The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQ
DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT
TASLVGDHGVVACGKVNTEVVD
Sequence Info Allergen Name Length Opt Bits Score E Value
A6XEP0 Blo t 2.0104 142 941 233.6 1.5e-63
A6XEP6 Blo t 2.0104 142 933 231.7 5.8e-63
A6XEP3 Blo t 2.0104 142 933 231.7 5.8e-63
A6XEP2 Blo t 2.0104 142 928 230.5 1.3e-62
A6XEP1 Blo t 2.0104 142 926 230.0 1.9e-62
A6XEP4 Blo t 2.0104 142 925 229.8 2.2e-62
A6XEN8 Blo t 2.0104 142 915 227.4 1.2e-61
A6XEN9 Blo t 2.0104 142 910 226.2 2.7e-61
AAQ73482 Blo t 2.0102 142 908 225.7 3.7e-61
AAQ73483 Blo t 2.0101 144 903 224.5 8.8e-61
A6XEP5 Blo t 2.0104 142 894 222.3 3.9e-60
AAQ73481 Blo t 2.0103 141 808 201.7 6.4e-54
BAX34757 Der f 35.0101 143 531 135.0 7.5e-34
O02380 Tyr p 2 141 519 132.1 5.4e-33
CAD32314 Lep d 2.0202 141 512 130.5 1.8e-32
CAA58755 Lep d 2.0201 141 512 130.5 1.8e-32
P80384 Lep d 2 141 502 128.0 9.3e-32
CAD32313 Lep d 2.0102 141 497 126.8 2.1e-31
CAB76459 Gly d 2.0201 125 455 116.8 2e-28
Q00855 Der f 2 146 407 105.2 7.4e-25
CAK22338 Der p 2.0114 146 406 104.9 8.7e-25
Q9TZZ2 Eur m 2 145 400 103.5 2.4e-24
P49278 Der p 2 146 393 101.8 7.6e-24
CAB59976 Gly d 2.0101 128 384 99.7 2.8e-23
BAA01239 Der f 2 138 382 99.2 4.4e-23
BAA01241 Der f 2 138 378 98.2 8.6e-23
ABA39438 Der f 2.0109 129 354 92.5 4.2e-21
AAC82350 Eur m 2.0102 135 351 91.8 7.5e-21
CAQ68249 Der p 2.0115 129 347 90.8 1.4e-20
ABA39437 Der p 2.0109 129 347 90.8 1.4e-20
AAK30133 Der f 2 170 344 89.9 3.4e-20
CAA57160 Lep d 2.0101 98 314 83.1 2.2e-18
ABG76195 Der f 22.0101 155 231 62.8 4.5e-12
Q28895 Can f 7.0101 149 227 61.9 8.3e-12
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP0

 Score = 233.6 bits 941,  Expect = 2e-63
 Identities = 142/142 100%, Positives = 142/142 100%, Gaps = 0/142 0%
Query  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQ 60
            MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TASLVGDHGVVACGKVNTEVVD 142
            TASLVGDHGVVACGKVNTEVVD
Sbjct  121  TASLVGDHGVVACGKVNTEVVD 142

Sequence Alignment: 2. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP6

 Score = 231.7 bits 933,  Expect = 6e-63
 Identities = 140/142 98%, Positives = 141/142 99%, Gaps = 0/142 0%
Query  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQ 60
            MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCII KGKSFTLKTFFIANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TASLVGDHGVVACGKVNTEVVD 142
            TASLVGDHGVVACGKVNTEV+D
Sbjct  121  TASLVGDHGVVACGKVNTEVID 142

Sequence Alignment: 3. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP3

 Score = 231.7 bits 933,  Expect = 6e-63
 Identities = 140/142 98%, Positives = 141/142 99%, Gaps = 0/142 0%
Query  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQ 60
            MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCII KGKSFTLKTFFIANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKT+T
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTIT 120
Query  121  TASLVGDHGVVACGKVNTEVVD 142
            TASLVGDHGVVACGKVNTEVVD
Sbjct  121  TASLVGDHGVVACGKVNTEVVD 142

Sequence Alignment: 4. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP2

 Score = 230.5 bits 928,  Expect = 1e-62
 Identities = 140/142 98%, Positives = 140/142 98%, Gaps = 0/142 0%
Query  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQ 60
            MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCII KGKSFTLKTFFIANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TASLVGDHGVVACGKVNTEVVD 142
            TASLVGDHGVVACGKVNTEV D
Sbjct  121  TASLVGDHGVVACGKVNTEVFD 142

Sequence Alignment: 5. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP1

 Score = 230.0 bits 926,  Expect = 2e-62
 Identities = 140/141 99%, Positives = 140/141 99%, Gaps = 0/141 0%
Query  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQ 60
            MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCII KGKSFTLKTFFIANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TASLVGDHGVVACGKVNTEVV 141
            TASLVGDHGVVACGKVNTEVV
Sbjct  121  TASLVGDHGVVACGKVNTEVV 141

Sequence Alignment: 6. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP4

 Score = 229.8 bits 925,  Expect = 2e-62
 Identities = 140/142 98%, Positives = 140/142 98%, Gaps = 0/142 0%
Query  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQ 60
            MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCS DHCII KGKSFTLKTFFIANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSDDHCIIHKGKSFTLKTFFIANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TASLVGDHGVVACGKVNTEVVD 142
            TASLVGDHGVVACGKVNTEVVD
Sbjct  121  TASLVGDHGVVACGKVNTEVVD 142

Sequence Alignment: 7. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN8

 Score = 227.4 bits 915,  Expect = 1e-61
 Identities = 138/142 97%, Positives = 138/142 97%, Gaps = 0/142 0%
Query  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQ 60
            MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHC I KGKSFTLKTFFIANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCTIHKGKSFTLKTFFIANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            DSEKLEIKISA MN IEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT
Sbjct  61   DSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TASLVGDHGVVACGKVNTEVVD 142
            TASLVGDHGVVACGKVNTEVVD
Sbjct  121  TASLVGDHGVVACGKVNTEVVD 142

Sequence Alignment: 8. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN9

 Score = 226.2 bits 910,  Expect = 3e-61
 Identities = 136/142 95%, Positives = 138/142 97%, Gaps = 0/142 0%
Query  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQ 60
            MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHC I KGKSFTLKTFFIANQ
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCTIHKGKSFTLKTFFIANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            DSEKLEIKISA MN IEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPT+LPN+KTVT
Sbjct  61   DSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTVT 120
Query  121  TASLVGDHGVVACGKVNTEVVD 142
            TASLVGDHGVVACGKVNTEVVD
Sbjct  121  TASLVGDHGVVACGKVNTEVVD 142

Sequence Alignment: 9. Allergen Name: Blo t 2.0102 Sequence ID: AAQ73482

 Score = 225.7 bits 908,  Expect = 4e-61
 Identities = 138/142 97%, Positives = 138/142 97%, Gaps = 0/142 0%
Query  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQ 60
            MFKFICLALLVS AA GDVKFT CAHGEVTSLDLSGCSGDHCII KGKSFTLKTFFIANQ
Sbjct  1    MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT
Sbjct  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
Query  121  TASLVGDHGVVACGKVNTEVVD 142
            TASLVGDHGVVACGKVNTEVVD
Sbjct  121  TASLVGDHGVVACGKVNTEVVD 142

Sequence Alignment: 10. Allergen Name: Blo t 2.0101 Sequence ID: AAQ73483

 Score = 224.5 bits 903,  Expect = 9e-61
 Identities = 139/142 97%, Positives = 139/142 97%, Gaps = 2/142 1%
Query  1    MFKFICLALLV--SYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIA 58
            MFKFICLALL   S AAAGDVKFTDCAHGEVTSLDLSGCSGDHCII KGKSFTLKTFFIA
Sbjct  1    MFKFICLALLPFWSRAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIA 60
Query  59   NQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKT 118
            NQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKT
Sbjct  61   NQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKT 120
Query  119  VTTASLVGDHGVVACGKVNTEVVD 142
            VTTASLVGDHGVVACGKVNTEVVD
Sbjct  121  VTTASLVGDHGVVACGKVNTEVVD 144

Sequence Alignment: 11. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP5

 Score = 222.3 bits 894,  Expect = 4e-60
 Identities = 134/142 94%, Positives = 136/142 95%, Gaps = 0/142 0%
Query  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQ 60
            MFKFICLALLVSYA AGDVKFTDCAHGEVTSLDLS CSGDHC I KGKSFTLKTFFIANQ
Sbjct  1    MFKFICLALLVSYATAGDVKFTDCAHGEVTSLDLSRCSGDHCTIHKGKSFTLKTFFIANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            DSEKLEIKISA MN IEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPT+LPN+KTVT
Sbjct  61   DSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTVT 120
Query  121  TASLVGDHGVVACGKVNTEVVD 142
            TASLVGDHGVVACGKVNTEVVD
Sbjct  121  TASLVGDHGVVACGKVNTEVVD 142

Sequence Alignment: 12. Allergen Name: Blo t 2.0103 Sequence ID: AAQ73481

 Score = 201.7 bits 808,  Expect = 6e-54
 Identities = 127/141 90%, Positives = 128/141 90%, Gaps = 1/141 0%
Query  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQ 60
            MFKFICLALLVS        +  C   EVTSLDLSGCSGDHCII KGKSFTLKTFFIANQ
Sbjct  1    MFKFICLALLVSSRRQRCQIYRSCTW-EVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQ 59
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT
Sbjct  60   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 119
Query  121  TASLVGDHGVVACGKVNTEVVD 142
            TASLVGDHGVVACGKVNTEVVD
Sbjct  120  TASLVGDHGVVACGKVNTEVVD 141

Sequence Alignment: 13. Allergen Name: Der f 35.0101 Sequence ID: BAX34757

 Score = 135.0 bits 531,  Expect = 8e-34
 Identities = 72/142 50%, Positives = 101/142 71%, Gaps = 1/142 0%
Query  1    MFKFICL-ALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIAN 59
            M KF+C+ AL  + A+AG +KF DC H EV SLD+SGC GD+C++ KGK+  L     +N
Sbjct  1    MIKFLCIFALTFAVASAGKMKFVDCGHKEVISLDVSGCEGDYCVLHKGKTIDLDMKCKSN 60
Query  60   QDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTV 119
            QDSE L++ ISA +N IE+ VPG D+DGC +  CP+ KGQ Y++ YS  +P +LPN+K  
Sbjct  61   QDSEHLKLIISADVNGIEIEVPGFDQDGCHYVQCPIHKGQDYDIKYSYNVPAVLPNIKGT 120
Query  120  TTASLVGDHGVVACGKVNTEVVD 142
             TA ++GD+G+V C K+N E+ D
Sbjct  121  LTAKVIGDNGLVGCLKLNGEIAD 143

Sequence Alignment: 14. Allergen Name: Tyr p 2 Sequence ID: O02380

 Score = 132.1 bits 519,  Expect = 5e-33
 Identities = 70/138 50%, Positives = 98/138 71%, Gaps = 0/138 0%
Query  3    KFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQDS 62
            KF+ L  LV+ AAAG VKFTDC   E+ S+ + GC GD C+I K K   +   F ANQD+
Sbjct  2    KFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDT 61
Query  63   EKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTA 122
             K+E+K++  +N +EVP+PG++ DGCK   CPLKKG KY ++YS+ +P+++PN+KTV   
Sbjct  62   CKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVKL 121
Query  123  SLVGDHGVVACGKVNTEV 140
               G+HGV+ACG VNT+V
Sbjct  122  LATGEHGVLACGAVNTDV 139

Sequence Alignment: 15. Allergen Name: Lep d 2.0202 Sequence ID: CAD32314

 Score = 130.5 bits 512,  Expect = 2e-32
 Identities = 71/140 50%, Positives = 96/140 68%, Gaps = 0/140 0%
Query  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQ 60
            M KFI L  LV+ A+AG + F DC HGEVT LD+SGCSGD C+I +G+  TL   F ANQ
Sbjct  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            D+ K+ IK+ A +    + VPG++ DGCK   CP+KKG+  +++Y + IP I P +K   
Sbjct  61   DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVDV 120
Query  121  TASLVGDHGVVACGKVNTEV 140
            TA LVGDHGV+ACG ++ +V
Sbjct  121  TAELVGDHGVMACGTIHGQV 140

Sequence Alignment: 16. Allergen Name: Lep d 2.0201 Sequence ID: CAA58755

 Score = 130.5 bits 512,  Expect = 2e-32
 Identities = 71/140 50%, Positives = 96/140 68%, Gaps = 0/140 0%
Query  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQ 60
            M KFI L  LV+ A+AG + F DC HGEVT LD+SGCSGD C+I +G+  TL   F ANQ
Sbjct  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            D+ K+ IK+ A +    + VPG++ DGCK   CP+KKG+  +++Y + IP I P +K   
Sbjct  61   DTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKADV 120
Query  121  TASLVGDHGVVACGKVNTEV 140
            TA LVGDHGV+ACG ++ +V
Sbjct  121  TAELVGDHGVMACGTIHGQV 140

Sequence Alignment: 17. Allergen Name: Lep d 2 Sequence ID: P80384

 Score = 128.0 bits 502,  Expect = 9e-32
 Identities = 71/140 50%, Positives = 96/140 68%, Gaps = 0/140 0%
Query  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQ 60
            M KFI L  LV+ A+AG + F DC HGEVT LD++GCSGD C+I +G+  TL+  F ANQ
Sbjct  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            D+ K+ IK+ A +    + VPG++ DGCK   CP+KKG+  ++ YS  IP I P +K   
Sbjct  61   DTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV 120
Query  121  TASLVGDHGVVACGKVNTEV 140
            TA L+GDHGV+ACG V+ +V
Sbjct  121  TAELIGDHGVMACGTVHGQV 140

Sequence Alignment: 18. Allergen Name: Lep d 2.0102 Sequence ID: CAD32313

 Score = 126.8 bits 497,  Expect = 2e-31
 Identities = 70/140 50%, Positives = 95/140 67%, Gaps = 0/140 0%
Query  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQ 60
            M KFI L  LV+ A+AG + F DC HGEVT LD++GCSGD C+I +G+  TL+  F ANQ
Sbjct  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ 60
Query  61   DSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            D+ K+ IK+   +    + VPG++ DGCK   CP+KKG+  ++ YS  IP I P +K   
Sbjct  61   DTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV 120
Query  121  TASLVGDHGVVACGKVNTEV 140
            TA L+GDHGV+ACG V+ +V
Sbjct  121  TAELIGDHGVMACGTVHGQV 140

Sequence Alignment: 19. Allergen Name: Gly d 2.0201 Sequence ID: CAB76459

 Score = 116.8 bits 455,  Expect = 2e-28
 Identities = 61/124 49%, Positives = 83/124 66%, Gaps = 0/124 0%
Query  17   GDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQDSEKLEIKISAIMNNI 76
            G +KF DC  GEVT LD++ CSGD C+I +GK +TL+  F ANQD+ K  IK+ A +   
Sbjct  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
Query  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTASLVGDHGVVACGKV 136
             + VPG++ DGCK   CP+KKG   ++ Y+  +P ILP +K   TA LVGDHGV+ACG+ 
Sbjct  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF 120
Query  137  NTEV 140
              +V
Sbjct  121  GRQV 124

Sequence Alignment: 20. Allergen Name: Der f 2 Sequence ID: Q00855

 Score = 105.2 bits 407,  Expect = 7e-25
 Identities = 57/131 43%, Positives = 87/131 66%, Gaps = 2/131 1%
Query  3    KFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCIIRKGKSFTLKTFFIANQD 61
            K +CL+LLV+   A  V   DCA+ E+  + + GC G D CII +GK FTL+ +F ANQ+
Sbjct  4    KILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQN 63
Query  62   SEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT- 120
            ++  +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V  
Sbjct  64   TKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
Query  121  TASLVGDHGVVAC 133
            T  L+GD+GV+AC
Sbjct  124  TVKLIGDNGVLAC 136

Sequence Alignment: 21. Allergen Name: Der p 2.0114 Sequence ID: CAK22338

 Score = 104.9 bits 406,  Expect = 9e-25
 Identities = 57/133 42%, Positives = 89/133 66%, Gaps = 2/133 1%
Query  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CIIRKGKSFTLKTFFIAN 59
            M+K +CL+LLV+  AA  V   DCA+ E+  + + GC G   CII +GK F L+ +F AN
Sbjct  2    MYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEAN 61
Query  60   QDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTV 119
            Q+++  +I+I A ++ +EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + V
Sbjct  62   QNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
Query  120  T-TASLVGDHGVVAC 133
              T  ++GD+GV+AC
Sbjct  122  VVTVKVLGDNGVLAC 136

Sequence Alignment: 22. Allergen Name: Eur m 2 Sequence ID: Q9TZZ2

 Score = 103.5 bits 400,  Expect = 2e-24
 Identities = 56/133 42%, Positives = 86/133 64%, Gaps = 2/133 1%
Query  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CIIRKGKSFTLKTFFIAN 59
            M+K +CL+LLV+  AA  V   DCA+ E+  + + GC G   C+I +G +F L+  F AN
Sbjct  1    MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN 60
Query  60   QDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTV 119
            Q+S   +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V
Sbjct  61   QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV 120
Query  120  T-TASLVGDHGVVAC 133
              T  L+GD+GV+AC
Sbjct  121  VVTVKLLGDNGVLAC 135

Sequence Alignment: 23. Allergen Name: Der p 2 Sequence ID: P49278

 Score = 101.8 bits 393,  Expect = 8e-24
 Identities = 56/133 42%, Positives = 86/133 64%, Gaps = 2/133 1%
Query  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CIIRKGKSFTLKTFFIAN 59
            M+K +CL+LLV+  A   V   DCA+ E+  + + GC G   CII +GK F L+  F AN
Sbjct  2    MYKILCLSLLVAAVARDQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEAN 61
Query  60   QDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTV 119
            Q+++  +I+I A ++ +EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + V
Sbjct  62   QNTKTAKIEIKASIDGLEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
Query  120  T-TASLVGDHGVVAC 133
              T  ++GD GV+AC
Sbjct  122  VVTVKVMGDDGVLAC 136

Sequence Alignment: 24. Allergen Name: Gly d 2.0101 Sequence ID: CAB59976

 Score = 99.7 bits 384,  Expect = 3e-23
 Identities = 52/124 41%, Positives = 84/124 67%, Gaps = 2/124 1%
Query  17   GDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQDSEKLEIKISAIMN-N 75
            G + FTDC H E+  L +S C+G++C+I +GK +TL   F ANQD+  + + ++AI++ +
Sbjct  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
Query  76   IEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLI-IPTILPNLKTVTTASLVGDHGVVACG 134
            I + +PG++ + CK   CP++KG+  EL Y++  IP   P +K    A L+G+HGV+ACG
Sbjct  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
Query  135  KVNTEV 140
             V+ EV
Sbjct  121  WVDGEV 126

Sequence Alignment: 25. Allergen Name: Der f 2 Sequence ID: BAA01239

 Score = 99.2 bits 382,  Expect = 4e-23
 Identities = 54/126 42%, Positives = 83/126 65%, Gaps = 2/126 1%
Query  8    ALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCIIRKGKSFTLKTFFIANQDSEKLE 66
            +LLV+   A  V   DCA+ E+  + + GC G D CII +GK FTL+ +F ANQ+++  +
Sbjct  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
Query  67   IKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLV 125
            I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V  T  L+
Sbjct  61   IEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLI 120
Query  126  GDHGVVAC 133
            GD+GV+AC
Sbjct  121  GDNGVLAC 128

Sequence Alignment: 26. Allergen Name: Der f 2 Sequence ID: BAA01241

 Score = 98.2 bits 378,  Expect = 9e-23
 Identities = 55/126 43%, Positives = 82/126 65%, Gaps = 2/126 1%
Query  8    ALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCIIRKGKSFTLKTFFIANQDSEKLE 66
            +LLV+   A  V   DCA+ E+  + + GC G D CII +GK FTL+ +F ANQ+++  +
Sbjct  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
Query  67   IKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLV 125
            I+I A ++ +E+ VPG+D + C    CPL KGQ+Y+  Y+  +P I P  + V  T  LV
Sbjct  61   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV 120
Query  126  GDHGVVAC 133
            GD+GV+AC
Sbjct  121  GDNGVLAC 128

Sequence Alignment: 27. Allergen Name: Der f 2.0109 Sequence ID: ABA39438

 Score = 92.5 bits 354,  Expect = 4e-21
 Identities = 53/114 46%, Positives = 78/114 68%, Gaps = 4/114 3%
Query  18   DVKFTDCAHGEVTSLDLSGCSG-DHCIIRKGKSFTLKTFFIANQDSEKLEIKISAIMNNI 76
            DVK  DCA+ E+  + + G  G D CII +GK FTL+ +F ANQ+++  +I+I A +N +
Sbjct  4    DVK--DCANNEIKKVMVDGRHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKANINGL 61
Query  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDHGVVAC 133
            EV VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V  T  L+GD+GV+AC
Sbjct  62   EVDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLAC 119

Sequence Alignment: 28. Allergen Name: Eur m 2.0102 Sequence ID: AAC82350

 Score = 91.8 bits 351,  Expect = 7e-21
 Identities = 50/123 40%, Positives = 77/123 62%, Gaps = 2/123 1%
Query  11   VSYAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CIIRKGKSFTLKTFFIANQDSEKLEIKI 69
            V+  AA  V   DCA+ E+  + + GC G   C+I +G +F L+  F ANQ+S   +I+I
Sbjct  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
Query  70   SAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDH 128
             A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V  T  L+GD+
Sbjct  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
Query  129  GVVAC 133
            GV+AC
Sbjct  121  GVLAC 125

Sequence Alignment: 29. Allergen Name: Der p 2.0115 Sequence ID: CAQ68249

 Score = 90.8 bits 347,  Expect = 1e-20
 Identities = 51/114 44%, Positives = 77/114 67%, Gaps = 4/114 3%
Query  18   DVKFTDCAHGEVTSLDLSGCSGDH-CIIRKGKSFTLKTFFIANQDSEKLEIKISAIMNNI 76
            DVK  DCA+ E+  + + GC G   CII +GK F L+  F ANQ+S+  +I+I A ++ +
Sbjct  4    DVK--DCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
Query  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDHGVVAC 133
            EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + V  T  ++GD+GV+AC
Sbjct  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVMGDNGVLAC 119

Sequence Alignment: 30. Allergen Name: Der p 2.0109 Sequence ID: ABA39437

 Score = 90.8 bits 347,  Expect = 1e-20
 Identities = 51/114 44%, Positives = 77/114 67%, Gaps = 4/114 3%
Query  18   DVKFTDCAHGEVTSLDLSGCSGDH-CIIRKGKSFTLKTFFIANQDSEKLEIKISAIMNNI 76
            DVK  DCA+ E+  + + GC G   CII +GK F L+  F ANQ+S+  +I+I A ++ +
Sbjct  4    DVK--DCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
Query  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDHGVVAC 133
            EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + V  T  ++GD+GV+AC
Sbjct  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLAC 119

Sequence Alignment: 31. Allergen Name: Der f 2 Sequence ID: AAK30133

 Score = 89.9 bits 344,  Expect = 3e-20
 Identities = 51/131 38%, Positives = 84/131 64%, Gaps = 8/131 6%
Query  3    KFICLALLVSYAAAGD------VKFTDCAHGEVTSLDLSGCSG-DHCIIRKGKSFTLKTF 55
            KF+C+  + S+           + +   A+ E+  + + GC G D CII +GK FTL+ +
Sbjct  22   KFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVDGCHGSDPCIIHRGKPFTLEAL 81
Query  56   FIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPN 115
            F ANQ+++  +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P 
Sbjct  82   FDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPK 141
Query  116  LKTVT-TASLVGDHGVVAC 133
             + V  T  L+GD+GV+AC
Sbjct  142  SENVVVTVKLIGDNGVLAC 160

Sequence Alignment: 32. Allergen Name: Lep d 2.0101 Sequence ID: CAA57160

 Score = 83.1 bits 314,  Expect = 2e-18
 Identities = 45/97 46%, Positives = 64/97 65%, Gaps = 0/97 0%
Query  44   IRKGKSFTLKTFFIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYEL 103
            I +G+  TL+  F ANQD+ K+ IK+ A +    + VPG++ DGCK   CP+KKG+  ++
Sbjct  1    IHRGEKMTLEAKFAANQDTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDF 60
Query  104  DYSLIIPTILPNLKTVTTASLVGDHGVVACGKVNTEV 140
             YS  IP I P +K   TA L+GDHGV+ACG V+ +V
Sbjct  61   IYSGTIPAITPKVKADVTAELIGDHGVMACGTVHGQV 97

Sequence Alignment: 33. Allergen Name: Der f 22.0101 Sequence ID: ABG76195

 Score = 62.8 bits 231,  Expect = 5e-12
 Identities = 43/136 31%, Positives = 76/136 55%, Gaps = 11/136 8%
Query  2    FKFICLALLVSYAAAG----DVKFTDCAHGEVTSLDLSGCSGDH--CIIRKGKSFTLKTF 55
            F  +C+AL+   AA      +V++ DC H E+ S+ ++G + ++  C+I K     L+  
Sbjct  4    FLIVCMALFCLAAAVQADETNVQYKDCGHNEIKSFFVTGGNPNQKSCVIHKHSKNQLRIS 63
Query  56   FIANQDS-EKLEIKISAIMNNIEVPVPGVD-KDGCK-H-TTCPLKKGQKYELDYSLIIPT 111
            F+AN+++  K+  +    +  IE+  PG+D  D C+ H  +CPL KGQ Y     + +  
Sbjct  64   FVANENTGNKINTRFICNLGGIELGWPGIDGTDACQGHGLSCPLTKGQTYNYHLDFNLGD 123
Query  112  ILPNLKTVTTASLVGDHGV-VACGKVN 137
             +P      T  L   HG  + CG+++
Sbjct  124  DVPTANVTATVRLENGHGGDLLCGRMH 150

Sequence Alignment: 34. Allergen Name: Can f 7.0101 Sequence ID: Q28895

 Score = 61.9 bits 227,  Expect = 8e-12
 Identities = 40/136 29%, Positives = 70/136 51%, Gaps = 5/136 3%
Query  4    FICLALLVSYAAAGDVKFTDC--AHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQD 61
            F+ LAL       G V F DC  A G +  L+++ C    C + KG+S+++   F +N  
Sbjct  8    FLLLALG-DLGPGGAVHFKDCGSAVGVIKELNVNPCPAQPCKLHKGQSYSVNVTFTSNIP 66
Query  62   SEKLEIKISAIMNNIEVPVPGVDKDGCKH-TTCPLKKGQKYELDYSLIIPTILPNLKTVT 120
            S+  +  +  I+  + VP P  + DGCK    CP++K + Y     L +    P++K V 
Sbjct  67   SQSSKAVVHGIVLGVAVPFPIPEADGCKSGINCPIQKDKTYSYLNKLPVKNEYPSIKLVV 126
Query  121  TASLVGDHGV-VACGKVNTEV 140
               L+GD+   + C ++  ++
Sbjct  127  QWMLLGDNNQHLFCWEIPVQI 147

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.