The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEVKGDGGAGTVRIITLPE
GSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIF
HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN
Sequence Info Allergen Name Length Opt Bits Score E Value
CAB03715 Dau c 1.0103 154 944 240.7 1.3e-65
CAB06416 Dau c 1.0105 154 928 236.8 2.1e-64
CAB03716 Dau c 1.0104 154 918 234.3 1.2e-63
BAA13604 Dau c 1.0102 154 917 234.0 1.4e-63
AAB01092 Dau c 1.0101 168 901 230.1 2.3e-62
P49372 Api g 1 154 808 207.1 1.8e-55
CAA67246 Pet c PR10 155 581 150.9 1.4e-38
P92918 Api g 1.0201 159 481 126.2 4e-31
AAL76932 Dau c 1.0201 154 480 126.0 4.6e-31
O50001 Pru ar 1 160 432 114.1 1.8e-27
CAM31908 Act c 8.0101 159 416 110.1 2.8e-26
CAM31909 Act d 8.0101 157 414 109.6 3.9e-26
AAB92255 Tar o RAP 157 414 109.6 3.9e-26
B6CQS9 Pru du 1.0101 160 399 105.9 5.2e-25
CAD10374 Cas s 1 160 393 104.5 1.4e-24
CAA96535 Mal d 1.0401 160 388 103.2 3.4e-24
ACJ23864 Fag s 1.0101 160 386 102.7 4.8e-24
CAA54421 Bet v 1.0201 160 381 101.5 1.1e-23
P43186 Bet v 1.0204 160 380 101.2 1.3e-23
CAA54481 Bet v 1.0202 160 380 101.2 1.3e-23
CAA96537 Mal d 1.0403 160 379 101.0 1.6e-23
CAA96536 Mal d 1.0402 160 379 101.0 1.6e-23
P43184 Bet v 1.0203 160 379 101.0 1.6e-23
Q39427 Bet v 1.0205 160 378 100.7 1.9e-23
NP_001275580 Sola l 4.0201 160 378 100.7 1.9e-23
APD76154 Jug r 5.0101 160 374 99.8 3.8e-23
CAB02217 Car b 1.0302 161 374 99.8 3.8e-23
CAB02160 Bet v 1.0113 160 373 99.5 4.5e-23
Q256S6 Fra a 1 160 372 99.3 5.3e-23
AAB24432 Aln g 1 160 372 99.3 5.3e-23
Q256S7 Fra a 1 160 372 99.3 5.3e-23
AFN42528 Can s 5.0101 161 372 99.3 5.3e-23
CAB02216 Car b 1.0301 161 372 99.3 5.3e-23
Q3T923 Fra a 1 160 371 99.0 6.3e-23
CAB02208 Car b 1.0105 160 371 99.0 6.3e-23
CAB02209 Car b 1.0106 160 371 99.0 6.3e-23
Q2I6V8 Pru p 1.0101 160 371 99.0 6.3e-23
O24248 Pru av 1 160 369 98.5 8.8e-23
ABZ81046 Que a 1.0301 160 369 98.5 8.8e-23
CAA33887 Bet v 1.0101 160 368 98.3 1.1e-22
CAB02206 Car b 1.0103 160 368 98.3 1.1e-22
CAB02207 Car b 1.0104 160 368 98.3 1.1e-22
ABZ81042 Car b 1.0111 160 368 98.3 1.1e-22
CAB02159 Bet v 1.0112 160 368 98.3 1.1e-22
ABZ81043 Car b 1.0112 160 368 98.3 1.1e-22
CAB02161 Bet v 1.0114 160 367 98.0 1.2e-22
ABZ81040 Car b 1.0109 160 367 98.0 1.2e-22
ABZ81041 Car b 1.0110 160 367 98.0 1.2e-22
CAB02156 Bet v 1.0109 160 367 98.0 1.2e-22
CAA96549 Cor a 1.0301 160 366 97.8 1.5e-22
P38948 Aln g 1 159 365 97.5 1.7e-22
CAA04828.1 Bet v 1.0206 159 365 97.5 1.7e-22
CAA07329.1 Bet v 1.0118 160 365 97.5 1.8e-22
CAA54696.1 Bet v 1.0301 160 365 97.5 1.8e-22
CAB02213 Car b 1.0107 160 364 97.3 2.1e-22
ABZ81047 Que a 1.0401 160 364 97.3 2.1e-22
AUH28179 Que m 1.0101 160 364 97.3 2.1e-22
CAA96548 Cor a 1.0201 160 364 97.3 2.1e-22
CAB02215 Car b 1.0108 160 364 97.3 2.1e-22
ADK39021 Ost c 1.0101 160 362 96.8 2.9e-22
AAO25113 Mal d 1.0304 159 361 96.5 3.5e-22
AAK13027 Mal d 1.0302 159 361 96.5 3.5e-22
CAA54484 Bet v 1.0104 160 361 96.5 3.5e-22
CAA96534 Mal d 1.0301 159 360 96.3 4.1e-22
Q256S4 Fra a 1 159 360 96.3 4.1e-22
CAA54482 Bet v 1.0102 160 359 96.0 4.9e-22
Q256S2 Fra a 1 160 359 96.0 4.9e-22
CAA50325 Cor a 1.0103 160 359 96.0 4.9e-22
ACF75030.1 Bet v 1.0207 150 358 95.8 5.4e-22
CAA54483 Bet v 1.0103 160 358 95.8 5.8e-22
ABZ81044 Car b 1.0113 160 358 95.8 5.8e-22
CAA54487 Bet v 1.0106 160 358 95.8 5.8e-22
QGS84240 Que i 1.0101 159 357 95.6 6.9e-22
CAB02157 Bet v 1.0110 160 357 95.6 6.9e-22
CAA54489 Bet v 1.0107 160 355 95.1 9.7e-22
CAA50328 Cor a 1.0102 160 355 95.1 9.7e-22
CAA07323.1 Bet v 1.0117 160 355 95.1 9.7e-22
CAA96547 Bet v 1.0115 160 355 95.1 9.7e-22
CAA04827.1 Bet v 1.0116 159 354 94.8 1.1e-21
CAB02155 Bet v 1.0108 160 354 94.8 1.2e-21
CAA50327 Cor a 1.0101 160 353 94.6 1.4e-21
CAA50326 Cor a 1.0104 160 352 94.3 1.6e-21
CAA47357 Car b 1.0102 159 350 93.8 2.3e-21
ABZ81045 Que a 1.0201 159 349 93.6 2.7e-21
CAA54485 Bet v 1.0105 160 349 93.6 2.7e-21
AAD13683 Mal d 1.0206 159 348 93.3 3.2e-21
AAK13028 Mal d 1.0303 159 348 93.3 3.2e-21
Q08407 Cor a 1 159 346 92.8 4.5e-21
P38950 Car b 1 159 346 92.8 4.5e-21
CAB02158 Bet v 1.0111 160 346 92.8 4.6e-21
AAG40329 Cor a 1.0402 161 341 91.6 1.1e-20
AAG40331 Cor a 1.0404 161 341 91.6 1.1e-20
AAD26545 Mal d 1.0202 159 340 91.3 1.3e-20
AAB01362 Mal d 1.0201 159 340 91.3 1.3e-20
P38949 Car b 1 159 337 90.6 2.1e-20
AAD26548 Mal d 1.0204 159 336 90.4 2.5e-20
O65200 Pyr c 1 159 336 90.4 2.5e-20
AAK13030 Mal d 1.0207 159 336 90.4 2.5e-20
AAD26555 Mal d 1.0107 159 336 90.4 2.5e-20
AAG40330 Cor a 1.0403 161 335 90.1 3e-20
AAD48405 Cor a 1.0401 161 335 90.1 3e-20
CAD32318 Mal d 1.0208 158 334 89.9 3.5e-20
AAD26547 Mal d 1.0203 159 334 89.9 3.5e-20
QOL10866 Que ac 1.0101 159 334 89.9 3.5e-20
CAA58646 Mal d 1.0101 159 333 89.6 4.2e-20
AHC08073 Sola l 4.0101 160 333 89.6 4.2e-20
ABC41615.1 Bet v 1.0119 150 332 89.4 4.7e-20
AAD26558 Mal d 1.0205 159 332 89.4 5e-20
AAD26554 Mal d 1.0106 159 332 89.4 5e-20
AAD26546 Mal d 1.0103 159 331 89.1 5.9e-20
AAK13029 Mal d 1.0109 159 331 89.1 5.9e-20
AAD29671 Mal d 1.0108 159 331 89.1 5.9e-20
AAD26552 Mal d 1.0104 159 330 88.9 7e-20
AAD26553 Mal d 1.0105 159 329 88.6 8.3e-20
CAA88833 Mal d 1.0102 159 328 88.4 9.9e-20
Q2VU97 Vig r 1.0101 155 317 85.7 6.4e-19
CAA43637 Pha v 1 156 308 83.4 3e-18
CAA42646 Gly m 4 158 308 83.4 3e-18
CAA43636 Pha v 1 155 303 82.2 7e-18
EF436550 Ara h 8.0201 153 302 82.0 8.2e-18
P25985 Pha v 1 155 301 81.7 9.9e-18
CAA75803 Lyc e 4.0101 178 299 81.2 1.6e-17
Q0Z8U9 Rub i 1.0101 137 294 80.0 2.9e-17
AAQ91847 Ara h 8.0101 157 294 80.0 3.3e-17
Q5ULZ4 Fra a 1.0101 100 159 46.6 2.3e-07
Q9ZWP8 Vig r 6.0101 155 113 35.2 0.00097
P85126 Que a 1.0101 50 100 32.1 0.0027
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 240.7 bits 944,  Expect = 1e-65
 Identities = 154/154 100%, Positives = 154/154 100%, Gaps = 0/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEVKGDGGAGTVRIITLPE 60
            MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEVKGDGGAGTVRIITLPE
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEVKGDGGAGTVRIITLPE 60
Query  61   GSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIF 120
            GSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIF
Sbjct  61   GSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIF 120
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN
Sbjct  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 2. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 236.8 bits 928,  Expect = 2e-64
 Identities = 150/154 97%, Positives = 153/154 99%, Gaps = 0/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEVKGDGGAGTVRIITLPE 60
            MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAA GAYKSVEVKGDGGAGTVRIITLPE
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVEVKGDGGAGTVRIITLPE 60
Query  61   GSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIF 120
            GSPIT+MTVRTDAVNKEAL+YDSTVIDGDILLGFIESIETH+VVVPTADGGSITKTTAIF
Sbjct  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAIF 120
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN
Sbjct  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 3. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 234.3 bits 918,  Expect = 1e-63
 Identities = 148/154 96%, Positives = 152/154 98%, Gaps = 0/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEVKGDGGAGTVRIITLPE 60
            MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAA GAYKSV+VKGDGGAGTVRIITLPE
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDVKGDGGAGTVRIITLPE 60
Query  61   GSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIF 120
            GSPIT+MTVRTDAVNKEAL+YDSTVIDGDILLGFIESIETH+VVVPTADGGSITKTTAIF
Sbjct  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAIF 120
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            HTKGDAVVPEENIKFAD QNTALFKAIEAYLIAN
Sbjct  121  HTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 4. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 234.0 bits 917,  Expect = 1e-63
 Identities = 149/154 96%, Positives = 152/154 98%, Gaps = 0/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEVKGDGGAGTVRIITLPE 60
            MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAA GAYKSV+VKGDGGAGTVRIITLPE
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDVKGDGGAGTVRIITLPE 60
Query  61   GSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIF 120
            GSPIT+MTVRTDAVNKEAL+YDSTVIDGDILL FIESIETHMVVVPTADGGSITKTTAIF
Sbjct  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIF 120
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN
Sbjct  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 5. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 230.1 bits 901,  Expect = 2e-62
 Identities = 147/154 95%, Positives = 150/154 97%, Gaps = 0/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEVKGDGGAGTVRIITLPE 60
            MGAQSHSLEITSSVSAEKIF  IVLDVDTVIPKAA GAYKSV+VKGDGGAGTVRIITLPE
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVDVKGDGGAGTVRIITLPE 74
Query  61   GSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIF 120
            GSPIT+MTVRTDAVNKEAL+YDSTVIDGDILL FIESIETHMVVVPTADGGSITKTTAIF
Sbjct  75   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIF 134
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN
Sbjct  135  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 6. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 207.1 bits 808,  Expect = 2e-55
 Identities = 124/154 80%, Positives = 141/154 91%, Gaps = 0/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEVKGDGGAGTVRIITLPE 60
            MG Q+H LE+TSSVSAEKIF G V+DVDTV+PKAA GAYKSVE+KGDGG GT++IITLP+
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPD 60
Query  61   GSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIF 120
            G PITTMT+R D VNKEAL++D +VIDGDILLGFIESIE H+V+VPTADGGSI KTTAIF
Sbjct  61   GGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIF 120
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            HTKGDAVVPEENIK+A+ QNTALFKA+EAYLIAN
Sbjct  121  HTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 7. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 150.9 bits 581,  Expect = 1e-38
 Identities = 86/154 55%, Positives = 117/154 75%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG Q   + ITSSV A K+F  + LD+DT++P+   GA K  E+ +GDGG GTV+++TL 
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            + SP  TM  + DA++KEA+++  ++IDGDILLG+I+SI  H+  VPTADGG    +TA+
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            F+TKGDAVVPEENIKFA+ QN  +FKA+EAYL+AN
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 8. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 126.2 bits 481,  Expect = 4e-31
 Identities = 78/153 50%, Positives = 105/153 68%, Gaps = 2/153 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG Q   +E  S+VSAEK++ G +LD+DTV PK      KSVE+ +GDGG GTV+++ L 
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            E +  TTM  + D ++K  L+Y  T I GDIL+  +ES+    VVVPT DGG I K T I
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPT-DGGCIVKNTTI 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            ++TKGDAV+PE+ IK A  ++   FKA+EAYL+AN
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 9. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 126.0 bits 480,  Expect = 5e-31
 Identities = 78/153 50%, Positives = 105/153 68%, Gaps = 2/153 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG Q   +E  S+VSAEK++ G +LD+DTV PK      KSVE+ +GDGG GTVR++ L 
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            E +  TTM  + D ++K  L Y  T I GDIL+  +ES+  + VVVPT DGG I K T I
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQFVVVPT-DGGCIVKNTTI 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            ++TKGDAV+PE+ +K A  ++   FKA+EAYL+AN
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 10. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 114.1 bits 432,  Expect = 2e-27
 Identities = 68/154 44%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  ++  E TS +  EK+F   +LD D +IPK A  A K  E+ +GDGG GT++ +T+ 
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D ++K+ LSY  T+I+GD L   IE+I   + +V + DGGSI KTT+ 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  + EE +K    +   LFK +EAYL+AN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLAN 155

Sequence Alignment: 11. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 110.1 bits 416,  Expect = 3e-26
 Identities = 67/154 43%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  ++ +EI S V   K++   +LD DT++PK    A K V++ +GDG AGT++ +T+ 
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R DA++K+ L+Y  T+I+GD+L    ESI  H+ +V   DGGSI K  +I
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            + TKGD  V EE IK+   +   +FKA+EAYL+AN
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155

Sequence Alignment: 12. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 109.6 bits 414,  Expect = 4e-26
 Identities = 70/153 45%, Positives = 101/153 66%, Gaps = 2/153 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MGA ++ +EI SS+SAEK+F   VLD DT+IPKA   A   V+ ++GDGG GT+++ T+ 
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS   ++  R D ++KE ++Y  ++I+G  L  F ESI  H+ +V T DGG I K  +I
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGALDVF-ESISYHIKIVATPDGGCICKNRSI 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +  K DA V EE IK    + + +FK +EAYL+AN
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLAN 154

Sequence Alignment: 13. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 109.6 bits 414,  Expect = 4e-26
 Identities = 62/147 42%, Positives = 95/147 64%, Gaps = 1/147 0%
Query  8    LEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLPEGSPITT 66
            +EITSS+S   IF   V+D DT+ PKA    YKS++ ++GDGG GT++ IT  +G P T+
Sbjct  6    FEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFTS 65
Query  67   MTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIFHTKGDA 126
               + DA++   +S   T+ +GD+L+G IES   H+  +P+ADGGS+ K + +F  KGDA
Sbjct  66   SKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGDA 125
Query  127  VVPEENIKFADAQNTALFKAIEAYLIAN 154
             + +EN+ +        FKAIE Y+I++
Sbjct  126  KLTDENVSLMKEGLKKTFKAIETYVISH 153

Sequence Alignment: 14. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 105.9 bits 399,  Expect = 5e-25
 Identities = 62/154 40%, Positives = 102/154 66%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  +++ E TS +   ++F  +VL+ DT+IPK A  + KS E V+GDGG GT++ I++ 
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS  + +  + D ++K+ + Y+ ++++GD L   +E I   + +V +ADGGS+ K+T+ 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  + EE++K    + T LFK IE YL+AN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVAN 155

Sequence Alignment: 15. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 104.5 bits 393,  Expect = 1e-24
 Identities = 62/154 40%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  +H  EITS++   ++F   VLD D +IPK A  A KS E+ +G+GG GT++ IT+ 
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D +++  ++Y  +VI+GD++  ++E I   + +V + DGGSI K T+ 
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKG+  + EE +     +   LFKA+EAYL+A+
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAH 155

Sequence Alignment: 16. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 103.2 bits 388,  Expect = 3e-24
 Identities = 60/154 38%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D +IPK A  A KS E+ +GDGG GT++ +T+ 
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R + ++K+ ++Y  ++I+GD L   +E I     ++ + DGGSI KTT+ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +H KGD  + EE++K    + + LFK +EAYL+A+
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155

Sequence Alignment: 17. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 102.7 bits 386,  Expect = 5e-24
 Identities = 61/154 39%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  ++  E T+ ++  ++F   VLD D +IPK A  A KS E+ +G GG GT++ IT+ 
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D ++   ++Y  T+I+GD +   +E I   + +V + DGGSI K+T+ 
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  + E+ IK    + + +FKA+EAYL+AN
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLAN 155

Sequence Alignment: 18. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 101.5 bits 381,  Expect = 1e-23
 Identities = 61/154 39%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +L+ DT+IPK A  A  SVE ++G+GG GT++ IT+P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y  ++I+G  L   +E I   + +V T DGGSI K +  
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  +  E++K    +  AL++A+E+YL+A+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 19. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 101.2 bits 380,  Expect = 1e-23
 Identities = 61/154 39%, Positives = 95/154 61%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D +IPK A  A  SVE ++G+GG GT++ IT+P
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y  ++I+G  L   +E I   + +V T DGGSI K +  
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  +  E++K    +  AL++A+E+YL+A+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 20. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 101.2 bits 380,  Expect = 1e-23
 Identities = 61/154 39%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +L+ DT+IPK A  A  SVE ++G+GG GT++ IT+P
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y  ++I+G  L   +E I   + +V T DGGSI K +  
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  +  E++K    +  AL++A+E+YL+A+
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 21. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 101.0 bits 379,  Expect = 2e-23
 Identities = 59/154 38%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D +IPK A  A KS E+ +GDGG GT++ +T+ 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R + ++K+ ++Y  ++I+GD L   +E I     ++ + DGGSI KTT+ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +  KGD  + EE++K    + + LFK +EAYL+A+
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155

Sequence Alignment: 22. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 101.0 bits 379,  Expect = 2e-23
 Identities = 58/154 37%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D +IPK A  A KS ++ +GDGG GT++ +T+ 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R + ++K+ ++Y  ++I+GD L   +E I     ++ + DGGSI KT + 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +H KGD  + EE++K    + + LFK +EAYL+A+
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155

Sequence Alignment: 23. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 101.0 bits 379,  Expect = 2e-23
 Identities = 61/154 39%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +L+ DT+IPK A  A  SVE ++G+GG GT++ IT+P
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y  ++I+G  L   +E I   + +V T DGGSI K +  
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  +  E++K    +  AL++A+E+YL+A+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 24. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 100.7 bits 378,  Expect = 2e-23
 Identities = 61/154 39%, Positives = 95/154 61%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D +IPK A  A  SVE ++G+GG GT++ IT+P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y  ++I+G  L   +E I   + +V T DGGSI K +  
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  +  E++K    +  AL++A+E+YL+A+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAH 155

Sequence Alignment: 25. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 100.7 bits 378,  Expect = 2e-23
 Identities = 60/154 38%, Positives = 95/154 61%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  + + E T++++  ++F G+VLD D+++PK  +   KS+E V+GDGGAG+++ + + 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EG PI  +  +   ++ + L    ++I+GD+L   +ESI   +      DGG + KTT  
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD VV EE       +   LFKAIEAYL+AN
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLAN 155

Sequence Alignment: 26. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 99.8 bits 374,  Expect = 4e-23
 Identities = 60/154 38%, Positives = 95/154 61%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  ++  E TS +   ++F   VLD D +IPK    A KS E+ +G+GG GT++ I + 
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  RTDA+++  ++Y  +VI+GD L   IE I     +V + +GGSI K+ + 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +H+KGD  + EE++K    + + LFKA+E YL+A+
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAH 155

Sequence Alignment: 27. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 99.8 bits 374,  Expect = 4e-23
 Identities = 63/154 40%, Positives = 94/154 61%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD + +IPK A  A  SVE V+G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP+  +  R + V+   + Y  TVI+G  +   +E I   + +V   DGGSI K T+ 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  VP E+IK    +   L+K +EAYL+A+
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155

Sequence Alignment: 28. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 99.5 bits 373,  Expect = 4e-23
 Identities = 58/154 37%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D ++PK A  A  SVE ++G+GG GT++ I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y+ +VI+G  +   +E I   + +V T DGGSI K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  V  E +K +      L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 29. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 99.3 bits 372,  Expect = 5e-23
 Identities = 62/151 41%, Positives = 91/151 60%, Gaps = 1/151 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  ++  E TS + A K+F   VLD D +IPK A  A K  E+ +GDGG GT++ IT+ 
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  +  +++KE  +Y  ++I+GD L   IE I+    +V    GG+I KTT+ 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKGD  + EE++K    + + LFK IE YL
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 152

Sequence Alignment: 30. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 99.3 bits 372,  Expect = 5e-23
 Identities = 59/154 38%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   +LD D ++PK A  A  SVE ++G+GG GT++ IT+P
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V++  + Y  +VI+G  +   +E +   + +V   DGGSI K +  
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FHTKGD  +  E IK    +   L+KA+E+YL+A+
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAH 155

Sequence Alignment: 31. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 99.3 bits 372,  Expect = 5e-23
 Identities = 62/151 41%, Positives = 91/151 60%, Gaps = 1/151 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  ++  E TS + A K+F   VLD D +IPK A  A K  E+ +GDGG GT++ IT+ 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  +  +++KE  +Y  ++I+GD L   IE I+    +V    GG+I KTT+ 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKGD  + EE++K    + + LFK IE YL
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 152

Sequence Alignment: 32. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 99.3 bits 372,  Expect = 5e-23
 Identities = 58/151 38%, Positives = 98/151 64%, Gaps = 2/151 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  ++  E TSS++  ++F   VLD D ++PK A  A + VE+ +G+GG GT++ IT+ 
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGF-IESIETHMVVVPTADGGSITKTTA 118
            +G P   +  + +A++KE+L+Y  ++I+GD L G  +E I     +V + DGG++ KT +
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  119  IFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
             +++ GDA V EE +K  + Q T ++K +EAYL
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYL 153

Sequence Alignment: 33. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 99.3 bits 372,  Expect = 5e-23
 Identities = 62/154 40%, Positives = 94/154 61%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD + +IPK +  A  SVE V+G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP+  +  R + V+   + Y  TVI+G  +   +E I   + +V   DGGSI K T+ 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  VP E+IK    +   L+K +EAYL+A+
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155

Sequence Alignment: 34. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 99.0 bits 371,  Expect = 6e-23
 Identities = 61/151 40%, Positives = 91/151 60%, Gaps = 1/151 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  ++  E TS + A K+F   VLD D +IPK A  A K  E+ +GDGG GT++ IT+ 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  +  +++KE  +Y  ++I+GD L   IE I+    +V    GG++ KTT+ 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKGD  + EE++K    + + LFK IE YL
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 152

Sequence Alignment: 35. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 99.0 bits 371,  Expect = 6e-23
 Identities = 62/154 40%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   VLD D +IPK A  A  SVE V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y+ TVI+GD+L   +E +   + +V    GGSI K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 36. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 99.0 bits 371,  Expect = 6e-23
 Identities = 62/154 40%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   VLD D +IPK A  A  SVE V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y+ TVI+GD+L   +E +   + +V    GGSI K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 37. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 99.0 bits 371,  Expect = 6e-23
 Identities = 64/149 42%, Positives = 94/149 63%, Gaps = 5/149 3%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  ++  E TS +   ++F   VLD D ++PK A  A K  E+ +GDGG GT++ IT+ 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTT 117
            EGS    +  + D+++KE  SY  T+I+GD L   +E I  ET +V  P+  GGSI K+T
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPS--GGSIIKST 118
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            + +HTKGD  + EE++K    + + LFK IE YL
Sbjct  119  SHYHTKGDVEIKEEHVKAGKEKASNLFKLIETYL 152

Sequence Alignment: 38. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 98.5 bits 369,  Expect = 9e-23
 Identities = 63/149 42%, Positives = 94/149 63%, Gaps = 5/149 3%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  ++  E TS +   ++F   VLD D ++PK A  A K  E+ +GDGG GT++ IT+ 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTT 117
            EGS    +  + D+++KE  SY  T+I+GD L   +E I  ET +V  P+  GGSI K+T
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPS--GGSIIKST 118
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            + +HTKG+  + EE++K    + + LFK IE YL
Sbjct  119  SHYHTKGNVEIKEEHVKAGKEKASNLFKLIETYL 152

Sequence Alignment: 39. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 98.5 bits 369,  Expect = 9e-23
 Identities = 59/154 38%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  ++  E  S +   ++F   VLD D +IPK    A KS E+ +G+GG GT++ IT+ 
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS +     R D ++ E ++Y  +VI+GD L+  +E++ T   +V + DGGSI K+T+ 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            ++TKGD  + +E I+    + + +FKA+EAYL+A+
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAH 155

Sequence Alignment: 40. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 98.3 bits 368,  Expect = 1e-22
 Identities = 58/154 37%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D + PK A  A  SVE ++G+GG GT++ I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y+ +VI+G  +   +E I   + +V T DGGSI K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  V  E +K +      L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 41. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 98.3 bits 368,  Expect = 1e-22
 Identities = 62/154 40%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   VLD D +IPK A  A  SVE V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y+ TVI+GD+L   +E +   + +V    GGSI K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 42. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 98.3 bits 368,  Expect = 1e-22
 Identities = 62/154 40%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   VLD D +IPK A  A  SVE V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y+ TVI+GD+L   +E +   + +V    GGSI K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 43. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 98.3 bits 368,  Expect = 1e-22
 Identities = 62/154 40%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   VLD D +IPK A  A  SVE V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y+ TVI+GD+L   +E +   + +V    GGSI K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 44. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 98.3 bits 368,  Expect = 1e-22
 Identities = 58/154 37%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D + PK A  A  SVE ++G+GG GT++ I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y+ +VI+G  +   +E I   + +V T DGGSI K +  
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  V  E +K +      L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 45. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 98.3 bits 368,  Expect = 1e-22
 Identities = 62/154 40%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   VLD D +IPK A  A  SVE V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y+ TVI+GD+L   +E +   + +V    GGSI K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 46. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 98.0 bits 367,  Expect = 1e-22
 Identities = 58/154 37%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D + PK A  A  SVE ++G+GG GT++ I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y+ +VI+G  +   +E I   + +V T DGGSI K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  V  E +K +      L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAH 155

Sequence Alignment: 47. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 98.0 bits 367,  Expect = 1e-22
 Identities = 62/154 40%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   VLD D +IPK A  A  SVE V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y+ TVI+GD+L   +E +   + +V    GGSI K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 48. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 98.0 bits 367,  Expect = 1e-22
 Identities = 61/154 39%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   VLD D +IPK A  A  SVE V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y+ TVI+GD+L   +E +   + +V    GGS+ K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 49. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 98.0 bits 367,  Expect = 1e-22
 Identities = 58/154 37%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D + PK A  A  SVE ++G+GG GT++ I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y+ +VI+G  +   +E I   + +V T DGGSI K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  V  E +K +      L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 50. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 97.8 bits 366,  Expect = 1e-22
 Identities = 58/154 37%, Positives = 94/154 61%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  ++  E TS +   ++F   VLD D +IPK A  A KS+E+ +G+GG GT++ I + 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  + + +++  +SY  +VI+GD L   +E I   + +V +  GGSI K+ + 
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HT GD  + +E IK    + + LFKA+E YL+A+
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAH 155

Sequence Alignment: 51. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 97.5 bits 365,  Expect = 2e-22
 Identities = 58/153 37%, Positives = 91/153 59%, Gaps = 1/153 0%
Query  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLPE 60
            G  ++  E  S + A ++F   +LD D ++PK A  A  SVE ++G+GG GT++ IT+PE
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  61   GSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIF 120
            GSP   +  R D V++  + Y  +VI+G  +   +E +   + +V   DGGSI K +  F
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            HTKGD  +  E IK    +   L+KA+E+YL+A+
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAH 154

Sequence Alignment: 52. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 97.5 bits 365,  Expect = 2e-22
 Identities = 59/153 38%, Positives = 93/153 60%, Gaps = 1/153 0%
Query  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLPE 60
            G  ++  E TS + A ++F   +LD D +IPK A  A  SVE ++G+GG GT++ IT+PE
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  61   GSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIF 120
            GSP   +  R D V+   + Y  ++I+G  L   +E I   + +V T DGGSI K +  +
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            HTKGD  +  E++K    +   L++A+E+YL+A+
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAH 154

Sequence Alignment: 53. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 97.5 bits 365,  Expect = 2e-22
 Identities = 58/154 37%, Positives = 95/154 61%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D +IPK A  A  SVE ++G+GG GT++ I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y+ +VI+G  +   +E I   + +V T DGGSI + +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  +  E++K    +  AL++A+E+YL+A+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 54. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 97.5 bits 365,  Expect = 2e-22
 Identities = 60/154 38%, Positives = 89/154 57%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E TS ++  ++F   VLD D +IPK A     S E ++G+GG GT++ IT+P
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    M  R D ++   + Y  ++I+G  L   +E I   + +V    GGSI K T+ 
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  + EE IK    +   LFKA+E YL+A+
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAH 155

Sequence Alignment: 55. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 97.3 bits 364,  Expect = 2e-22
 Identities = 61/154 39%, Positives = 89/154 57%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   VLD D +IPK A  A  SVE V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + +  TVI+GD+L   +E +   + +V    GGSI K +  
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 56. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 97.3 bits 364,  Expect = 2e-22
 Identities = 58/154 37%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  +H  + TS ++  ++F  + LD D +I K    A KS E+ +G+GG GT++ IT+ 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS +     R D ++ E ++Y  +VI+GD L+  +E++ T   +V + DGGSI K+T+ 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            ++TKGD  + +E I+    + + +FKA+EAYL+A+
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAH 155

Sequence Alignment: 57. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 97.3 bits 364,  Expect = 2e-22
 Identities = 58/154 37%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  ++  E  S +   ++F   VLD D +IPK    A KS E+ +G+GG GT++ IT+ 
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS +     R D ++ E +++  +VI+GD L+  +E++ T   +V + DGGSI K+T  
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            ++TKGD  + +E I+    + + +FKA+EAYL+A+
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAH 155

Sequence Alignment: 58. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 97.3 bits 364,  Expect = 2e-22
 Identities = 62/154 40%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD + +IPK A  A  SVE V+G+GG GT++ IT+ 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R + V+   + Y  TVI+G  +   +E I   + +V   DGGSI K +  
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  V  E+IK    +   LF+A+EAYL+A+
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAH 155

Sequence Alignment: 59. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 97.3 bits 364,  Expect = 2e-22
 Identities = 61/154 39%, Positives = 89/154 57%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   VLD D +IPK A  A  SVE V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + +  TVI+GD+L   +E +   + +V    GGSI K +  
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 60. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 96.8 bits 362,  Expect = 3e-22
 Identities = 61/154 39%, Positives = 90/154 58%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   VLD D +IPK A  A   VE V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y+ TVI+GD+L   +E +   + +V    GGSI K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 61. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 96.5 bits 361,  Expect = 3e-22
 Identities = 63/149 42%, Positives = 94/149 63%, Gaps = 6/149 4%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  ++  E TS +   ++F+  VLD D +IPK A  A KS E+ +GDGG GT++ I + 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTT 117
            EGS  + +  R D V+KE + Y  +VI+GD +   IE I  ET +V    +  GS+ K+T
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVA---SGSGSVIKST 117
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLI 152
            + +HTKGD  + EE++K    + + LFK IE YL+
Sbjct  118  SHYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152

Sequence Alignment: 62. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 96.5 bits 361,  Expect = 3e-22
 Identities = 63/149 42%, Positives = 94/149 63%, Gaps = 6/149 4%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  ++  E TS +   ++F+  VLD D +IPK A  A KS E+ +GDGG GT++ I + 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTT 117
            EGS  + +  R D V+K+ + Y  +VI+GD +   IE I  ET +V    A  GS+ K+T
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVA---AGSGSVIKST 117
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLI 152
            + +HTKGD  + EE++K    + + LFK IE YL+
Sbjct  118  SHYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152

Sequence Alignment: 63. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 96.5 bits 361,  Expect = 3e-22
 Identities = 58/154 37%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++ +E TS + A ++F   +LD D + PK A  A  SVE ++G+GG GT++ I++P
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y  +VI+G  +   +E I   + +V T +GGSI K    
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  V  E IK +      L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 64. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 96.3 bits 360,  Expect = 4e-22
 Identities = 63/151 41%, Positives = 95/151 62%, Gaps = 6/151 3%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  ++  E TS +   ++F+  VLD D +IPK A  A KS E+ +GDGG GT++ I + 
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTT 117
            EGS  + +  R D V+KE + Y  +VI+GD +   IE I  ET +V    +  GS+ K+T
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVA---SGSGSVIKST 117
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            + +HTK D  + EE++K    + + LFK IE YL+A+
Sbjct  118  SHYHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAH 154

Sequence Alignment: 65. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 96.3 bits 360,  Expect = 4e-22
 Identities = 64/148 43%, Positives = 92/148 62%, Gaps = 6/148 4%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  ++  E TS + A K+F   VLD D +IPK A  A K  E+ +GDGG GT++ IT+ 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTT 117
            EGS    +  +  +++KE  +Y  ++I+GD L   IE I  ET +V  P    G+I KTT
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPH---GTIIKTT 117
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            + +HTKGD  + EE++K    + + LFK IE YL
Sbjct  118  SKYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 151

Sequence Alignment: 66. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 96.0 bits 359,  Expect = 5e-22
 Identities = 55/154 35%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++ +E TS + A ++F   +LD D ++PK A  A  SVE ++G+GG GT++ I +P
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y+ +VI+G  +   +E I   + +V T DGG + K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKG+  V  E +K +      L++A+E+YL+A+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 67. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 96.0 bits 359,  Expect = 5e-22
 Identities = 61/151 40%, Positives = 89/151 58%, Gaps = 1/151 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  ++  E TS + A K+F   VLD D +IPK A  A K  E+ +GDGG GT++ IT+ 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  +  +++K   +Y  ++I+GD L   IE I+    +V    GG+I KTT+ 
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKGD  + EE++K    +   LFK IE YL
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYL 152

Sequence Alignment: 68. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 96.0 bits 359,  Expect = 5e-22
 Identities = 62/154 40%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   VLD D +IPK A  A  SVE V+G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D V+   ++Y  TVI+GD+L   +E +   + +V    GGSI K ++ 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  +  E IK A      L++A+E YL+A+
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 69. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 95.8 bits 358,  Expect = 5e-22
 Identities = 57/144 39%, Positives = 89/144 61%, Gaps = 1/144 0%
Query  9    EITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLPEGSPITTM 67
            E TS + A ++F   +L+ D +IPK A  A  SVE ++G+GG GT++ IT+PEGSP   +
Sbjct  6    ETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGSPFKYV 65
Query  68   TVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIFHTKGDAV 127
              R D V+   + Y  ++I+G  L   +E I   + +V T DGGSI K +  +HTKGD  
Sbjct  66   KERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHTKGDHE 125
Query  128  VPEENIKFADAQNTALFKAIEAYLI 152
            +  E++K    +  AL++A+E+YL+
Sbjct  126  MKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 70. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 95.8 bits 358,  Expect = 6e-22
 Identities = 58/154 37%, Positives = 90/154 58%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D + PK A  A  SVE ++G+GG GT++ I++P
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y  +VI+G  +   +E I   + +V T +GGSI K    
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  V  E IK +      L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 71. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 95.8 bits 358,  Expect = 6e-22
 Identities = 61/154 39%, Positives = 89/154 57%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   VLD D +IPK A  A  SVE V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y  TVI+GD+L   +E +   + +V    GGSI K ++ 
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 72. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 95.8 bits 358,  Expect = 6e-22
 Identities = 58/154 37%, Positives = 90/154 58%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D + PK A  A  SVE ++G+GG GT++ I++P
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y  +VI+G  +   +E I   + +V T +GGSI K    
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  V  E IK +      L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 73. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 95.6 bits 357,  Expect = 7e-22
 Identities = 62/153 40%, Positives = 93/153 60%, Gaps = 2/153 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  +H  + TS +   ++F   VLD D +IPK    A KS+E ++G+GG GT++ IT+ 
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            E S       R DA++ E  +Y  +VI+GD L   + S+ T +  V + DGGSI K+T  
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            ++TKGD  + EE I+    + T L KA+EAYL+A+
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAH 154

Sequence Alignment: 74. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 95.6 bits 357,  Expect = 7e-22
 Identities = 55/154 35%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D + PK A  A  SVE ++G+GG GT++ I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y+ +VI+G  +   +E I   + +V T DGG + K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKG+  V  E +K +      L++A+E+YL+A+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 75. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 95.1 bits 355,  Expect = 1e-21
 Identities = 55/154 35%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D ++PK A  A  SVE ++G+GG GT++ I +P
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y+ +VI+G  +   +E I   + +V T DGG + K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKG+  V  E +K +      L++A+E+YL+A+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 76. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 95.1 bits 355,  Expect = 1e-21
 Identities = 60/154 38%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++ +E  S + A ++F   VLD D +IPK A  A  SVE V+G+GG GT++ IT+ 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D V+   + Y  TVI+GD+L   +E + + + +V    GGSI K ++ 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  +  E +K A      L++A+E YL+A+
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 77. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 95.1 bits 355,  Expect = 1e-21
 Identities = 55/154 35%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D + PK A  A  SVE ++G+GG GT++ I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y+ +VI+G  +   +E I   + +V T DGG + K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKG+  V  E +K +      L++A+E+YL+A+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 78. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 95.1 bits 355,  Expect = 1e-21
 Identities = 58/154 37%, Positives = 90/154 58%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D + PK A  A  SVE ++G+GG GT++ I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V  + + Y  +VI+G  +   +E I   + +V T DG SI K +  
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  V  E IK +      L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 79. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 94.8 bits 354,  Expect = 1e-21
 Identities = 56/153 36%, Positives = 90/153 58%, Gaps = 1/153 0%
Query  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLPE 60
            G  ++  E TS + A ++F   +LD D + PK A  A  SVE ++G+GG GT++ I++PE
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  61   GSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIF 120
            G P   +  R D V+   + Y  ++I+G  +   +E I   + +V T DGGSI K +  +
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            HTKGD  V  E +K +      L++A+E+YL+A+
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 154

Sequence Alignment: 80. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 94.8 bits 354,  Expect = 1e-21
 Identities = 55/154 35%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D + PK A  A  SVE ++G+GG GT++ I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y+ +VI+G  +   +E I   + +V T DGG + K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKG+  V  E +K +      L++A+E+YL+A+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 81. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 94.6 bits 353,  Expect = 1e-21
 Identities = 60/154 38%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++ +E  S + A ++F   VLD D +IPK A  A  SVE V+G+GG GT++ IT+ 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D V+   ++Y  TVI+GD+L   +E +   + +V    GGSI K ++ 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  +  E +K A      L++A+E YL+A+
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 82. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 94.3 bits 352,  Expect = 2e-21
 Identities = 60/154 38%, Positives = 90/154 58%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++ +E  S +SA ++F   VLD D +IPK A  A  SVE V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D V+   + Y  TVI+GD+L   +E + + + +V    GGS  K ++ 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  +  E +K A      L++A+E YL+A+
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 83. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 93.8 bits 350,  Expect = 2e-21
 Identities = 60/153 39%, Positives = 89/153 58%, Gaps = 1/153 0%
Query  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLPE 60
            G  ++  E  S + A ++F   VLD D +IPK A  A  SVE V G+GG GT++ IT+ E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  61   GSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIF 120
            GSP   +  R D V+   + Y+ TVI+GD+L   +E +   + +V    GGSI K ++ F
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            H KG   V  E +K A      L++A+E+YL+A+
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAH 154

Sequence Alignment: 84. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 93.6 bits 349,  Expect = 3e-21
 Identities = 61/153 39%, Positives = 94/153 61%, Gaps = 2/153 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  +H  + TS ++  ++F  + LD D +I K    A KS E+ +G+GG GT++ IT+ 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            E S       R DA++ E  +Y  +VI+GD L   +ES+ T +  V + DGGSI K+T  
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            ++TKGD  + EE I+ A  +   L+KA+EAYL+A+
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAH 154

Sequence Alignment: 85. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 93.6 bits 349,  Expect = 3e-21
 Identities = 55/154 35%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +L+ D +IPK A  A  SVE ++G+GG GT++ I +P
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y+ +VI+G  +   +E I   + +V T DGG + K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKG+  V  E +K +      L++A+E+YL+A+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 86. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 93.3 bits 348,  Expect = 3e-21
 Identities = 62/148 41%, Positives = 90/148 60%, Gaps = 6/148 4%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F G VLD D +IPK A  A K  E+ +GDGG GT++ IT+ 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTT 117
            EGS    +  + D+V++   SY  T+I+GD L   IE +  ET +V    +  GSI K+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVA---SGSGSIIKSI 117
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            + +HTKGD  + EE++K    +   LFK IE+YL
Sbjct  118  SHYHTKGDVEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 87. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 93.3 bits 348,  Expect = 3e-21
 Identities = 59/149 39%, Positives = 94/149 63%, Gaps = 6/149 4%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  ++ +E TS +   ++++  VLD D +IPK A  A KS E+ +GDGG GT++ I + 
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTT 117
            EGS  + +  + D V+K+ + Y  +VI+GD +   IE I  ET +V    +  GS+ K+ 
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVA---SGSGSVIKSI 117
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLI 152
            + +HTKGD  + EE++K    + + LFK IE YL+
Sbjct  118  SHYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152

Sequence Alignment: 88. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 92.8 bits 346,  Expect = 5e-21
 Identities = 59/153 38%, Positives = 90/153 58%, Gaps = 1/153 0%
Query  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLPE 60
            G  ++ +E  S + A ++F   VLD D +IPK A  A  SVE V+G+GG GT++ IT+ E
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  61   GSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIF 120
            GS    +  R D V+   ++Y  TVI+GD+L   +E +   + +V    GGSI K ++ F
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            H KGD  +  E +K A      L++A+E YL+A+
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 154

Sequence Alignment: 89. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 92.8 bits 346,  Expect = 5e-21
 Identities = 56/153 36%, Positives = 92/153 60%, Gaps = 1/153 0%
Query  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLPE 60
            G  ++  E TS + A ++F   +LD + +IPK +  A  SVE V+G+GG GT++ IT+ E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  61   GSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIF 120
            GSP+  +  R + ++   + Y+ TVI+GD+L   +E +   + +V    GGSI K ++ F
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            H KG   V  E +K A      L++A+E+YL+A+
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAH 154

Sequence Alignment: 90. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 92.8 bits 346,  Expect = 5e-21
 Identities = 54/154 35%, Positives = 90/154 58%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D + PK A  A  SVE ++G+GG GT++ I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
             G P   +  R D V+   + Y+ +VI+G  +   +E I   + +V T DGG + K +  
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKG+  V  E +K +      L++A+E+YL+A+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 91. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 91.6 bits 341,  Expect = 1e-20
 Identities = 60/153 39%, Positives = 89/153 58%, Gaps = 4/153 2%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  S+  E TS +   ++F   VLD D +IPK A   +   E ++G+GG GT++ IT+ 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTT 117
            EGS    M  + + ++   + Y  ++I+G  L   +E I  E  M   P   GGSI K T
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHG-GGSILKIT 119
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            + +HTKG+A + EE IK    +   LFKA+EAYL+A+
Sbjct  120  SKYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAH 156

Sequence Alignment: 92. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 91.6 bits 341,  Expect = 1e-20
 Identities = 60/153 39%, Positives = 90/153 58%, Gaps = 4/153 2%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  S+  E TS +   ++F   VLD D +IPK A   + S E ++G+GG GT++ IT+ 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTT 117
            EG+    M  + + ++   + Y  ++I+G  L   +E I  E  M   P   GGSI K T
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHG-GGSILKIT 119
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            + +HTKG+A + EE IK    +   LFKA+EAYL+A+
Sbjct  120  SKYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAH 156

Sequence Alignment: 93. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 91.3 bits 340,  Expect = 1e-20
 Identities = 61/148 41%, Positives = 89/148 60%, Gaps = 6/148 4%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK A  A K  E+ +GDGG GT++ IT+ 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTT 117
            EGS    +  + D+V++   SY  T+I+GD L   IE +  ET +V    +  GSI K+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVA---SGSGSIIKSI 117
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            + +HTKGD  + EE++K    +   LFK IE+YL
Sbjct  118  SHYHTKGDVEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 94. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 91.3 bits 340,  Expect = 1e-20
 Identities = 61/148 41%, Positives = 89/148 60%, Gaps = 6/148 4%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK A  A K  E+ +GDGG GT++ IT+ 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTT 117
            EGS    +  + D+V++   SY  T+I+GD L   IE +  ET +V    +  GSI K+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVA---SGSGSIIKSI 117
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            + +HTKGD  + EE++K    +   LFK IE+YL
Sbjct  118  SHYHTKGDVEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 95. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 90.6 bits 337,  Expect = 2e-20
 Identities = 58/153 37%, Positives = 87/153 56%, Gaps = 1/153 0%
Query  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLPE 60
            G  ++  E  S + A ++F   VLD D +IPK A     SVE V G+GG GT++ IT+ E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  61   GSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIF 120
            G P   +  R D V+   + Y+ TVI+GD+L   +E +   + +V    GGSI K ++ F
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            H KG   V  E +K A      L++A+E+YL+A+
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAH 154

Sequence Alignment: 96. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 90.4 bits 336,  Expect = 3e-20
 Identities = 60/148 40%, Positives = 89/148 60%, Gaps = 6/148 4%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK A  A K  E+ +GDGG GT++ IT+ 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTT 117
            EGS    +  + D+V++   SY  T+I+GD L   IE +  ET ++    +  GSI K+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMA---SGSGSIIKSI 117
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            + +HTKGD  + EE++K    +   LFK IE+YL
Sbjct  118  SHYHTKGDVEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 97. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 90.4 bits 336,  Expect = 3e-20
 Identities = 58/150 38%, Positives = 88/150 58%, Gaps = 2/150 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK A  A K  E+ +G+GG GT++ IT+ 
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D++++ + SY  T+I+GD L   IE I     +V +  G +I K+ + 
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVASGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKGD  + EE++K    +   LFK IE+YL
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 98. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 90.4 bits 336,  Expect = 3e-20
 Identities = 61/148 41%, Positives = 88/148 59%, Gaps = 6/148 4%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK A  A K  E+ +GDGG GT + IT+ 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTT 117
            EGS    +  + D+V++   SY  T+I+GD L   IE +  ET +V    +  GSI K+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVA---SGSGSIIKSI 117
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            + +HTKGD  + EE++K    +   LFK IE+YL
Sbjct  118  SHYHTKGDVEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 99. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 90.4 bits 336,  Expect = 3e-20
 Identities = 58/150 38%, Positives = 88/150 58%, Gaps = 2/150 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK A  A K  E+ +G+GG GT++ IT+ 
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D++++ + SY  T+I+GD L   IE I     +V    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKG+  + EE++K   A+   LFK IE+YL
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYL 151

Sequence Alignment: 100. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 90.1 bits 335,  Expect = 3e-20
 Identities = 59/153 38%, Positives = 88/153 57%, Gaps = 4/153 2%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG   +  E TS +   ++F   VLD D +IPK A   +   E ++G+GG GT++ IT+ 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTT 117
            EGS    M  + + ++   + Y  ++I+G  L   +E I  E  M   P   GGSI K T
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHG-GGSILKIT 119
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            + +HTKG+A + EE IK    +   LFKA+EAYL+A+
Sbjct  120  SKYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAH 156

Sequence Alignment: 101. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 90.1 bits 335,  Expect = 3e-20
 Identities = 59/153 38%, Positives = 89/153 58%, Gaps = 4/153 2%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG   +  E TS +   ++F   VLD D +IPK A   + S E ++G+GG GT++ IT+ 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTT 117
            EG+    M  + + ++   + Y  ++I+G  L   +E I  E  M   P   GGSI K T
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHG-GGSILKIT 119
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            + +HTKG+A + EE IK    +   LFKA+EAYL+A+
Sbjct  120  SKYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAH 156

Sequence Alignment: 102. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 89.9 bits 334,  Expect = 4e-20
 Identities = 60/147 40%, Positives = 89/147 60%, Gaps = 6/147 4%
Query  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLPE 60
            G  ++  E TS +   ++F   VLD D +IPK A  A K  E+ +GDGG GT++ IT+ E
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  61   GSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTTA 118
            GS    +  + D+V++   SY  T+I+GD L   IE +  ET +V    +  GSI K+ +
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVA---SGSGSIIKSIS 117
Query  119  IFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
             +HTKGD  + EE++K    +   LFK IE+YL
Sbjct  118  HYHTKGDVEIMEEHVKAGKEKAHGLFKLIESYL 150

Sequence Alignment: 103. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 89.9 bits 334,  Expect = 4e-20
 Identities = 60/148 40%, Positives = 89/148 60%, Gaps = 6/148 4%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK A  A K  E+ +GDGG GT++ IT+ 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTT 117
            EGS    +  + D+V++   SY  T+I+GD L   IE +  ET +V    +  GSI K+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVA---SGSGSIIKSI 117
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            + +HTKGD  + EE++K    +   LFK IE++L
Sbjct  118  SHYHTKGDVEIKEEHVKAGKEKAHGLFKLIESHL 151

Sequence Alignment: 104. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 89.9 bits 334,  Expect = 4e-20
 Identities = 61/153 39%, Positives = 91/153 59%, Gaps = 2/153 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  ++  + TS +   ++F   VLD D +I K    A KS E+ +G+GG GT++  T+ 
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            E S +     R D ++ E  SY  +VI+G+ L   I SI T +  V + DGGSI K+T  
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            ++TKG   + EE I+ A  + T LFKA+EAYL+A+
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAH 154

Sequence Alignment: 105. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 89.6 bits 333,  Expect = 4e-20
 Identities = 57/150 38%, Positives = 87/150 58%, Gaps = 2/150 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK A  A K  E+ +G+GG GT++ IT+ 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D++++ + SY  T+I+GD L   IE I     +V    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKG+  + EE++K    +   LFK IE+YL
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYL 151

Sequence Alignment: 106. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 89.6 bits 333,  Expect = 4e-20
 Identities = 54/154 35%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  +++ E T+++S  ++F  +VLD D ++PK  +   K+ E ++GDGG G+++ + + 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EG PI  +  +   ++ + L    ++I+GDIL   +ESI   +      +GG + KTT  
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD VV EE       +   + KA+EAYL+AN
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLAN 155

Sequence Alignment: 107. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 89.4 bits 332,  Expect = 5e-20
 Identities = 52/148 35%, Positives = 86/148 58%, Gaps = 1/148 0%
Query  5    SHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLPEGSP 63
            ++  E TS + A ++F   +LD D + PK A  A  SV+ ++G+GG GT++ I +PEG P
Sbjct  2    NYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGFP 61
Query  64   ITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIFHTK 123
               +  R D V+   + Y+ +VI+G  +   +E I   + +V T DGG I K +  +HTK
Sbjct  62   FKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHTK 121
Query  124  GDAVVPEENIKFADAQNTALFKAIEAYLI 152
            G+  V  E +K +      L++A+E+YL+
Sbjct  122  GNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 108. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 89.4 bits 332,  Expect = 5e-20
 Identities = 60/148 40%, Positives = 88/148 59%, Gaps = 6/148 4%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK A  A K  E+ +GDGG GT++ IT+ 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTT 117
            EGS    +  + D+V++   SY  T+I+GD L   IE +  ET +V    +  GSI K+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVA---SGSGSIIKSI 117
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            + +HTKGD  + EE++     +   LFK IE+YL
Sbjct  118  SHYHTKGDVEIKEEHVMAGKEKAHGLFKLIESYL 151

Sequence Alignment: 109. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 89.4 bits 332,  Expect = 5e-20
 Identities = 57/150 38%, Positives = 88/150 58%, Gaps = 2/150 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK A  A K  E+ +G+GG GT++ IT+ 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D++++ + SY  T+I+GD L   IE+I     +V    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKG+  + EE++K    +   LFK IE+YL
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 110. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 89.1 bits 331,  Expect = 6e-20
 Identities = 57/150 38%, Positives = 87/150 58%, Gaps = 2/150 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK A  A K  E+ +G+GG GT++ IT+ 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D++++ + SY  T+I+GD L   IE I     +V    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKG+  + EE++K    +   LFK IE+YL
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 111. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 89.1 bits 331,  Expect = 6e-20
 Identities = 57/150 38%, Positives = 87/150 58%, Gaps = 2/150 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK A  A K  E+ +G+GG GT++ IT+ 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D++++ + SY  T+I+GD L   IE I     +V    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKG+  + EE++K    +   LFK IE+YL
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYL 151

Sequence Alignment: 112. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 89.1 bits 331,  Expect = 6e-20
 Identities = 57/150 38%, Positives = 87/150 58%, Gaps = 2/150 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK A  A K  E+ +G+GG GT++ IT+ 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D++++ + SY  T+I+GD L   IE I     +V    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKG+  + EE++K    +   LFK IE+YL
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 113. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 88.9 bits 330,  Expect = 7e-20
 Identities = 57/150 38%, Positives = 87/150 58%, Gaps = 2/150 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK A  A K  E+ +G+GG GT++ IT+ 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D++++ + SY  T+I+GD L   IE I     +V    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKG+  + EE++K    +   LFK IE+YL
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 114. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 88.6 bits 329,  Expect = 8e-20
 Identities = 57/150 38%, Positives = 87/150 58%, Gaps = 2/150 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK A  A K  E+ +G+GG GT++ IT+ 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D++++ + SY  T+I+GD L   IE I     +V    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKG+  + EE++K    +   LFK IE+YL
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 115. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 88.4 bits 328,  Expect = 1e-19
 Identities = 56/150 37%, Positives = 86/150 57%, Gaps = 2/150 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK A  A K  E+ +G+GG GT++ IT+ 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D++++ + SY  T+I+GD L   IE I     +V    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATI-KSISH 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +H KG+  + EE++K    +   LFK IE+YL
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYL 151

Sequence Alignment: 116. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 85.7 bits 317,  Expect = 6e-19
 Identities = 54/145 37%, Positives = 88/145 60%, Gaps = 2/145 1%
Query  9    EITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLPEGSPITTM 67
            + TS V+   +++ +  D D +IPKA  G+++SVE V+G+GG GT++ I++ E      +
Sbjct  9    QATSPVAPATLYNALAKDADNIIPKAV-GSFQSVEIVEGNGGPGTIKKISFVEDGETKFV 67
Query  68   TVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIFHTKGDAV 127
              + ++V++  L Y  +++ G  L    E I     +   ADGGS+ K T  +H KGDA 
Sbjct  68   LHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTISYHGKGDAP 127
Query  128  VPEENIKFADAQNTALFKAIEAYLIAN 154
              E+ +K   A++ ALFKA+EAYL+AN
Sbjct  128  PNEDELKAGKAKSDALFKAVEAYLLAN 154

Sequence Alignment: 117. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 83.4 bits 308,  Expect = 3e-18
 Identities = 51/154 33%, Positives = 89/154 57%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  +   + TS V+   ++  +  D DT+ PKA   ++KSVE V+G+GG GT++ I++ 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            E      +  + +++++  L Y  +++ G  L    E I     +    +GGS+ K +  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +H+KGDA   E+ +K   A++ +LFKA+EAYL+AN
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155

Sequence Alignment: 118. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 83.4 bits 308,  Expect = 3e-18
 Identities = 58/153 37%, Positives = 88/153 57%, Gaps = 2/153 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  +   EI S V+   ++  +V D D VIPKA   ++KSVE V+G+GG GT++ IT+ 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPKA-LDSFKSVENVEGNGGPGTIKKITFL 59
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            E      +  + +++++  L Y  +V+ G  L    E I     +V   +GGS  K T  
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            + TKGDA   ++ +K   A+  ALFKAIEAYL+A+
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAH 154

Sequence Alignment: 119. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 82.2 bits 303,  Expect = 7e-18
 Identities = 51/145 35%, Positives = 86/145 59%, Gaps = 2/145 1%
Query  9    EITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLPEGSPITTM 67
            + TS V+   ++  +V D DT++PKA   ++KSVE V+G+GG GT++ I++ E      +
Sbjct  9    QTTSPVAPATLYKALVKDADTIVPKAVD-SFKSVEIVEGNGGPGTIKKISFVEDGETKFV 67
Query  68   TVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIFHTKGDAV 127
              + + +++  L Y  +++ G  L    E I     +    +GGS+ K +  +H+KGDA 
Sbjct  68   LHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKYHSKGDAP 127
Query  128  VPEENIKFADAQNTALFKAIEAYLIAN 154
              E+ +K   A++ ALFK IEAYL+AN
Sbjct  128  PNEDELKAGKAKSDALFKVIEAYLLAN 154

Sequence Alignment: 120. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 82.0 bits 302,  Expect = 8e-18
 Identities = 57/150 38%, Positives = 89/150 59%, Gaps = 7/150 4%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG ++   E TS V   K+F   V+D D + PK    A +S+E V+G+GG GTV+ +T  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIE--THMVVVPTADGGSITKTT 117
            E    + +  + DA+++   +YD T+  G    GF E +E  +    +  ADGGS  K +
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGG---TGFQEILEKVSFKTKLEAADGGSKIKVS 116
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
              FHTKGDA +P+E  +    ++  +FKAIE Y+++N
Sbjct  117  VTFHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 121. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 81.7 bits 301,  Expect = 1e-17
 Identities = 49/146 33%, Positives = 86/146 58%, Gaps = 1/146 0%
Query  9    EITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLPEGSPITTM 67
            + TS V+   ++  +  D DT+ PKA   ++KSVE V+G+GG GT++ I++ E      +
Sbjct  8    QTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVEDGETKFV 67
Query  68   TVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIFHTKGDAV 127
              + +++++  L Y  +++ G  L    E I     +    +GGS+ K +  +H+KGDA 
Sbjct  68   LHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITYHSKGDAP 127
Query  128  VPEENIKFADAQNTALFKAIEAYLIAN 154
              E+ +K   A++ +LFKA+EAYL+AN
Sbjct  128  PNEDELKAGKAKSDSLFKAVEAYLLAN 154

Sequence Alignment: 122. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 81.2 bits 299,  Expect = 2e-17
 Identities = 48/145 33%, Positives = 83/145 57%, Gaps = 1/145 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  +++ E T+++S  ++F  +VLD D ++PK  +   K+ E ++GDGG G+++ + + 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            EG PI  +  +   ++ + L    ++I+GDIL   +ESI   +      +GG + KTT  
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFK 145
            +HTKGD VV EE       +N   F+
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQ 146

Sequence Alignment: 123. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 80.0 bits 294,  Expect = 3e-17
 Identities = 54/134 40%, Positives = 78/134 58%, Gaps = 2/134 1%
Query  11   TSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLPEGSPITTMTV 69
            TS +   K+F   VLD D +IPK A  A KSVE+ +GDGG GTV+ I L EG+  + +  
Sbjct  2    TSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKH 61
Query  70   RTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVP 129
            + D ++K  + Y  ++ +GD L   IE I   + +V +  G SI KTT+ +H KG A + 
Sbjct  62   KIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVASGRG-SIIKTTSHYHCKGGAEIK 120
Query  130  EENIKFADAQNTALFK 145
            EE +K    +   LFK
Sbjct  121  EEQVKDGKERAAGLFK 136

Sequence Alignment: 124. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 80.0 bits 294,  Expect = 3e-17
 Identities = 55/152 36%, Positives = 88/152 57%, Gaps = 3/152 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
            MG  +   EITS+V   K+++ +  D D++ PK      KSVE V+G+GG GT++ +T+ 
Sbjct  1    MGVFTFEDEITSTVPPAKLYNAMK-DADSITPKIIDDV-KSVEIVEGNGGPGTIKKLTIV 58
Query  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
            E      +  + +++++   +Y+ +V+ G  L    E I     +V   +GGSI K T  
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGDA   EE +K   A+   LF+AIE Y++AN
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLAN 153

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 46.6 bits 159,  Expect = 2e-07
 Identities = 30/73 41%, Positives = 43/73 58%, Gaps = 4/73 5%
Query  77   EALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIK 134
            E   Y    ++GD L   +E I  ET +V  P++   +I KTT+ +HTKGD  + EE++K
Sbjct  18   EGSQYGYVKVEGDALSDTLEKIDYETKLVSAPSS--STIIKTTSKYHTKGDVEIKEEHVK 75
Query  135  FADAQNTALFKAIEAYL 151
                +   LFK IE YL
Sbjct  76   AGKEKAAHLFKLIEGYL 92

Sequence Alignment: 126. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 35.2 bits 113,  Expect = 0.001
 Identities = 34/136 25%, Positives = 63/136 46%, Gaps = 6/136 4%
Query  13   SVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIIT-LPEGSPITTMTVR 70
            SV  E +++ +  D  TV+PK      K V+ ++GDGG GT+ I   LPE SP +     
Sbjct  12   SVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSP-SYQREE 70
Query  71   TDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPE 130
                ++ +      VI+G  L   +   +T   +    +  ++      +    D  + E
Sbjct  71   ITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDSD--IEE 128
Query  131  ENIKFADAQNTALF-KAIEAYL 151
            +      +Q+T ++ + +E YL
Sbjct  129  KVTPTKTSQSTLMYLRRLERYL 150

Sequence Alignment: 127. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 32.1 bits 100,  Expect = 0.003
 Identities = 17/48 35%, Positives = 28/48 58%, Gaps = 1/48 2%
Query  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGG 49
            G  +H  + TS ++  ++F  + LD D +I K    A KS E+ +G+GG
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.