The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ
DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT
TASLVGDHGVVACGKVNTEVVD
Sequence Info Allergen Name Length Opt Bits Score E Value
AAQ73482 Blo t 2.0102 142 946 233.2 2e-63
A6XEP6 Blo t 2.0104 142 917 226.3 2.5e-61
A6XEP3 Blo t 2.0104 142 917 226.3 2.5e-61
A6XEP2 Blo t 2.0104 142 912 225.1 5.6e-61
A6XEP1 Blo t 2.0104 142 910 224.6 7.8e-61
A6XEP4 Blo t 2.0104 142 909 224.4 9.2e-61
A6XEP0 Blo t 2.0104 142 908 224.2 1.1e-60
A6XEN8 Blo t 2.0104 142 899 222.0 4.8e-60
AAQ73483 Blo t 2.0101 144 896 221.3 8.1e-60
A6XEN9 Blo t 2.0104 142 894 220.8 1.1e-59
A6XEP5 Blo t 2.0104 142 878 217.0 1.6e-58
AAQ73481 Blo t 2.0103 141 819 202.9 2.7e-54
BAX34757 Der f 35.0101 143 524 132.6 4.1e-33
O02380 Tyr p 2 141 512 129.7 2.9e-32
CAD32314 Lep d 2.0202 141 505 128.1 9.2e-32
CAA58755 Lep d 2.0201 141 505 128.1 9.2e-32
P80384 Lep d 2 141 495 125.7 4.8e-31
CAD32313 Lep d 2.0102 141 490 124.5 1.1e-30
CAB76459 Gly d 2.0201 125 455 116.1 3.1e-28
Q00855 Der f 2 146 403 103.7 2e-24
CAK22338 Der p 2.0114 146 402 103.5 2.4e-24
Q9TZZ2 Eur m 2 145 396 102.1 6.4e-24
P49278 Der p 2 146 393 101.3 1.1e-23
CAB59976 Gly d 2.0101 128 384 99.2 4e-23
BAA01239 Der f 2 138 378 97.8 1.2e-22
BAA01241 Der f 2 138 374 96.8 2.3e-22
ABA39438 Der f 2.0109 129 354 92.1 5.8e-21
AAK30133 Der f 2 170 349 90.8 1.8e-20
ABA39437 Der p 2.0109 129 347 90.4 1.8e-20
CAQ68249 Der p 2.0115 129 347 90.4 1.8e-20
AAC82350 Eur m 2.0102 135 347 90.4 1.9e-20
CAA57160 Lep d 2.0101 98 324 84.9 6.1e-19
Q28895 Can f 7.0101 149 234 63.4 2.8e-12
ABG76195 Der f 22.0101 155 229 62.2 6.7e-12
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Blo t 2.0102 Sequence ID: AAQ73482

 Score = 233.2 bits 946,  Expect = 2e-63
 Identities = 142/142 100%, Positives = 142/142 100%, Gaps = 0/142 0%
Query  1    MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
            MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ
Sbjct  1    MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TASLVGDHGVVACGKVNTEVVD 142
            TASLVGDHGVVACGKVNTEVVD
Sbjct  121  TASLVGDHGVVACGKVNTEVVD 142

Sequence Alignment: 2. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP6

 Score = 226.3 bits 917,  Expect = 2e-61
 Identities = 138/142 97%, Positives = 139/142 97%, Gaps = 0/142 0%
Query  1    MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
            MFKFICLALLVS AA GDVKFT CAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TASLVGDHGVVACGKVNTEVVD 142
            TASLVGDHGVVACGKVNTEV+D
Sbjct  121  TASLVGDHGVVACGKVNTEVID 142

Sequence Alignment: 3. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP3

 Score = 226.3 bits 917,  Expect = 2e-61
 Identities = 138/142 97%, Positives = 139/142 97%, Gaps = 0/142 0%
Query  1    MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
            MFKFICLALLVS AA GDVKFT CAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKT+T
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTIT 120
Query  121  TASLVGDHGVVACGKVNTEVVD 142
            TASLVGDHGVVACGKVNTEVVD
Sbjct  121  TASLVGDHGVVACGKVNTEVVD 142

Sequence Alignment: 4. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP2

 Score = 225.1 bits 912,  Expect = 6e-61
 Identities = 138/142 97%, Positives = 138/142 97%, Gaps = 0/142 0%
Query  1    MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
            MFKFICLALLVS AA GDVKFT CAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TASLVGDHGVVACGKVNTEVVD 142
            TASLVGDHGVVACGKVNTEV D
Sbjct  121  TASLVGDHGVVACGKVNTEVFD 142

Sequence Alignment: 5. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP1

 Score = 224.6 bits 910,  Expect = 8e-61
 Identities = 138/141 97%, Positives = 138/141 97%, Gaps = 0/141 0%
Query  1    MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
            MFKFICLALLVS AA GDVKFT CAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TASLVGDHGVVACGKVNTEVV 141
            TASLVGDHGVVACGKVNTEVV
Sbjct  121  TASLVGDHGVVACGKVNTEVV 141

Sequence Alignment: 6. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP4

 Score = 224.4 bits 909,  Expect = 9e-61
 Identities = 138/142 97%, Positives = 138/142 97%, Gaps = 0/142 0%
Query  1    MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
            MFKFICLALLVS AA GDVKFT CAHGEVTSLDLSGCS DHCIIHKGKSFTLKTFFIANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSDDHCIIHKGKSFTLKTFFIANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TASLVGDHGVVACGKVNTEVVD 142
            TASLVGDHGVVACGKVNTEVVD
Sbjct  121  TASLVGDHGVVACGKVNTEVVD 142

Sequence Alignment: 7. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP0

 Score = 224.2 bits 908,  Expect = 1e-60
 Identities = 138/142 97%, Positives = 138/142 97%, Gaps = 0/142 0%
Query  1    MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
            MFKFICLALLVS AA GDVKFT CAHGEVTSLDLSGCSGDHCII KGKSFTLKTFFIANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TASLVGDHGVVACGKVNTEVVD 142
            TASLVGDHGVVACGKVNTEVVD
Sbjct  121  TASLVGDHGVVACGKVNTEVVD 142

Sequence Alignment: 8. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN8

 Score = 222.0 bits 899,  Expect = 5e-60
 Identities = 136/142 95%, Positives = 136/142 95%, Gaps = 0/142 0%
Query  1    MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
            MFKFICLALLVS AA GDVKFT CAHGEVTSLDLSGCSGDHC IHKGKSFTLKTFFIANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCTIHKGKSFTLKTFFIANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            DSEKLEIKISA MN IEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT
Sbjct  61   DSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TASLVGDHGVVACGKVNTEVVD 142
            TASLVGDHGVVACGKVNTEVVD
Sbjct  121  TASLVGDHGVVACGKVNTEVVD 142

Sequence Alignment: 9. Allergen Name: Blo t 2.0101 Sequence ID: AAQ73483

 Score = 221.3 bits 896,  Expect = 8e-60
 Identities = 138/142 97%, Positives = 138/142 97%, Gaps = 2/142 1%
Query  1    MFKFICLALLV--SPAAGGDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIA 58
            MFKFICLALL   S AA GDVKFT CAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIA
Sbjct  1    MFKFICLALLPFWSRAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIA 60
Query  59   NQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKT 118
            NQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKT
Sbjct  61   NQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKT 120
Query  119  VTTASLVGDHGVVACGKVNTEVVD 142
            VTTASLVGDHGVVACGKVNTEVVD
Sbjct  121  VTTASLVGDHGVVACGKVNTEVVD 144

Sequence Alignment: 10. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN9

 Score = 220.8 bits 894,  Expect = 1e-59
 Identities = 134/142 94%, Positives = 136/142 95%, Gaps = 0/142 0%
Query  1    MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
            MFKFICLALLVS AA GDVKFT CAHGEVTSLDLSGCSGDHC IHKGKSFTLKTFFIANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCTIHKGKSFTLKTFFIANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            DSEKLEIKISA MN IEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPT+LPN+KTVT
Sbjct  61   DSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTVT 120
Query  121  TASLVGDHGVVACGKVNTEVVD 142
            TASLVGDHGVVACGKVNTEVVD
Sbjct  121  TASLVGDHGVVACGKVNTEVVD 142

Sequence Alignment: 11. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP5

 Score = 217.0 bits 878,  Expect = 2e-58
 Identities = 132/142 92%, Positives = 134/142 94%, Gaps = 0/142 0%
Query  1    MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
            MFKFICLALLVS A  GDVKFT CAHGEVTSLDLS CSGDHC IHKGKSFTLKTFFIANQ
Sbjct  1    MFKFICLALLVSYATAGDVKFTDCAHGEVTSLDLSRCSGDHCTIHKGKSFTLKTFFIANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            DSEKLEIKISA MN IEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPT+LPN+KTVT
Sbjct  61   DSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTVT 120
Query  121  TASLVGDHGVVACGKVNTEVVD 142
            TASLVGDHGVVACGKVNTEVVD
Sbjct  121  TASLVGDHGVVACGKVNTEVVD 142

Sequence Alignment: 12. Allergen Name: Blo t 2.0103 Sequence ID: AAQ73481

 Score = 202.9 bits 819,  Expect = 3e-54
 Identities = 128/141 90%, Positives = 130/141 92%, Gaps = 1/141 0%
Query  1    MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
            MFKFICLALLVS        + +C   EVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ
Sbjct  1    MFKFICLALLVSSRRQRCQIYRSCTW-EVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 59
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT
Sbjct  60   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 119
Query  121  TASLVGDHGVVACGKVNTEVVD 142
            TASLVGDHGVVACGKVNTEVVD
Sbjct  120  TASLVGDHGVVACGKVNTEVVD 141

Sequence Alignment: 13. Allergen Name: Der f 35.0101 Sequence ID: BAX34757

 Score = 132.6 bits 524,  Expect = 4e-33
 Identities = 71/142 50%, Positives = 100/142 70%, Gaps = 1/142 0%
Query  1    MFKFICL-ALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIAN 59
            M KF+C+ AL  + A+ G +KF  C H EV SLD+SGC GD+C++HKGK+  L     +N
Sbjct  1    MIKFLCIFALTFAVASAGKMKFVDCGHKEVISLDVSGCEGDYCVLHKGKTIDLDMKCKSN 60
Query  60   QDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTV 119
            QDSE L++ ISA +N IE+ VPG D+DGC +  CP+ KGQ Y++ YS  +P +LPN+K  
Sbjct  61   QDSEHLKLIISADVNGIEIEVPGFDQDGCHYVQCPIHKGQDYDIKYSYNVPAVLPNIKGT 120
Query  120  TTASLVGDHGVVACGKVNTEVVD 142
             TA ++GD+G+V C K+N E+ D
Sbjct  121  LTAKVIGDNGLVGCLKLNGEIAD 143

Sequence Alignment: 14. Allergen Name: Tyr p 2 Sequence ID: O02380

 Score = 129.7 bits 512,  Expect = 3e-32
 Identities = 69/138 50%, Positives = 97/138 70%, Gaps = 0/138 0%
Query  3    KFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDS 62
            KF+ L  LV+ AA G VKFT C   E+ S+ + GC GD C+IHK K   +   F ANQD+
Sbjct  2    KFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDT 61
Query  63   EKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTA 122
             K+E+K++  +N +EVP+PG++ DGCK   CPLKKG KY ++YS+ +P+++PN+KTV   
Sbjct  62   CKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVKL 121
Query  123  SLVGDHGVVACGKVNTEV 140
               G+HGV+ACG VNT+V
Sbjct  122  LATGEHGVLACGAVNTDV 139

Sequence Alignment: 15. Allergen Name: Lep d 2.0202 Sequence ID: CAD32314

 Score = 128.1 bits 505,  Expect = 9e-32
 Identities = 70/140 50%, Positives = 95/140 67%, Gaps = 0/140 0%
Query  1    MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
            M KFI L  LV+ A+ G + F  C HGEVT LD+SGCSGD C+IH+G+  TL   F ANQ
Sbjct  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            D+ K+ IK+ A +    + VPG++ DGCK   CP+KKG+  +++Y + IP I P +K   
Sbjct  61   DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVDV 120
Query  121  TASLVGDHGVVACGKVNTEV 140
            TA LVGDHGV+ACG ++ +V
Sbjct  121  TAELVGDHGVMACGTIHGQV 140

Sequence Alignment: 16. Allergen Name: Lep d 2.0201 Sequence ID: CAA58755

 Score = 128.1 bits 505,  Expect = 9e-32
 Identities = 70/140 50%, Positives = 95/140 67%, Gaps = 0/140 0%
Query  1    MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
            M KFI L  LV+ A+ G + F  C HGEVT LD+SGCSGD C+IH+G+  TL   F ANQ
Sbjct  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            D+ K+ IK+ A +    + VPG++ DGCK   CP+KKG+  +++Y + IP I P +K   
Sbjct  61   DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKADV 120
Query  121  TASLVGDHGVVACGKVNTEV 140
            TA LVGDHGV+ACG ++ +V
Sbjct  121  TAELVGDHGVMACGTIHGQV 140

Sequence Alignment: 17. Allergen Name: Lep d 2 Sequence ID: P80384

 Score = 125.7 bits 495,  Expect = 5e-31
 Identities = 70/140 50%, Positives = 95/140 67%, Gaps = 0/140 0%
Query  1    MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
            M KFI L  LV+ A+ G + F  C HGEVT LD++GCSGD C+IH+G+  TL+  F ANQ
Sbjct  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            D+ K+ IK+ A +    + VPG++ DGCK   CP+KKG+  ++ YS  IP I P +K   
Sbjct  61   DTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV 120
Query  121  TASLVGDHGVVACGKVNTEV 140
            TA L+GDHGV+ACG V+ +V
Sbjct  121  TAELIGDHGVMACGTVHGQV 140

Sequence Alignment: 18. Allergen Name: Lep d 2.0102 Sequence ID: CAD32313

 Score = 124.5 bits 490,  Expect = 1e-30
 Identities = 69/140 49%, Positives = 94/140 67%, Gaps = 0/140 0%
Query  1    MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
            M KFI L  LV+ A+ G + F  C HGEVT LD++GCSGD C+IH+G+  TL+  F ANQ
Sbjct  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            D+ K+ IK+   +    + VPG++ DGCK   CP+KKG+  ++ YS  IP I P +K   
Sbjct  61   DTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV 120
Query  121  TASLVGDHGVVACGKVNTEV 140
            TA L+GDHGV+ACG V+ +V
Sbjct  121  TAELIGDHGVMACGTVHGQV 140

Sequence Alignment: 19. Allergen Name: Gly d 2.0201 Sequence ID: CAB76459

 Score = 116.1 bits 455,  Expect = 3e-28
 Identities = 61/124 49%, Positives = 83/124 66%, Gaps = 0/124 0%
Query  17   GDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNI 76
            G +KF  C  GEVT LD++ CSGD C+IH+GK +TL+  F ANQD+ K  IK+ A +   
Sbjct  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
Query  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTASLVGDHGVVACGKV 136
             + VPG++ DGCK   CP+KKG   ++ Y+  +P ILP +K   TA LVGDHGV+ACG+ 
Sbjct  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF 120
Query  137  NTEV 140
              +V
Sbjct  121  GRQV 124

Sequence Alignment: 20. Allergen Name: Der f 2 Sequence ID: Q00855

 Score = 103.7 bits 403,  Expect = 2e-24
 Identities = 56/131 42%, Positives = 86/131 65%, Gaps = 2/131 1%
Query  3    KFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQD 61
            K +CL+LLV+      V    CA+ E+  + + GC G D CIIH+GK FTL+ +F ANQ+
Sbjct  4    KILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQN 63
Query  62   SEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT- 120
            ++  +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V  
Sbjct  64   TKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
Query  121  TASLVGDHGVVAC 133
            T  L+GD+GV+AC
Sbjct  124  TVKLIGDNGVLAC 136

Sequence Alignment: 21. Allergen Name: Der p 2.0114 Sequence ID: CAK22338

 Score = 103.5 bits 402,  Expect = 2e-24
 Identities = 56/133 42%, Positives = 88/133 66%, Gaps = 2/133 1%
Query  1    MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDH-CIIHKGKSFTLKTFFIAN 59
            M+K +CL+LLV+  A   V    CA+ E+  + + GC G   CIIH+GK F L+ +F AN
Sbjct  2    MYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEAN 61
Query  60   QDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTV 119
            Q+++  +I+I A ++ +EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + V
Sbjct  62   QNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
Query  120  T-TASLVGDHGVVAC 133
              T  ++GD+GV+AC
Sbjct  122  VVTVKVLGDNGVLAC 136

Sequence Alignment: 22. Allergen Name: Eur m 2 Sequence ID: Q9TZZ2

 Score = 102.1 bits 396,  Expect = 6e-24
 Identities = 55/133 41%, Positives = 85/133 63%, Gaps = 2/133 1%
Query  1    MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDH-CIIHKGKSFTLKTFFIAN 59
            M+K +CL+LLV+  A   V    CA+ E+  + + GC G   C+IH+G +F L+  F AN
Sbjct  1    MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN 60
Query  60   QDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTV 119
            Q+S   +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V
Sbjct  61   QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV 120
Query  120  T-TASLVGDHGVVAC 133
              T  L+GD+GV+AC
Sbjct  121  VVTVKLLGDNGVLAC 135

Sequence Alignment: 23. Allergen Name: Der p 2 Sequence ID: P49278

 Score = 101.3 bits 393,  Expect = 1e-23
 Identities = 56/133 42%, Positives = 86/133 64%, Gaps = 2/133 1%
Query  1    MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDH-CIIHKGKSFTLKTFFIAN 59
            M+K +CL+LLV+  A   V    CA+ E+  + + GC G   CIIH+GK F L+  F AN
Sbjct  2    MYKILCLSLLVAAVARDQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEAN 61
Query  60   QDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTV 119
            Q+++  +I+I A ++ +EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + V
Sbjct  62   QNTKTAKIEIKASIDGLEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
Query  120  T-TASLVGDHGVVAC 133
              T  ++GD GV+AC
Sbjct  122  VVTVKVMGDDGVLAC 136

Sequence Alignment: 24. Allergen Name: Gly d 2.0101 Sequence ID: CAB59976

 Score = 99.2 bits 384,  Expect = 4e-23
 Identities = 52/124 41%, Positives = 84/124 67%, Gaps = 2/124 1%
Query  17   GDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMN-N 75
            G + FT C H E+  L +S C+G++C+IH+GK +TL   F ANQD+  + + ++AI++ +
Sbjct  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
Query  76   IEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLI-IPTILPNLKTVTTASLVGDHGVVACG 134
            I + +PG++ + CK   CP++KG+  EL Y++  IP   P +K    A L+G+HGV+ACG
Sbjct  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
Query  135  KVNTEV 140
             V+ EV
Sbjct  121  WVDGEV 126

Sequence Alignment: 25. Allergen Name: Der f 2 Sequence ID: BAA01239

 Score = 97.8 bits 378,  Expect = 1e-22
 Identities = 53/126 42%, Positives = 82/126 65%, Gaps = 2/126 1%
Query  8    ALLVSPAAGGDVKFTACAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQDSEKLE 66
            +LLV+      V    CA+ E+  + + GC G D CIIH+GK FTL+ +F ANQ+++  +
Sbjct  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
Query  67   IKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLV 125
            I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V  T  L+
Sbjct  61   IEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLI 120
Query  126  GDHGVVAC 133
            GD+GV+AC
Sbjct  121  GDNGVLAC 128

Sequence Alignment: 26. Allergen Name: Der f 2 Sequence ID: BAA01241

 Score = 96.8 bits 374,  Expect = 2e-22
 Identities = 54/126 42%, Positives = 81/126 64%, Gaps = 2/126 1%
Query  8    ALLVSPAAGGDVKFTACAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQDSEKLE 66
            +LLV+      V    CA+ E+  + + GC G D CIIH+GK FTL+ +F ANQ+++  +
Sbjct  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
Query  67   IKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLV 125
            I+I A ++ +E+ VPG+D + C    CPL KGQ+Y+  Y+  +P I P  + V  T  LV
Sbjct  61   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV 120
Query  126  GDHGVVAC 133
            GD+GV+AC
Sbjct  121  GDNGVLAC 128

Sequence Alignment: 27. Allergen Name: Der f 2.0109 Sequence ID: ABA39438

 Score = 92.1 bits 354,  Expect = 6e-21
 Identities = 53/114 46%, Positives = 78/114 68%, Gaps = 4/114 3%
Query  18   DVKFTACAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNI 76
            DVK   CA+ E+  + + G  G D CIIH+GK FTL+ +F ANQ+++  +I+I A +N +
Sbjct  4    DVK--DCANNEIKKVMVDGRHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKANINGL 61
Query  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDHGVVAC 133
            EV VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V  T  L+GD+GV+AC
Sbjct  62   EVDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLAC 119

Sequence Alignment: 28. Allergen Name: Der f 2 Sequence ID: AAK30133

 Score = 90.8 bits 349,  Expect = 2e-20
 Identities = 48/109 44%, Positives = 75/109 68%, Gaps = 2/109 1%
Query  25   AHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNIEVPVPGV 83
            A+ E+  + + GC G D CIIH+GK FTL+ +F ANQ+++  +I+I A ++ +E+ VPG+
Sbjct  50   ANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGI 109
Query  84   DKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDHGVVAC 133
            D + C    CPL KGQ+Y++ Y+  +P I P  + V  T  L+GD+GV+AC
Sbjct  110  DTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLAC 160

Sequence Alignment: 29. Allergen Name: Der p 2.0109 Sequence ID: ABA39437

 Score = 90.4 bits 347,  Expect = 2e-20
 Identities = 51/114 44%, Positives = 77/114 67%, Gaps = 4/114 3%
Query  18   DVKFTACAHGEVTSLDLSGCSGDH-CIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNI 76
            DVK   CA+ E+  + + GC G   CIIH+GK F L+  F ANQ+S+  +I+I A ++ +
Sbjct  4    DVK--DCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
Query  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDHGVVAC 133
            EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + V  T  ++GD+GV+AC
Sbjct  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLAC 119

Sequence Alignment: 30. Allergen Name: Der p 2.0115 Sequence ID: CAQ68249

 Score = 90.4 bits 347,  Expect = 2e-20
 Identities = 51/114 44%, Positives = 77/114 67%, Gaps = 4/114 3%
Query  18   DVKFTACAHGEVTSLDLSGCSGDH-CIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNI 76
            DVK   CA+ E+  + + GC G   CIIH+GK F L+  F ANQ+S+  +I+I A ++ +
Sbjct  4    DVK--DCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
Query  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDHGVVAC 133
            EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + V  T  ++GD+GV+AC
Sbjct  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVMGDNGVLAC 119

Sequence Alignment: 31. Allergen Name: Eur m 2.0102 Sequence ID: AAC82350

 Score = 90.4 bits 347,  Expect = 2e-20
 Identities = 49/123 39%, Positives = 76/123 61%, Gaps = 2/123 1%
Query  11   VSPAAGGDVKFTACAHGEVTSLDLSGCSGDH-CIIHKGKSFTLKTFFIANQDSEKLEIKI 69
            V+  A   V    CA+ E+  + + GC G   C+IH+G +F L+  F ANQ+S   +I+I
Sbjct  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
Query  70   SAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDH 128
             A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V  T  L+GD+
Sbjct  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
Query  129  GVVAC 133
            GV+AC
Sbjct  121  GVLAC 125

Sequence Alignment: 32. Allergen Name: Lep d 2.0101 Sequence ID: CAA57160

 Score = 84.9 bits 324,  Expect = 6e-19
 Identities = 46/97 47%, Positives = 65/97 67%, Gaps = 0/97 0%
Query  44   IHKGKSFTLKTFFIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYEL 103
            IH+G+  TL+  F ANQD+ K+ IK+ A +    + VPG++ DGCK   CP+KKG+  ++
Sbjct  1    IHRGEKMTLEAKFAANQDTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDF 60
Query  104  DYSLIIPTILPNLKTVTTASLVGDHGVVACGKVNTEV 140
             YS  IP I P +K   TA L+GDHGV+ACG V+ +V
Sbjct  61   IYSGTIPAITPKVKADVTAELIGDHGVMACGTVHGQV 97

Sequence Alignment: 33. Allergen Name: Can f 7.0101 Sequence ID: Q28895

 Score = 63.4 bits 234,  Expect = 3e-12
 Identities = 42/135 31%, Positives = 73/135 54%, Gaps = 7/135 5%
Query  4    FICLALL-VSPAAGGDVKFTAC--AHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
            F+ LAL  + P  GG V F  C  A G +  L+++ C    C +HKG+S+++   F +N 
Sbjct  8    FLLLALGDLGP--GGAVHFKDCGSAVGVIKELNVNPCPAQPCKLHKGQSYSVNVTFTSNI 65
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKH-TTCPLKKGQKYELDYSLIIPTILPNLKTV 119
             S+  +  +  I+  + VP P  + DGCK    CP++K + Y     L +    P++K V
Sbjct  66   PSQSSKAVVHGIVLGVAVPFPIPEADGCKSGINCPIQKDKTYSYLNKLPVKNEYPSIKLV 125
Query  120  TTASLVGDHGV-VACGKVNTEV 140
                L+GD+   + C ++  ++
Sbjct  126  VQWMLLGDNNQHLFCWEIPVQI 147

Sequence Alignment: 34. Allergen Name: Der f 22.0101 Sequence ID: ABG76195

 Score = 62.2 bits 229,  Expect = 7e-12
 Identities = 43/136 31%, Positives = 77/136 56%, Gaps = 11/136 8%
Query  2    FKFICLALL-VSPAAGGD---VKFTACAHGEVTSLDLSGCSGDH--CIIHKGKSFTLKTF 55
            F  +C+AL+ ++ A   D   V++  C H E+ S+ ++G + ++  C+IHK     L+  
Sbjct  4    FLIVCMALFCLAAAVQADETNVQYKDCGHNEIKSFFVTGGNPNQKSCVIHKHSKNQLRIS 63
Query  56   FIANQDS-EKLEIKISAIMNNIEVPVPGVD-KDGCK-H-TTCPLKKGQKYELDYSLIIPT 111
            F+AN+++  K+  +    +  IE+  PG+D  D C+ H  +CPL KGQ Y     + +  
Sbjct  64   FVANENTGNKINTRFICNLGGIELGWPGIDGTDACQGHGLSCPLTKGQTYNYHLDFNLGD 123
Query  112  ILPNLKTVTTASLVGDHGV-VACGKVN 137
             +P      T  L   HG  + CG+++
Sbjct  124  DVPTANVTATVRLENGHGGDLLCGRMH 150

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.