbjct  3    YCNIKCSKVAHTVCQTGESTKPSSKNCAKVSITSVGVTEEEKKLIVDEHNRFRQKVAQGL 62
Query  83   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAY-AG 141
            ETRGNPGPQPAASDMN+LVWNDELA+IAQVWASQCQF+VHDKCRNTA+Y VGQNIAY A 
Sbjct  63   ETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFVHDKCRNTAQYQVGQNIAYSAS 122
Query  142  GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENK 201
             +  P VV LI LWENEVKDFNYNTGITK+NFAK+GHYTQ+VW KTKE+GCGS+KY+E  
Sbjct  123  TAAYPGVVKLIVLWENEVKDFNYNTGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKG 182
Query  202  MQNHYLICNYGPAGNYLG 219
            M++HYL+CNYGPAGN LG
Sbjct  183  MKSHYLVCNYGPAGNVLG 200

Sequence Alignment: 10. Allergen Name: Dol a 5 Sequence ID: Q05108

 Score = 201.6 bits 955,  Expect = 2e-53
 Identities = 133/194 68%, Positives = 157/194 80%, Gaps = 6/194 3%
Query  23   DYCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 82
            +YCKI CP G HT+C+YG S KP  NC GK++KS G T +EK  IV  HN FRQKVAQGL
Sbjct  2    NYCKI-CPKGTHTLCKYGTSMKP--NCGGKIVKSYGVTNDEKNEIVKRHNEFRQKVAQGL 58
Query  83   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG- 141
            ETRGNPGPQP A +MN LVWNDELA IAQ WA+QC F  HD+CRNTAKYPVGQN+A A  
Sbjct  59   ETRGNPGPQPPAKNMNLLVWNDELAKIAQTWANQCNFG-HDQCRNTAKYPVGQNVAIAST 117
Query  142  -GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMEN 200
             G+    +  LIK+WE+EVKD+N +  +   NF+K+GHYTQMVWGKTKEIGCGS+KY+EN
Sbjct  118  TGNSYQTMSYLIKMWEDEVKDYNPHKDLMHNNFSKVGHYTQMVWGKTKEIGCGSVKYIEN 177
Query  201  KMQNHYLICNYGPAGNYLGQ 220
            K + HYL+CNYGPAGNY+ Q
Sbjct  178  KWHTHYLVCNYGPAGNYMNQ 197

Sequence Alignment: 11. Allergen Name: Dol m 5.0101 Sequence ID: P10736

 Score = 197.9 bits 936,  Expect = 2e-52
 Identities = 134/217 61%, Positives = 164/217 75%, Gaps = 7/217 3%
Query  1    MEIGGLVYLVIVVAIIHSSQGV--DYCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVG 58
            MEIGGLVYL++++ II+ S G   +YCKI+C  GIHT+C++G S KP  NC   V+K+ G
Sbjct  1    MEIGGLVYLILIITIINLSFGETNNYCKIKCRKGIHTLCKFGTSMKP--NCGRNVVKAYG 58
Query  59   PTEEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQ 118
             T +EK  I+  HN FRQ VA+GLETRG PGPQP A +MN LVWNDELA IAQ WA+QC 
Sbjct  59   LTNDEKNEILKRHNDFRQNVAKGLETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCD 118
Query  119  FLVHDKCRNTAKYPVGQNIAYAG--GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKI 176
            F  HD CRNTAKY VGQNIA +    +++     LIK WE+EV +FNY  G+   NF K+
Sbjct  119  F-NHDDCRNTAKYQVGQNIAISSTTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKV 177
Query  177  GHYTQMVWGKTKEIGCGSLKYMENKMQNHYLICNYGPAGNYLGQ 220
            GHYTQMVWGKTKEIGCGS+KY+E+    HYL+CNYGP GN + Q
Sbjct  178  GHYTQMVWGKTKEIGCGSIKYIEDNWYTHYLVCNYGPGGNDFNQ 221

Sequence Alignment: 12. Allergen Name: Ves v 5 Sequence ID: Q05110

 Score = 195.8 bits 926,  Expect = 9e-52
 Identities = 133/221 60%, Positives = 171/221 77%, Gaps = 10/221 4%
Query  1    MEIGGLVYLVIVVAIIHSSQGV--DYCKIRC-PSGIHTVCQYGESTKPSKNCAGKVIKSV 57
            MEI GLVYL+I+V II    G   +YCKI+C   G+HT C+YG S KP  NC  KV+ S 
Sbjct  1    MEISGLVYLIIIVTIIDLPYGKANNYCKIKCLKGGVHTACKYG-SLKP--NCGNKVVVSY 57
Query  58   GPTEEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQC 117
            G T++EK+ I+ EHN FRQK+A+GLETRGNPGPQP A +M +LVWNDELA++AQVWA+QC
Sbjct  58   GLTKQEKQDILKEHNDFRQKIARGLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQC 117
Query  118  QFLVHDKCRNTAKYPVGQNIAYAGGS--KLPDVVSLIKLWENEVKDFNYNTGITKQNFAK 175
            Q+  HD CR+ AKY VGQN+A  G +  K  D V L+K+WE+EVKD+N     +  +F K
Sbjct  118  QYG-HDTCRDVAKYQVGQNVALTGSTAAKYDDPVKLVKMWEDEVKDYNPKKKFSGNDFLK 176
Query  176  IGHYTQMVWGKTKEIGCGSLKYMENKMQNHYLICNYGPAGNYLGQ-LPNTK 225
             GHYTQMVW  TKE+GCGS+KY++ K + HYL+CNYGP+GN++ + L  TK
Sbjct  177  TGHYTQMVWANTKEVGCGSIKYIQEKWHKHYLVCNYGPSGNFMNEELYQTK 227

Sequence Alignment: 13. Allergen Name: Dol m 5.02 Sequence ID: AAA28302

 Score = 192.4 bits 909,  Expect = 1e-50
 Identities = 127/195 65%, Positives = 155/195 79%, Gaps = 6/195 3%
Query  23   DYCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 82
            +YCKI+C  GIHT+C++G S KP  NC  K++K  G + +EK  IV+ HN+FRQKVA+GL
Sbjct  12   NYCKIKCSRGIHTLCKFGTSMKP--NCGSKLVKVHGVSNDEKNEIVNRHNQFRQKVAKGL 69
Query  83   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG- 141
            ETRGNPGPQP A +MN LVWNDELA IAQ WA+QC F  HD+CRNT KY VGQN+A A  
Sbjct  70   ETRGNPGPQPPAKNMNVLVWNDELAKIAQTWANQCSFG-HDQCRNTEKYQVGQNVAIAST 128
Query  142  -GSKLPDVVSLIKLWENEVKDFNYNTG-ITKQNFAKIGHYTQMVWGKTKEIGCGSLKYME 199
             G+    +  LI++WENEVKDFN   G +   NF+K+GHYTQMVWGKTKEIGCGS+KY+E
Sbjct  129  TGNSYATMSKLIEMWENEVKDFNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYIE 188
Query  200  NKMQNHYLICNYGPAGNYLGQ 220
            N  + HYL+CNYGPAGNY+ Q
Sbjct  189  NNWHTHYLVCNYGPAGNYMDQ 209

Sequence Alignment: 14. Allergen Name: Dol m 5.02 Sequence ID: P10737

 Score = 192.4 bits 909,  Expect = 1e-50
 Identities = 127/195 65%, Positives = 155/195 79%, Gaps = 6/195 3%
Query  23   DYCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 82
            +YCKI+C  GIHT+C++G S KP  NC  K++K  G + +EK  IV+ HN+FRQKVA+GL
Sbjct  12   NYCKIKCSRGIHTLCKFGTSMKP--NCGSKLVKVHGVSNDEKNEIVNRHNQFRQKVAKGL 69
Query  83   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG- 141
            ETRGNPGPQP A +MN LVWNDELA IAQ WA+QC F  HD+CRNT KY VGQN+A A  
Sbjct  70   ETRGNPGPQPPAKNMNVLVWNDELAKIAQTWANQCSFG-HDQCRNTEKYQVGQNVAIAST 128
Query  142  -GSKLPDVVSLIKLWENEVKDFNYNTG-ITKQNFAKIGHYTQMVWGKTKEIGCGSLKYME 199
             G+    +  LI++WENEVKDFN   G +   NF+K+GHYTQMVWGKTKEIGCGS+KY+E
Sbjct  129  TGNSYATMSKLIEMWENEVKDFNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYIE 188
Query  200  NKMQNHYLICNYGPAGNYLGQ 220
            N  + HYL+CNYGPAGNY+ Q
Sbjct  189  NNWHTHYLVCNYGPAGNYMDQ 209

Sequence Alignment: 15. Allergen Name: Ves p 5 Sequence ID: P35785

 Score = 187.3 bits 884,  Expect = 3e-49
 Identities = 120/191 62%, Positives = 155/191 81%, Gaps = 7/191 3%
Query  23   DYCKIRC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 81
            +YCKI+C   G+HT C+YG S KP  NC  K++ S G T+EEK+ I+ EHN FRQK+A+G
Sbjct  2    NYCKIKCLKGGVHTACKYG-SLKP--NCGNKIVVSYGLTKEEKQDILKEHNDFRQKIARG 58
Query  82   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 141
            LETRGNPGPQP A +M +LVWNDELA++AQVWA+QCQ+  HD CR+ AKYPVGQN+A  G
Sbjct  59   LETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYG-HDTCRDVAKYPVGQNVALTG 117
Query  142  GS--KLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYME 199
             +  K  + V L+K+WE+EVKD+N     ++ NF KIGHYTQMVW  TKEIGCGS+KY++
Sbjct  118  STADKYDNPVKLVKMWEDEVKDYNPKKKFSENNFNKIGHYTQMVWANTKEIGCGSIKYIQ 177
Query  200  NKMQNHYLICNYGPAGNY 217
            N+ + HYL+CNYGP+GN+
Sbjct  178  NEWHKHYLVCNYGPSGNF 195

Sequence Alignment: 16. Allergen Name: Vesp c 5 Sequence ID: P35781

 Score = 184.7 bits 871,  Expect = 2e-48
 Identities = 127/192 66%, Positives = 155/192 80%, Gaps = 12/192 6%
Query  23   DYCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 82
            +YCKI+C SGIHT+C+YG STKP  NC   V+K+ G T++E   I+ +HN FRQKVA+GL
Sbjct  2    NYCKIKCRSGIHTLCKYGTSTKP--NCGKNVVKASGLTKQENLEILKQHNEFRQKVARGL 59
Query  83   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAGG 142
            ETRGNPGPQP A  MN LVWNDELA+IAQVWA+QC +  HD CRN+AKY VGQNIA   G
Sbjct  60   ETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYG-HDNCRNSAKYSVGQNIAE--G 116
Query  143  SKLPD----VVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYM 198
            S   D    V +++K+WE+EVKD+ Y  G  K  + K+GHYTQMVW KTKEIGCGS+KY+
Sbjct  117  STTADNFGSVSNMVKMWEDEVKDYQY--GSPKNKLNKVGHYTQMVWAKTKEIGCGSIKYI 174
Query  199  ENKMQNHYLICNYGPAGNYLGQLP 222
            EN  + HYL+CNYGPAGN +G  P
Sbjct  175  ENGWHRHYLVCNYGPAGN-VGNEP 197

Sequence Alignment: 17. Allergen Name: Vesp v 5.0101 Sequence ID: P0DMB9

 Score = 184.1 bits 868,  Expect = 3e-48
 Identities = 125/198 63%, Positives = 157/198 79%, Gaps = 8/198 4%
Query  23   DYCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 82
            +YCKI+C SGIHT+C+YG STKP  NC   V+K+ G T+ EK  I+ +HN FRQKVA+GL
Sbjct  2    NYCKIKCRSGIHTLCKYGTSTKP--NCGRSVVKASGLTKAEKLEILKQHNEFRQKVARGL 59
Query  83   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG- 141
            ETRGNPGPQP A  MN LVWNDELA+IAQVWASQC++  HD CRNTAKY VGQNIA    
Sbjct  60   ETRGNPGPQPPAKSMNTLVWNDELAQIAQVWASQCKYG-HDNCRNTAKYLVGQNIAEQST 118
Query  142  -GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMEN 200
              + +  V +++K+W +EVKD+ Y  G +K  +  +GHYTQMVW KTKEIGCG++KY+EN
Sbjct  119  TAASFEPVSNMVKMWSDEVKDYQY--GSSKNKLNDVGHYTQMVWAKTKEIGCGNIKYIEN 176
Query  201  KMQNHYLICNYGPAGNYLGQLPNTKK 226
              ++HYL+CNYGPAGN +G  P  +K
Sbjct  177  GWHHHYLVCNYGPAGN-IGNEPIYEK 201

Sequence Alignment: 18. Allergen Name: Ves vi 5 Sequence ID: P35787

 Score = 184.1 bits 868,  Expect = 3e-48
 Identities = 127/202 62%, Positives = 157/202 77%, Gaps = 6/202 2%
Query  22   VDYCKIRC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQ 80
            V+YCKI+C   G+HT C+YG STKP  NC   V+K+ G TE EK+ I+  HN FRQKVA+
Sbjct  2    VNYCKIKCLKGGVHTACKYGTSTKP--NCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAK 59
Query  81   GLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIA-Y 139
            GLETRGNPGPQP A +MN+LVWNDELA+IAQVWASQC +  HD C++T KYPVGQNIA  
Sbjct  60   GLETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYG-HDTCKDTEKYPVGQNIAKR 118
Query  140  AGGSKLPDVVS-LIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYM 198
            +  + L D    L+K+WENEVKDFN N   +K N+ K GHYTQMVW KTKEIGCGS+KY+
Sbjct  119  STTAALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYV 178
Query  199  ENKMQNHYLICNYGPAGNYLGQLPNTKK 226
            +++   HYL+CNYGP+GN+  +    KK
Sbjct  179  KDEWYTHYLVCNYGPSGNFRNEKLYEKK 206

Sequence Alignment: 19. Allergen Name: Ves s 5 Sequence ID: P35786

 Score = 183.9 bits 867,  Expect = 3e-48
 Identities = 123/196 62%, Positives = 151/196 77%, Gaps = 6/196 3%
Query  22   VDYCKIRC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQ 80
            VDYCKI+C   G+HT C+YG STKP  NC   V+KS G T+ EK+ I+  HN FR KVA+
Sbjct  1    VDYCKIKCLKGGVHTACKYGTSTKP--NCGNMVVKSYGVTQAEKQEILKIHNDFRNKVAR 58
Query  81   GLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYA 140
            GLETRGNPGPQP A +MN+LVWN+ELA+IAQ+WASQC++  HD C++T KY VGQNIA +
Sbjct  59   GLETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYG-HDTCKDTTKYNVGQNIAVS 117
Query  141  GGSK--LPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYM 198
              +     +V +L+K WENEVKDFN      +  F KIGHYTQMVW KTKEIGCGS+KY+
Sbjct  118  SSTAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYV 177
Query  199  ENKMQNHYLICNYGPAGNYLGQ 220
            +N    HYL+CNYGPAGN+  Q
Sbjct  178  DNNWYTHYLVCNYGPAGNFGNQ 199

Sequence Alignment: 20. Allergen Name: Ves g 5 Sequence ID: P35784

 Score = 183.5 bits 865,  Expect = 4e-48
 Identities = 118/191 61%, Positives = 155/191 81%, Gaps = 7/191 3%
Query  23   DYCKIRC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 81
            +YCKI+C   G+HT C+Y ES KP  NCA K + + G T++EK+ I+ EHN FRQK+A+G
Sbjct  2    NYCKIKCLKGGVHTACKY-ESLKP--NCANKKVVAYGLTKQEKQDILKEHNDFRQKIARG 58
Query  82   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 141
            LETRGNPGPQP A +M +LVW+DELA+IAQVWA+QCQ+  HD CR+ AKYPVGQN+A  G
Sbjct  59   LETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYG-HDTCRDVAKYPVGQNVALTG 117
Query  142  GS--KLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYME 199
             +  K  + V L+K+WE+EVKD+N     ++ NF KIGHYTQMVW  TKE+GCGS+KY++
Sbjct  118  STAAKYDNPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQ 177
Query  200  NKMQNHYLICNYGPAGNY 217
            +K + HYL+CNYGP+GN+
Sbjct  178  DKWHKHYLVCNYGPSGNF 195

Sequence Alignment: 21. Allergen Name: Ves f 5 Sequence ID: P35783

 Score = 182.3 bits 859,  Expect = 1e-47
 Identities = 120/199 60%, Positives = 155/199 77%, Gaps = 8/199 4%
Query  23   DYCKIRC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 81
            +YCKI+C   G+HT C+YG S KP  NC  KV+ S G T++EK+ I+ EHN FRQK+A+G
Sbjct  2    NYCKIKCLKGGVHTACKYG-SLKP--NCGNKVVVSYGLTKQEKQDILKEHNDFRQKIARG 58
Query  82   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 141
            LETRGNPGPQP A +M +LVWNDELA++AQVWA+QCQ+  HD CR+ AKY VGQN+A  G
Sbjct  59   LETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYG-HDTCRDIAKYQVGQNVALTG 117
Query  142  GS--KLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYME 199
             +  K  D V L+K+WE+EVKD+N     +  NF K GHYTQMVW  TKE+GCGS+K+++
Sbjct  118  STAAKYDDPVKLVKMWEDEVKDYNPKKKFSGNNFLKTGHYTQMVWANTKEVGCGSIKFIQ 177
Query  200  NKMQNHYLICNYGPAGNYLGQ-LPNTK 225
             K + HYL+CNYGP+GN+  + L  TK
Sbjct  178  EKWHKHYLVCNYGPSGNFQNEELYQTK 204

Sequence Alignment: 22. Allergen Name: Vesp c 5 Sequence ID: P35782

 Score = 181.9 bits 857,  Expect = 1e-47
 Identities = 123/194 63%, Positives = 153/194 78%, Gaps = 8/194 4%
Query  23   DYCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 82
            +YCKI+C SGIHT+C+YG STKP  NC   V+K+ G T++E   I+ +HN FRQKVA+GL
Sbjct  2    NYCKIKCRSGIHTLCKYGTSTKP--NCGKNVVKASGLTKQENLEILKQHNEFRQKVARGL 59
Query  83   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAGG 142
            ETRGNPGPQP A  MN LVWNDELA+IAQVWA+QC +  HD CRN+AKY VGQNIA    
Sbjct  60   ETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYG-HDNCRNSAKYSVGQNIAEGST 118
Query  143  S--KLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMEN 200
            S   + +V +++K+WE+EVKD+ Y  G  K  + K+GHYTQMVW KTKEIGCGS  Y+E+
Sbjct  119  SADNFVNVSNMVKMWEDEVKDYQY--GSPKNKLNKVGHYTQMVWAKTKEIGCGSEDYIED 176
Query  201  KMQNHYLICNYGPAGNYLGQLP 222
              + HYL+CNYGPAGN +G  P
Sbjct  177  GWHRHYLVCNYGPAGN-VGNEP 197

Sequence Alignment: 23. Allergen Name: Vesp m 5 Sequence ID: P81657

 Score = 181.1 bits 853,  Expect = 2e-47
 Identities = 122/194 62%, Positives = 153/194 78%, Gaps = 8/194 4%
Query  23   DYCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 82
            +YCKI+C SGIHT+C++G STKP  NC   V+K+ G T+ EK  I+ +HN FRQKVA+GL
Sbjct  2    NYCKIKCRSGIHTLCKFGISTKP--NCGKNVVKASGLTKAEKLEILKQHNEFRQKVARGL 59
Query  83   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAGG 142
            ETRG PGPQP A  MN LVWNDELA+IAQVWA QC +  HD CRNTAKY VGQNIA  G 
Sbjct  60   ETRGKPGPQPPAKSMNTLVWNDELAQIAQVWAGQCDYG-HDVCRNTAKYSVGQNIAENGS 118
Query  143  S--KLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMEN 200
            +   +  V +++++W +EVK++ Y  G TK  + ++GHYTQMVW KTKEIGCGS+KY+EN
Sbjct  119  TAASFASVSNMVQMWADEVKNYQY--GSTKNKLIEVGHYTQMVWAKTKEIGCGSIKYIEN 176
Query  201  KMQNHYLICNYGPAGNYLGQLP 222
              + HYL+CNYGPAGN +G  P
Sbjct  177  GWHRHYLVCNYGPAGN-IGNEP 197

Sequence Alignment: 24. Allergen Name: Ves m 5 Sequence ID: P35760

 Score = 179.7 bits 846,  Expect = 6e-47
 Identities = 119/199 59%, Positives = 154/199 77%, Gaps = 8/199 4%
Query  23   DYCKIRC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 81
            +YCKI+C   G+HT C+YG S KP  NC  K + S G T++EK+ I+ EHN FRQK+A+G
Sbjct  2    NYCKIKCLKGGVHTACKYG-SLKP--NCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARG 58
Query  82   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 141
            LETRGNPGPQP A +M +LVW+DELA+IAQVWA+QCQ+  HD CR+ AKY VGQN+A  G
Sbjct  59   LETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYG-HDTCRDVAKYQVGQNVALTG 117
Query  142  GSK--LPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYME 199
             +     D V L+K+WE+EVKD+N     ++ NF KIGHYTQMVW  TKE+GCGS+KY++
Sbjct  118  STAAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQ 177
Query  200  NKMQNHYLICNYGPAGNYLGQ-LPNTK 225
               + HYL+CNYGP+GN+  + L  TK
Sbjct  178  ENWHKHYLVCNYGPSGNFQNEELYQTK 204

Sequence Alignment: 25. Allergen Name: Pac c 3.0101 Sequence ID: C0ITL3

 Score = 137.5 bits 637,  Expect = 3e-34
 Identities = 96/183 52%, Positives = 131/183 71%, Gaps = 10/183 5%
Query  33   IHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGLETRGNPGPQP 92
            +HT+CQY  S +PS NC      +   T  +K+ I+  HN  RQKV  G ETRGNPGPQP
Sbjct  6    VHTMCQY-TSPQPSPNCG--TYSNAHITAADKETILKVHNDERQKVKAGQETRGNPGPQP 62
Query  93   AASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAGGS-KLP-DVVS 150
            AAS+M DL W++ELA IAQ W +QC+ + HD CRN  +Y VGQNIA +G + K P ++ +
Sbjct  63   AASNMPDLTWDNELAAIAQRWVNQCK-IGHDGCRNVERYQVGQNIAMSGSTAKGPCNMNN 121
Query  151  LIKLWENEVKDFN---YNTGITKQN-FAKIGHYTQMVWGKTKEIGCGSLKYMENKMQNHY 206
            L+++W NEV  +N    ++  +  N F KIGHYTQ+VWGKT ++GCG +++++ K    Y
Sbjct  122  LVQMWINEVNALNAADVSSMPSDGNYFMKIGHYTQLVWGKTTKVGCGIIQFLDGKFYKCY 181
Query  207  LICNYGPAGNYLG 219
            L CNYGPAGN +G
Sbjct  182  LACNYGPAGNMFG 194

Sequence Alignment: 26. Allergen Name: Sol r 3 Sequence ID: P35779

 Score = 136.0 bits 629,  Expect = 9e-34
 Identities = 102/199 51%, Positives = 132/199 66%, Gaps = 16/199 8%
Query  23   DYCKIR-CP--SGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVA 79
            +YC ++ C   + IHT+CQY  S  P   C      +VG T+ EK  IV++HN +RQ+VA
Sbjct  2    NYCNLQSCKRNNAIHTMCQY-TSPTPGPMCLE--YSNVGFTDAEKDAIVNKHNELRQRVA 58
Query  80   QGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAY 139
             G E RG  GPQP A  M +L W+ ELA IAQ WA+QC F  HD CRN  ++ VGQNIA 
Sbjct  59   SGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFE-HDACRNVERFAVGQNIAA 117
Query  140  --AGGSKLPDVVSLIKLWENEVKDFNYNTGITK-----QNFAKIGHYTQMVWGKTKEIGC 192
              + G     +  +I LW NEVKDF+ N  I+        +  +GHYTQ+VW KTK+IGC
Sbjct  118  TSSSGKNKSTLSDMILLWYNEVKDFD-NRWISSFPSDGNILMHVGHYTQIVWAKTKKIGC 176
Query  193  GSLKYMENKMQNHYLICNYGPAGNYLG-QLPNTKK 226
            G + + E+    HYL+CNYGPAGN LG Q+   KK
Sbjct  177  GRIMFKEDNWNKHYLVCNYGPAGNVLGAQIYEIKK 211

Sequence Alignment: 27. Allergen Name: Sol i 3 Sequence ID: P35778

 Score = 133.8 bits 618,  Expect = 5e-33
 Identities = 106/212 50%, Positives = 140/212 66%, Gaps = 21/212 9%
Query  1    ME-IGGLVYLVIVVAIIHSSQGVDYCKIR-CP--SGIHTVCQYGESTKPSKNCAGKVIKS 56
            ME I  +++L I    + ++   +YC ++ C   + IHT+CQY  S  P   C      +
Sbjct  1    MELIVSILWLAITAENLANTLATNYCNLQSCKRNNAIHTMCQY-TSPTPGPMCL--EYSN 57
Query  57   VGPTEEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQ 116
            VG T+ EK  IV++HN +RQ+VA G E RG  GPQP A  M +L W+ ELA IAQ WA+Q
Sbjct  58   VGFTDAEKDAIVNKHNELRQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQ 117
Query  117  CQFLVHDKCRNTAKYPVGQNIAYAGGS----KLPDVVSLIKLWENEVKDFNYNTGITK-- 170
            C F  HD CRN  ++ VGQNIA    S      P+   +I LW NEVKDF+ N  I+   
Sbjct  118  CTFE-HDACRNVERFAVGQNIAATSSSGKNKSTPN--EMILLWYNEVKDFD-NRWISSFP 173
Query  171  --QN-FAKIGHYTQMVWGKTKEIGCGSLKYME-NKMQNHYLICNYGPAGNYLG 219
               N + K+GHYTQ+VW KT +IGCG + + E +    HYL+CNYGPAGN LG
Sbjct  174  SDDNILMKVGHYTQIVWAKTTKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLG 226

Sequence Alignment: 28. Allergen Name: Sco m 5.0101 Sequence ID: QEA69430

 Score = 77.3 bits 338,  Expect = 4e-16
 Identities = 69/164 42%, Positives = 99/164 60%, Gaps = 16/164 9%
Query  51   GKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIA 110
            G  +K  G     KK+I+  HN+ RQ VA G ++    G QP+A++M +L W+D++A  A
Sbjct  23   GCDMKVRGLDANMKKMILDLHNKKRQTVANGQQS----G-QPSAANMKELHWDDQIAANA 77
Query  111  QVWASQCQFLVHDKC-RNTAKYP-VGQNIAYAGGSKLPDVVSL-IKLWENEVKDFNYNTG 167
            Q  A  C F    K  R T+KY  +G+NI Y G    PD +   +  W +EVKD      
Sbjct  78   QRSAETCVFQHTAKNLRKTSKYSYLGENI-YMG--SYPDPIPRSVNAWYDEVKDVTPAVV 134
Query  168  IT-KQNFAKIGHYTQMVWGKTKEIGCGSLKYMENKMQNHYLICNYGPAGNYLGQLPNTKK 226
             + +     IGHYTQMVW  T+ +GCG +   +   +N Y+ C YGP+GNY G+ P  K+
Sbjct  135  KSFRSGGPMIGHYTQMVWANTEALGCGLVTASD---KNTYIFCQYGPSGNYPGE-PIYKQ 190

Sequence Alignment: 29. Allergen Name: Cte f 2 Sequence ID: AAF65314

 Score = 71.0 bits 306,  Expect = 4e-14
 Identities = 73/199 36%, Positives = 103/199 51%, Gaps = 27/199 13%
Query  9    LVIVVAIIHSSQGVDYCKIRCPSGIHTVCQYGESTKPS--KNCAGKVIKSVGPTEEEKKL 66
            ++  V +       DYC + C +G +  C     TKP   ++C     K V  TE  KK 
Sbjct  19   VIFAVNVKPKPNQDDYCNLNCTNGPNVGC-----TKPDVPRDCQN--FKLVNITERMKKA 71
Query  67   IVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCR 126
             ++ HNR R+ VA G     +    P A+ M +L WN  LA +A+    QC+ + HD C 
Sbjct  72   FLNAHNRKRRLVAAGKGLLKDGVHTPIAAKMPNLTWNIALAKLAEYNVKQCE-MKHD-CA 129
Query  127  NTAKYPVGQNIAYAGGSKLPDVVSLI-KL----WENEVKDFNYNTGITK-----QNFAKI 176
             T     GQN+ + G +  P   S I K+    W  E KD      I K      N   I
Sbjct  130  KTRHGHTGQNLFFYGTTLSPIKNSTIAKMAVDGWYAESKDTRLED-IKKLTTIYPNGKPI 188
Query  177  GHYTQMVWGKTKEIGCGSLKYMENKMQNHY----LICNYGPAGNYL 218
            GHYTQ++WG T ++GC    Y ++   N +    + CNY   GN L
Sbjct  189  GHYTQLIWGNTTKVGCAVSTYKKHSNGNMFNMTLVACNYR-GGNML 233

Sequence Alignment: 30. Allergen Name: Pol m 5.0101 Sequence ID: 7065471

 Score = 56.8 bits 241,  Expect = 1e-10
 Identities = 34/37 91%, Positives = 35/37 94%, Gaps = 0/37 0%
Query  22   VDYCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVG 58
            VDYCKI+C SGIHTVCQYGESTKPSKNCA KVIKSVG
Sbjct  1    VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG 37

Sequence Alignment: 31. Allergen Name: Sol s 3.0101 Sequence ID: ABC58726

 Score = 57.9 bits 244,  Expect = 1e-10
 Identities = 42/86 48%, Positives = 55/86 63%, Gaps = 6/86 6%
Query  23   DYCKIR-CP--SGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVA 79
            +YC ++ C   + IHT+CQY  S  P   C      +VG T+ EK  IV++HN +RQ+VA
Sbjct  2    NYCNLQSCKRNNAIHTMCQY-TSPTPGPMCL--EYSNVGFTDAEKDAIVNKHNELRQRVA 58
Query  80   QGLETRGNPGPQPAASDMNDLVWNDELAHIAQ 111
             G E RG   PQP A  M +L W+ ELA IAQ
Sbjct  59   SGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ 90

Sequence Alignment: 32. Allergen Name: Sol g 3.0101 Sequence ID: AAY32926

 Score = 51.7 bits 214,  Expect = 7e-09
 Identities = 29/45 64%, Positives = 35/45 77%, Gaps = 1/45 2%
Query  175  KIGHYTQMVWGKTKEIGCGSLKYME-NKMQNHYLICNYGPAGNYLG 219
            KIGHYTQ+VW KT +IGCG + + E +    HYL+CNYGPAGN LG
Sbjct  17   KIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLG 62

Sequence Alignment: 33. Allergen Name: Cyn d 24.0101 Sequence ID: AAU15051

 Score = 51.8 bits 212,  Expect = 1e-08
 Identities = 45/140 32%, Positives = 75/140 53%, Gaps = 26/140 18%
Query  58   GPTEEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQC 117
            G  ++  + I++EHN FR K                   +  L WN  LA  +Q +A   
Sbjct  12   GLNDKAIQDILNEHNMFRAK-----------------EHVPPLTWNTTLAKFSQDYAESK 54
Query  118  QFLVHDKCRNT-AKYPVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKI 176
              L  D C+   +  P G+N+ +  G+      + +  W +E K ++Y +    Q     
Sbjct  55   --LKKD-CKMVHSDSPYGENLMFGSGAI--SWKTTVDTWSDEKKSYHYGSNTCDQG-KMC 108
Query  177  GHYTQMVWGKTKEIGCGSLKYMENKMQNHYLICNYGPAGNYLGQLP 222
            GHYT +VW  T  +GCG  + + +  ++  ++C+Y P GNY  Q P
Sbjct  109  GHYTAVVWKDTTSVGCG--RVLCDDKKDTMIMCSYWPPGNYENQKP 152

Sequence Alignment: 34. Allergen Name: Glo m 5 Sequence ID: AAF82096

 Score = 50.2 bits 203,  Expect = 7e-08
 Identities = 67/190 35%, Positives = 98/190 51%, Gaps = 26/190 13%
Query  21   GVDYCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQ 80
            G DYC + C +  H  C      +       K+I       + +  ++  HN+ R  VA 
Sbjct  19   GGDYCGL-CDN--HDACVMQNVFQSGCPSGAKMI----DLNKYQSALLDAHNKKRNHVAG 71
Query  81   GLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYP-VGQNIAY 139
            G E++        A  M  + W+ ELA +A+    QCQ + HD+CRNT K+   GQN+A 
Sbjct  72   GGESK-----LKRACQMATMKWDSELAKLAEYNVKQCQ-MNHDRCRNTVKFKYAGQNLAE 125
Query  140  AG--GSKLPDVVSLIKL----WENEVKDFNYN-TGITKQNF--AKIGHYTQMVWGKTKEI 190
             G  G   PD   LI+     W  EVKD N         N+    IGH+T MV  +   +
Sbjct  126  LGRSGGPPPDYRKLIEKAVDKWYEEVKDCNQGYIDSYPMNYRGPAIGHFTVMVAERNTHV 185
Query  191  GCGSLKYME-NKMQNHYLICNYGPAGNYLGQLPNTK 225
            GC + +Y + N  Q   + CNY  A   + ++P  K
Sbjct  186  GCAASEYTKSNGFQYFLMACNY--ATTNMMEFPIYK 219

Sequence Alignment: 35. Allergen Name: Art la 2.0101 Sequence ID: AVD29826

 Score = 47.6 bits 191,  Expect = 3e-07
 Identities = 49/122 40%, Positives = 76/122 62%, Gaps = 34/122 27%
Query  83   ETRGNPGPQPA----ASD-------MNDLVWNDELAHIAQVWAS----QCQFLVHDKC-R 126
            ET G PG  P     A +       M  L W+DELA +AQ WA      C ++  D+C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRCGE 84
Query  127  NTAKYPVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGK 186
            N A+  +  ++A             ++LW +E  D++YN     +     GHYTQ+VW  
Sbjct  85   NMAQGAINGSMA-------------VQLWLDERLDYDYNE---NKCIKMCGHYTQIVWAN 128
Query  187  TKEIGCGSLKYMENKMQNHYLICNYGPAGNYLGQLP 222
            ++ +GCG  + + +    + ++CNY P GN +GQ P
Sbjct  129  SERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKP 162

Sequence Alignment: 36. Allergen Name: Art ar 2.0101 Sequence ID: A0A2L1DGQ3

 Score = 47.6 bits 191,  Expect = 3e-07
 Identities = 49/122 40%, Positives = 76/122 62%, Gaps = 34/122 27%
Query  83   ETRGNPGPQPA----ASD-------MNDLVWNDELAHIAQVWAS----QCQFLVHDKC-R 126
            ET G PG  P     A +       M  L W+DELA +AQ WA      C ++  D+C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRCGE 84
Query  127  NTAKYPVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGK 186
            N A+  +  ++A             ++LW +E  D++YN     +     GHYTQ+VW  
Sbjct  85   NMAQGAINGSMA-------------VQLWLDERLDYDYNE---NKCIKMCGHYTQIVWAN 128
Query  187  TKEIGCGSLKYMENKMQNHYLICNYGPAGNYLGQLP 222
            ++ +GCG  + + +    + ++CNY P GN +GQ P
Sbjct  129  SERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKP 162

Sequence Alignment: 37. Allergen Name: Art an 2.0101 Sequence ID: AVD29822

 Score = 47.6 bits 191,  Expect = 3e-07
 Identities = 50/122 40%, Positives = 75/122 61%, Gaps = 34/122 27%
Query  83   ETRGNPGPQPA----ASD-------MNDLVWNDELAHIAQVWAS----QCQFLVHDKC-R 126
            ET G PG  P     A +       M  L W+DELA +AQ WA      C ++  D+C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLVHSDRCGE 84
Query  127  NTAKYPVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGK 186
            N A+  +  ++A             ++LW +E  D++YN     +     GHYTQ+VW  
Sbjct  85   NMAQGAINGSMA-------------VQLWLDERLDYDYNE---NKCIKMCGHYTQIVWAN 128
Query  187  TKEIGCGSLKYMENKMQNHYLICNYGPAGNYLGQLP 222
            T+ +GCG  + + +    +  +CNY P GN +GQ P
Sbjct  129  TERVGCG--RALCSNGWAYITVCNYDPPGNVVGQKP 162

Sequence Alignment: 38. Allergen Name: Art ca 2.0101 Sequence ID: AVD29824

 Score = 47.6 bits 191,  Expect = 3e-07
 Identities = 42/108 38%, Positives = 68/108 62%, Gaps = 23/108 21%
Query  97   MNDLVWNDELAHIAQVWAS----QCQFLVHDKC-RNTAKYPVGQNIAYAGGSKLPDVVSL 151
            M  L W+DELA +AQ WA      C ++  D+C  N A+  +  ++A             
Sbjct  50   MKPLCWDDELAKVAQAWAETRTPDCSLIHSDRCGENMAQGAINGSMA------------- 96
Query  152  IKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENKMQNHYLICNY 211
            ++LW +E  D++YN     +     GHYTQ+VW  ++ +GCG  + + +    + ++CNY
Sbjct  97   VQLWLDERLDYDYNEN---KCIKMCGHYTQIVWANSERVGCG--RALCSNGWAYIIVCNY 151
Query  212  GPAGNYLGQLP 222
             P GN +GQ P
Sbjct  152  DPPGNVVGQKP 162

Sequence Alignment: 39. Allergen Name: Art si 2.0101 Sequence ID: AVD29827

 Score = 47.6 bits 191,  Expect = 3e-07
 Identities = 49/122 40%, Positives = 77/122 63%, Gaps = 34/122 27%
Query  83   ETRGNPGPQPA----ASD-------MNDLVWNDELAHIAQVWA----SQCQFLVHDKC-R 126
            ET G PG  P     A +       M  L W+DELA +AQ WA    + C ++  D+C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAEARTADCSLVHSDRCGE 84
Query  127  NTAKYPVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGK 186
            N A+  +  ++A             ++LW +E  D++YN     +     GHYTQ+VW  
Sbjct  85   NMAQGAINGSMA-------------VQLWLDERLDYDYNE---NKCIKMCGHYTQIVWAN 128
Query  187  TKEIGCGSLKYMENKMQNHYLICNYGPAGNYLGQLP 222
            ++ +GCG  + + +    + ++CNY P GN +GQ P
Sbjct  129  SERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKP 162

Sequence Alignment: 40. Allergen Name: Art gm 2.0101 Sequence ID: AVD29825

 Score = 47.6 bits 191,  Expect = 3e-07
 Identities = 50/122 40%, Positives = 75/122 61%, Gaps = 34/122 27%
Query  83   ETRGNPGPQPA----ASD-------MNDLVWNDELAHIAQVWAS----QCQFLVHDKC-R 126
            ET G PG  P     A +       M  L W+DELA +AQ WA      C ++  D+C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLVHSDRCGE 84
Query  127  NTAKYPVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGK 186
            N A+  +  ++A             ++LW +E  D++YN     +     GHYTQ+VW  
Sbjct  85   NMAQGAINGSMA-------------VQLWLDERLDYDYNE---NKCIKMCGHYTQIVWAN 128
Query  187  TKEIGCGSLKYMENKMQNHYLICNYGPAGNYLGQLP 222
            T+ +GCG  + + +    +  +CNY P GN +GQ P
Sbjct  129  TERVGCG--RALCSNGWAYITVCNYDPPGNVVGQKP 162

Sequence Alignment: 41. Allergen Name: Tab y 5.0101 Sequence ID: ADM18345

 Score = 45.4 bits 179,  Expect = 2e-06
 Identities = 62/197 31%, Positives = 102/197 51%, Gaps = 25/197 12%
Query  6    LVYLVIVVAIIHSSQGVDYCKI-RCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEK 64
            LV LV+  ++I+S   +DYC + R   G H  C  G S   S +C G+  ++   T+E K
Sbjct  11   LVVLVLQCSVINS---LDYCSLCRGGRGEHVGC--G-SPGFSSDC-GQKARTRKFTKEHK 63
Query  65   KLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDK 124
            K+I+ + N  R  VA+G  + G     P AS M  +VW++ELA +A+     C    + K
Sbjct  64   KVILDKINDVRDHVAKG--SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAY-K 116
Query  125  CRNTAKY--PVGQNIAYAGGSKLPDVVSLIK--LWENEVKDFNYNTGITK--QNFAKIGH 178
            CR+T ++  P   N  +    K+P  +SLI   +     +  N    I +  Q     G+
Sbjct  117  CRHTLRFWSPGQLNFEFYA-DKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGN 175
Query  179  YTQM---VWGKTKEIGCGSLKYMENKMQNHYLICNYGPAGNY 217
              ++   +  +   +GCG   +         L CN+    +Y
Sbjct  176  VKELALAISDRVTAVGCGLTTWKLGGKARALLTCNFSSENDY 217

Sequence Alignment: 42. Allergen Name: Pru p 9.0101 Sequence ID: XP_007199020

 Score = 44.5 bits 176,  Expect = 2e-06
 Identities = 52/130 40%, Positives = 73/130 56%, Gaps = 28/130 21%
Query  56   SVGPTEEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWAS 115
            S   ++EE    V EHN+ R++V          G +P       L WN  LA+ AQ +A 
Sbjct  22   SANISKEEIDGFVEEHNKARKEV----------GNKP-------LKWNTTLAQYAQEYAD 64
Query  116  QCQFLVHDKCRNTAKYPVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAK 175
            +    V D     +    G+N+A   G       +  K W  E K+F Y+    K    +
Sbjct  65   K---RVGDCAMEHSMGRWGENLASGDGMSG---AAATKYWVTE-KEF-YDEKSNKCVKDE 116
Query  176  IGHYTQMVWGKTKEIGCGSLKYMENKMQNHYLICNYGP 213
             GHY  +VWGKT E+GCG  K   N  QN Y++C+Y P
Sbjct  117  CGHYLAVVWGKTTEVGCGISK--CNNGQN-YVVCSYDP 151

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.