The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGFLKVLATSLATLAVVDAGTLLTASNTDAVIPSSYIVVMNDDVSTAEFSTHREWATNVH
ARLSRRKNGETGPGKHFEINGLKGYTASFDENTAKDIANDPAVKYIEPDMIVNATANVVQ
SNVPSWGLARISSKRTGTTSYTYDSTAGEGVVFYGVDTGIDISHSDFGGRAKWGTNVVDN
DNTDGNGHGTHTASTAAGSKYGVAKKATLVAVKVLGADGSGTNSGVISGMDWAVKDAKSR
GANGKYVMNTSLGGEFSKAVNDAAANVVKSGIFLSVAAGNEAENASNSSPASAAEACTIA
ASTSTDGSASFTNFGSVVDLYAPGQSITAAYPGGGSKTLSGTSMAAPHVAGVAAYLMALE
GVSAGNACARIVQLATSSISRAPSGTTSKLLYNGINV
Sequence Info Allergen Name Length Opt Bits Score E Value
AAF23726 Pen ch 13 397 2510 578.5 1.8e-166
AAD25926 Pen c 13.0101 397 2489 573.7 5e-165
AAD52013 Tri r 2.0101 412 1143 266.9 1.2e-72
ADE74975 Asp v 13.0101 403 971 227.7 7.4e-61
AAD47202 Asp fl protease 403 950 222.9 2.1e-59
CAA35594 Asp o 13 403 950 222.9 2.1e-59
P28296 Asp f 13 403 949 222.7 2.4e-59
Q32ZM1 Rho m 2.0101 342 770 181.9 3.8e-47
AAF71379 Pen ch 18 494 670 159.0 4.3e-40
ACF19589 Cur l 4.0101 506 527 126.4 2.8e-30
Y13338 Asp f 18.0101 495 522 125.3 6.1e-30
A0A0F6N3V8 Alt a 15.0101 507 515 123.7 1.9e-29
AAG44478 Pen o 18 503 488 117.5 1.3e-27
A0A0U1Y1N5 Fus p 9.0101 386 348 85.7 4e-18
ABQ59329 Cla c 9.0101 388 339 83.6 1.7e-17
AAX14379 Cla h 9.0101 518 337 83.1 3.2e-17
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pen ch 13 Sequence ID: AAF23726

 Score = 578.5 bits 2510,  Expect = 2e-166
 Identities = 397/397 100%, Positives = 397/397 100%, Gaps = 0/397 0%
Query  1    MGFLKVLATSLATLAVVDAGTLLTASNTDAVIPSSYIVVMNDDVSTAEFSTHREWATNVH 60
            MGFLKVLATSLATLAVVDAGTLLTASNTDAVIPSSYIVVMNDDVSTAEFSTHREWATNVH
Sbjct  1    MGFLKVLATSLATLAVVDAGTLLTASNTDAVIPSSYIVVMNDDVSTAEFSTHREWATNVH 60
Query  61   ARLSRRKNGETGPGKHFEINGLKGYTASFDENTAKDIANDPAVKYIEPDMIVNATANVVQ 120
            ARLSRRKNGETGPGKHFEINGLKGYTASFDENTAKDIANDPAVKYIEPDMIVNATANVVQ
Sbjct  61   ARLSRRKNGETGPGKHFEINGLKGYTASFDENTAKDIANDPAVKYIEPDMIVNATANVVQ 120
Query  121  SNVPSWGLARISSKRTGTTSYTYDSTAGEGVVFYGVDTGIDISHSDFGGRAKWGTNVVDN 180
            SNVPSWGLARISSKRTGTTSYTYDSTAGEGVVFYGVDTGIDISHSDFGGRAKWGTNVVDN
Sbjct  121  SNVPSWGLARISSKRTGTTSYTYDSTAGEGVVFYGVDTGIDISHSDFGGRAKWGTNVVDN 180
Query  181  DNTDGNGHGTHTASTAAGSKYGVAKKATLVAVKVLGADGSGTNSGVISGMDWAVKDAKSR 240
            DNTDGNGHGTHTASTAAGSKYGVAKKATLVAVKVLGADGSGTNSGVISGMDWAVKDAKSR
Sbjct  181  DNTDGNGHGTHTASTAAGSKYGVAKKATLVAVKVLGADGSGTNSGVISGMDWAVKDAKSR 240
Query  241  GANGKYVMNTSLGGEFSKAVNDAAANVVKSGIFLSVAAGNEAENASNSSPASAAEACTIA 300
            GANGKYVMNTSLGGEFSKAVNDAAANVVKSGIFLSVAAGNEAENASNSSPASAAEACTIA
Sbjct  241  GANGKYVMNTSLGGEFSKAVNDAAANVVKSGIFLSVAAGNEAENASNSSPASAAEACTIA 300
Query  301  ASTSTDGSASFTNFGSVVDLYAPGQSITAAYPGGGSKTLSGTSMAAPHVAGVAAYLMALE 360
            ASTSTDGSASFTNFGSVVDLYAPGQSITAAYPGGGSKTLSGTSMAAPHVAGVAAYLMALE
Sbjct  301  ASTSTDGSASFTNFGSVVDLYAPGQSITAAYPGGGSKTLSGTSMAAPHVAGVAAYLMALE 360
Query  361  GVSAGNACARIVQLATSSISRAPSGTTSKLLYNGINV 397
            GVSAGNACARIVQLATSSISRAPSGTTSKLLYNGINV
Sbjct  361  GVSAGNACARIVQLATSSISRAPSGTTSKLLYNGINV 397

Sequence Alignment: 2. Allergen Name: Pen c 13.0101 Sequence ID: AAD25926

 Score = 573.7 bits 2489,  Expect = 5e-165
 Identities = 393/397 98%, Positives = 395/397 99%, Gaps = 0/397 0%
Query  1    MGFLKVLATSLATLAVVDAGTLLTASNTDAVIPSSYIVVMNDDVSTAEFSTHREWATNVH 60
            MGFLKVLATSLATLAVVDAGTLLTASNTDAVIPSSYIVVMNDDVSTAEF+THREWATNVH
Sbjct  1    MGFLKVLATSLATLAVVDAGTLLTASNTDAVIPSSYIVVMNDDVSTAEFNTHREWATNVH 60
Query  61   ARLSRRKNGETGPGKHFEINGLKGYTASFDENTAKDIANDPAVKYIEPDMIVNATANVVQ 120
            ARLSRRKNGETGPGKHFEINGLKGYTASFDE+TAKDIANDPAVKYIEPDMIVNATANVVQ
Sbjct  61   ARLSRRKNGETGPGKHFEINGLKGYTASFDESTAKDIANDPAVKYIEPDMIVNATANVVQ 120
Query  121  SNVPSWGLARISSKRTGTTSYTYDSTAGEGVVFYGVDTGIDISHSDFGGRAKWGTNVVDN 180
            SNVPSWGLARISSKRTGTTSYTYDSTAGEGVVFYGVDTGIDISHSDFGGRAKWGTNVVDN
Sbjct  121  SNVPSWGLARISSKRTGTTSYTYDSTAGEGVVFYGVDTGIDISHSDFGGRAKWGTNVVDN 180
Query  181  DNTDGNGHGTHTASTAAGSKYGVAKKATLVAVKVLGADGSGTNSGVISGMDWAVKDAKSR 240
            DNTDGNGHGTHTASTAAGSKYGVAKKATLVAVKVLGADGSGTNSGVISGMDWAVKDAKSR
Sbjct  181  DNTDGNGHGTHTASTAAGSKYGVAKKATLVAVKVLGADGSGTNSGVISGMDWAVKDAKSR 240
Query  241  GANGKYVMNTSLGGEFSKAVNDAAANVVKSGIFLSVAAGNEAENASNSSPASAAEACTIA 300
            GANGKYVMN SLGGEFSKAVNDAAANVVKSGIFLSVAAGNEAENASNSSPASAAE CTIA
Sbjct  241  GANGKYVMNMSLGGEFSKAVNDAAANVVKSGIFLSVAAGNEAENASNSSPASAAEVCTIA 300
Query  301  ASTSTDGSASFTNFGSVVDLYAPGQSITAAYPGGGSKTLSGTSMAAPHVAGVAAYLMALE 360
            ASTSTDGSASFTNFGSVVDLYAPGQSITAAYPGGGSKTLSGTSMAAPHVAGVAAYLMALE
Sbjct  301  ASTSTDGSASFTNFGSVVDLYAPGQSITAAYPGGGSKTLSGTSMAAPHVAGVAAYLMALE 360
Query  361  GVSAGNACARIVQLATSSISRAPSGTTSKLLYNGINV 397
            GVSAGNACARIVQLATSSISRAPSGTTSKLLYNGINV
Sbjct  361  GVSAGNACARIVQLATSSISRAPSGTTSKLLYNGINV 397

Sequence Alignment: 3. Allergen Name: Tri r 2.0101 Sequence ID: AAD52013

 Score = 266.9 bits 1143,  Expect = 1e-72
 Identities = 202/394 51%, Positives = 260/394 65%, Gaps = 15/394 3%
Query  1    MGFL-KVLATSLATLAVVDAGTLLTASNTDAVIPSSYIVVMNDDVSTAEFSTHREWAT-N 58
            MGF+ K +   LA L+ V+   +L A      IP+ YIVVM  +VS   F+ H  W + +
Sbjct  1    MGFITKAIPIVLAALSTVNGARILEAGPHAEAIPNKYIVVMKREVSDEAFNAHTTWLSQS 60
Query  59   VHARLSRRKNGE---TGPGKHFEINGL-KGYTASFDENTAKDIANDPAVKYIEPDMIVNA 114
            +++R+ RR        G    + + G+ + Y+  FD+   KDI++   V +IEPD +V  
Sbjct  61   LNSRIMRRAGSSKPMAGMQDKYSLGGIFRAYSGEFDDAMIKDISSHDDVDFIEPDFVVRT 120
Query  115  TANVV----QSNVPSWGLARISSKRTGTTSYTYDSTAGEGVVFYGVDTGIDISHSDFGGR 170
            T N      Q NVPSWGLAR+ SK+ G T+Y YD +AG+GV  Y +DTGIDI H DF GR
Sbjct  121  TTNGTNLTHQDNVPSWGLARVGSKKPGGTTYYYDPSAGKGVTAYIIDTGIDIDHEDFQGR 180
Query  171  AKWGTNVVDNDNTDGNGHGTHTASTAAGSKYGVAKKATLVAVKVLGADGSGTNSGVISGM 230
            AKWG N VD  NTD NGHGTH A T  G+KYG+AK  +LVAVKVL  DGSG+NSGVI GM
Sbjct  181  AKWGENFVDQQNTDCNGHGTHVAGTVGGTKYGLAKGVSLVAVKVLDCDGSGSNSGVIKGM 240
Query  231  DWAVKDAKSRG-----ANGKYVMNTSLGGEFSKAVNDAAANVVKSGIFLSVAAGNEAENA 285
            +WA++ A   G     A GK VMN SLGG  S+A N AA  +  +GIF++VAAGNE  +A
Sbjct  241  EWAMRQASGGGNGTAKAAGKSVMNMSLGGPRSEASNQAAKAISDAGIFMAVAAGNENMDA 300
Query  286  SNSSPASAAEACTIAASTSTDGSASFTNFGSVVDLYAPGQSITAAYPGGGSKTLSGTSMA 345
             +SSPAS    CT+AAST  DG A F+N+G+VVD+YAPG+ IT+  PGG + TLSGTSMA
Sbjct  301  QHSSPASEPSVCTVAASTKDDGKADFSNYGAVVDVYAPGKDITSLKPGGSTDTLSGTSMA 360
Query  346  APHVAGVAAYLMALEGVSAGNACARIVQLATSSISRAPSGTTSKLLYNG 394
            +PHV G+ AYL+ L        C  I ++A   I     GTT KL+YNG
Sbjct  361  SPHVCGLGAYLIGLGKQGGPGLCDTIKKMANDVIQSPGEGTTGKLIYNG 409

Sequence Alignment: 4. Allergen Name: Asp v 13.0101 Sequence ID: ADE74975

 Score = 227.7 bits 971,  Expect = 7e-61
 Identities = 163/381 42%, Positives = 230/381 60%, Gaps = 10/381 2%
Query  12   ATLAVVDAGTLLTASNTDAVIPSSYIVVMNDDVSTAEFSTHREWATNVHAR-LSRRK--N 68
            A L  V    +L A      +P  YIV     +   +   H  WA+NVH R L RR   +
Sbjct  13   ALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQIDAHTTWASNVHKRNLERRDLTD 72
Query  69   GETGPG--KHFEINGLKGYTASFDENTAKDIANDPAVKYIEPDMIVNATANVVQSNVPSW 126
             +  PG  K+F+I+ +  Y  SFD+ T ++I N   V ++E D +    A   QS+ P W
Sbjct  73   RDLYPGIEKNFKIHKFAAYVGSFDDATIEEIRNHKDVAHVEEDQVWYLDALTTQSDAP-W 131
Query  127  GLARISSKRTGTTSYTYDSTAGEGVVFYGVDTGIDISHSDFGGRAKWGTNVVDNDNTDGN 186
            GL  IS +   ++ Y YD++AG     Y VDTGI++ HS+F GRA    N     + D  
Sbjct  132  GLGAISHQGDASSDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAYNAAGGQHVDSV 191
Query  187  GHGTHTASTAAGSKYGVAKKATLVAVKVLGADGSGTNSGVISGMDWAVKDAKSRGANGKY 246
            GHGTH A T  G  +GV+KKA L++VKV+  + S T S ++ G +WA  D  S+   GK 
Sbjct  192  GHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESSST-SIILDGYNWAANDIVSKSRTGKS 250
Query  247  VMNTSLGGEFSKAVNDAAANVVKSGIFLSVAAGNEAENASNSSPASAAEACTIAASTSTD 306
             +N SLGG +S A ++A  +    G++  VAAGNE  +ASN+SPASA  A T+AAST  +
Sbjct  251  AINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPASAPNALTVAASTERN 310
Query  307  GSASFTNFGSVVDLYAPGQSITAAYPGGGS--KTLSGTSMAAPHVAGVAAYLMALEGVSA 364
              ASF+N+G VVD++APG+ I +A+ GG S   T+SGTSMA PH+ G++ YL+ALEG+S+
Sbjct  311  ARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSMATPHIVGLSLYLIALEGLSS 370
Query  365  -GNACARIVQLATSSISRAPSGTTSKLLYNG 394
             G+  +RI +LAT       SG+ + L YNG
Sbjct  371  PGDVTSRIKELATQGALSGVSGSPNALAYNG 401

Sequence Alignment: 5. Allergen Name: Asp fl protease Sequence ID: AAD47202

 Score = 222.9 bits 950,  Expect = 2e-59
 Identities = 155/361 42%, Positives = 218/361 60%, Gaps = 10/361 2%
Query  32   IPSSYIVVMNDDVSTAEFSTHREWATNVHAR-LSRR--KNGETGPG--KHFEINGLKGYT 86
            +P  YIV     +  A+   H  WATN+H R L RR    G+   G  ++++IN +  Y 
Sbjct  33   LPGKYIVTFKPGIDEAKIQEHTTWATNIHQRSLERRGATGGDLPVGIERNYKINKFAAYA 92
Query  87   ASFDENTAKDIANDPAVKYIEPDMIVNATANVVQSNVPSWGLARISSKRTGTTSYTYDST 146
             SFD+ T ++I  +  V Y+E D I        Q + P WGL  IS K   +T Y YD++
Sbjct  93   GSFDDATIEEIRKNEDVAYVEEDQIYYLDGLTTQKSAP-WGLGSISHKGQQSTDYIYDTS 151
Query  147  AGEGVVFYGVDTGIDISHSDFGGRAKWGTNVVDNDNTDGNGHGTHTASTAAGSKYGVAKK 206
            AGEG   Y VD+G+++ H +F GRA    N     + D  GHGTH + T AG  YG+AKK
Sbjct  152  AGEGTYAYVVDSGVNVDHEEFEGRASKAYNAAGGQHVDSIGHGTHVSGTIAGKTYGIAKK 211
Query  207  ATLVAVKVLGADGSGTNSGVISGMDWAVKDAKSRGANGKYVMNTSLGGEFSKAVNDAAAN 266
            A++++VKV+  + S T S ++ G +WA  D  S+    K  +N SLGG +SKA NDA  N
Sbjct  212  ASILSVKVFQGESSST-SVILDGFNWAANDIVSKKRTSKAAINMSLGGGYSKAFNDAVEN 270
Query  267  VVKSGIFLSVAAGNEAENASNSSPASAAEACTIAASTSTDGSASFTNFGSVVDLYAPGQS 326
              + G++  VAAGNE  +A  +SPASA +A T+AA   ++  ASF+NFG VVD++APGQ 
Sbjct  271  AFEQGVLSVVAAGNENSDAGQTSPASAPDAITVAAIQKSNNRASFSNFGKVVDVFAPGQD 330
Query  327  ITAAYPGGGS--KTLSGTSMAAPHVAGVAAYLMALEGVSAGNACA-RIVQLATSSISRAP 383
            I +A+ G  S   T+SGTSMA PH+ G++ YL ALE +    A   RI +LAT  + +  
Sbjct  331  ILSAWIGSSSATNTISGTSMATPHIVGLSLYLAALENLDGPAAVTKRIEELATKDVVKDV 390
Query  384  SGTTSKLLYNG 394
             G+ + L YNG
Sbjct  391  KGSPNLLAYNG 401

Sequence Alignment: 6. Allergen Name: Asp o 13 Sequence ID: CAA35594

 Score = 222.9 bits 950,  Expect = 2e-59
 Identities = 155/361 42%, Positives = 218/361 60%, Gaps = 10/361 2%
Query  32   IPSSYIVVMNDDVSTAEFSTHREWATNVHAR-LSRR--KNGETGPG--KHFEINGLKGYT 86
            +P  YIV     +  A+   H  WATN+H R L RR    G+   G  ++++IN +  Y 
Sbjct  33   LPGKYIVTFKPGIDEAKIQEHTTWATNIHQRSLERRGATGGDLPVGIERNYKINKFAAYA 92
Query  87   ASFDENTAKDIANDPAVKYIEPDMIVNATANVVQSNVPSWGLARISSKRTGTTSYTYDST 146
             SFD+ T ++I  +  V Y+E D I        Q + P WGL  IS K   +T Y YD++
Sbjct  93   GSFDDATIEEIRKNEDVAYVEEDQIYYLDGLTTQKSAP-WGLGSISHKGQQSTDYIYDTS 151
Query  147  AGEGVVFYGVDTGIDISHSDFGGRAKWGTNVVDNDNTDGNGHGTHTASTAAGSKYGVAKK 206
            AGEG   Y VD+G+++ H +F GRA    N     + D  GHGTH + T AG  YG+AKK
Sbjct  152  AGEGTYAYVVDSGVNVDHEEFEGRASKAYNAAGGQHVDSIGHGTHVSGTIAGKTYGIAKK 211
Query  207  ATLVAVKVLGADGSGTNSGVISGMDWAVKDAKSRGANGKYVMNTSLGGEFSKAVNDAAAN 266
            A++++VKV+  + S T S ++ G +WA  D  S+    K  +N SLGG +SKA NDA  N
Sbjct  212  ASILSVKVFQGESSST-SVILDGFNWAANDIVSKKRTSKAAINMSLGGGYSKAFNDAVEN 270
Query  267  VVKSGIFLSVAAGNEAENASNSSPASAAEACTIAASTSTDGSASFTNFGSVVDLYAPGQS 326
              + G++  VAAGNE  +A  +SPASA +A T+AA   ++  ASF+NFG VVD++APGQ 
Sbjct  271  AFEQGVLSVVAAGNENSDAGQTSPASAPDAITVAAIQKSNNRASFSNFGKVVDVFAPGQD 330
Query  327  ITAAYPGGGS--KTLSGTSMAAPHVAGVAAYLMALEGVSAGNACA-RIVQLATSSISRAP 383
            I +A+ G  S   T+SGTSMA PH+ G++ YL ALE +    A   RI +LAT  + +  
Sbjct  331  ILSAWIGSSSATNTISGTSMATPHIVGLSLYLAALENLDGPAAVTKRIKELATKDVVKDV 390
Query  384  SGTTSKLLYNG 394
             G+ + L YNG
Sbjct  391  KGSPNLLAYNG 401

Sequence Alignment: 7. Allergen Name: Asp f 13 Sequence ID: P28296

 Score = 222.7 bits 949,  Expect = 2e-59
 Identities = 161/361 44%, Positives = 217/361 60%, Gaps = 10/361 2%
Query  32   IPSSYIVVMNDDVSTAEFSTHREWATNVHAR-LSRRK--NGETGPG--KHFEINGLKGYT 86
            IP  YIV       TA   +H  WAT++H R L RR   +GE   G  K ++I  +  Y 
Sbjct  33   IPGKYIVTFKPGTDTATIESHTLWATDLHKRNLERRDTTSGEPPVGIEKSYKIKDFAAYA 92
Query  87   ASFDENTAKDIANDPAVKYIEPDMIVNATANVVQSNVPSWGLARISSKRTGTTSYTYDST 146
             SFD+ T ++I     V ++E D I    A   Q   P WGL  IS K   +T Y YD++
Sbjct  93   GSFDDATIEEIRKRGDVAHVEEDQIWYLDALTTQKGAP-WGLGSISHKGQASTDYIYDTS 151
Query  147  AGEGVVFYGVDTGIDISHSDFGGRAKWGTNVVDNDNTDGNGHGTHTASTAAGSKYGVAKK 206
            AG G   Y VD+GI+++H +F  RA    N     + D  GHGTH A T  G  YGVAKK
Sbjct  152  AGAGTYAYVVDSGINVNHVEFESRASLAYNAAGGSHVDSIGHGTHVAGTIGGKTYGVAKK 211
Query  207  ATLVAVKVLGADGSGTNSGVISGMDWAVKDAKSRGANGKYVMNTSLGGEFSKAVNDAAAN 266
              L++VKV+  + S T S ++ G +WAV D  S+G   K  +N SLGG +S A N+A  N
Sbjct  212  TNLLSVKVFQGESSST-SIILDGFNWAVNDIVSKGRTKKAAINMSLGGGYSYAFNNAVEN 270
Query  267  VVKSGIFLSVAAGNEAENASNSSPASAAEACTIAASTSTDGSASFTNFGSVVDLYAPGQS 326
                G++  VAAGNE  +ASN+SPASA  A T+AA   ++  ASF+N+GSVVD++APGQ 
Sbjct  271  AFDEGVLSVVAAGNENSDASNTSPASAPNALTVAAINKSNARASFSNYGSVVDIFAPGQD 330
Query  327  ITAAYPGG--GSKTLSGTSMAAPHVAGVAAYLMALEGVSAGNAC-ARIVQLATSSISRAP 383
            I +A+ G    + T+SGTSMA PH+ G++ YLM LE +S   A  ARI +LAT+ +    
Sbjct  331  ILSAWIGSTTATNTISGTSMATPHIVGLSVYLMGLENLSGPAAVTARIKELATNGVVTNV 390
Query  384  SGTTSKLLYNG 394
             G+ +KL YNG
Sbjct  391  KGSPNKLAYNG 401

Sequence Alignment: 8. Allergen Name: Rho m 2.0101 Sequence ID: Q32ZM1

 Score = 181.9 bits 770,  Expect = 4e-47
 Identities = 136/303 44%, Positives = 194/303 64%, Gaps = 24/303 7%
Query  91   ENTAKDIANDPAVKYIEPDMIVNATANVVQSNVPSWGLARISSK---RTGT-TSYTYDST 146
            E+  + +   P V +IE + +V+A    V    P WGLARIS +     G+   Y YDS 
Sbjct  6    EDLIEQVRQLPMVNFIEKNSLVHANEFTVAKGAP-WGLARISHRDPLSLGSFDQYLYDSN 64
Query  147  AGEGVVFYGVDTGIDISHSDFGGRAKWGTNVVDND-NTDGNGHGTHTASTAAGSKYGVAK 205
             G GV  Y +DTG+++ H  F GRAKWG  +   D + DGNGHGTH A T   + YGVAK
Sbjct  65   GGTGVTSYVIDTGVNVHHEQFEGRAKWGKTIPQGDEDEDGNGHGTHCAGTIGSNAYGVAK 124
Query  206  KATLVAVKVLGADGSGTNSGVISGMDWAVK---DAKSRGANGKYVMNTSLGGEFSKAVND 262
             A +VAVKVL ++GSG+ S VI G+++AVK   D+  +G N     N SLGG  S A++ 
Sbjct  125  NAEIVAVKVLRSNGSGSMSDVIKGVEFAVKSHQDSVKKGKNSFSTANMSLGGGKSPALDL 184
Query  263  AAANVVKSGIFLSVAAGNEAENASNSSPASAAEACTIAASTSTDGSASFTNFGSVVDLYA 322
            A    VK+G+ ++VAAGNE ++A N+SPASA  A T+ AST +D  A F+N+G  VD++A
Sbjct  185  AVNAAVKAGLHFAVAAGNENQDACNTSPASAENAITVGASTISDARAYFSNYGKCVDIFA 244
Query  323  PGQSITAAYPGGGSKT--LSGTSMAAPHVAGVAAYLMAL------------EGVSAGNAC 368
            PG +I + Y G  + T  LSGTSMA+PH+AG+  Y ++L            EG++     
Sbjct  245  PGLNILSTYIGSDAATAYLSGTSMASPHIAGLLTYYLSLQPSSDSEFFIGAEGITPAQLK 304
Query  369  ARIVQLATSSI-SRAPSGTTSKLLYNG 394
              ++ + T  + +  P+ T + L +NG
Sbjct  305  KNLIAFGTPDVLADIPADTPNILAFNG 331

Sequence Alignment: 9. Allergen Name: Pen ch 18 Sequence ID: AAF71379

 Score = 159.0 bits 670,  Expect = 4e-40
 Identities = 165/386 42%, Positives = 230/386 59%, Gaps = 30/386 7%
Query  4    LKVLATSLATLAVVDAGTLLTASNTDAVIPSSYIVVMNDDVSTAEFSTHREWATNVHA-- 61
            L V A+ +A  ++ +    + +S T   IP SYIVV    V  +  S H+ W   VH   
Sbjct  12   LLVAASPVAVNSIHNDAAPILSSMTSKDIPDSYIVVFKKHVDPSSASAHQSWLQEVHTAH 71
Query  62   --RLSRRKNGETGPG-------KH-FEING-LKGYTASFDENTAKDIANDPAVKYIEPDM 110
              R+  +K    G         KH F I G L GY   F E+  + I   P V YIE D 
Sbjct  72   TGRMELKKRSLFGFDFEAFMGLKHTFHIAGSLLGYAGHFHEDVIEQIRRHPDVDYIEKDS 131
Query  111  IVNA-TANVVQSNVPSWGLARISSKRTGT----TSYTYDSTAGEGVVFYGVDTGIDISHS 165
             V   +   V+ N P WGLARIS + + +      Y Y    GEGV  Y +DTG ++ H 
Sbjct  132  EVRTMSEGSVEKNAP-WGLARISHRESLSFGNFNKYLYAEEGGEGVDAYVIDTGANVKHV 190
Query  166  DFGGRAKWGTNVVDND-NTDGNGHGTHTASTAAGSKYGVAKKATLVAVKVLGADGSGTNS 224
            DF GRA WG  +   D + DGNGHGTH + T AG K+GVAKKA + AVKVL ++GSGT S
Sbjct  191  DFEGRANWGKTIPQGDADEDGNGHGTHCSGTIAGKKFGVAKKANVYAVKVLRSNGSGTMS 250
Query  225  GVISGMDWAVKD--AKSRGANGKY---VMNTSLGGEFSKAVNDAAANVVKSGIFLSVAAG 279
             V+ G++WA +    KS+  + K+   V N SLGG  S+ ++ A    V +GI ++VAAG
Sbjct  251  DVVKGVEWAAEAHIKKSKKGDKKFKGSVANMSLGGGSSRTLDLAVNAAVDAGIHFAVAAG 310
Query  280  NEAENASNSSPASAAEACTIAASTSTDGSASFTNFGSVVDLYAPGQSITAAYPGG--GSK 337
            N+  +A N SPA+A +A T+ AST  D  A F+N+G   D++APG +I + + G    + 
Sbjct  311  NDNADACNYSPAAAEKAITVGASTLADERAYFSNYGKCTDIFAPGLNILSTWVGSDHATN 370
Query  338  TLSGTSMAAPHVAGVAAYLMALEGVS-AGNACARIV--QLATSSISRAPSGTTSKL 390
            T+SGTSMA+PH+AG+ AY ++L     +  A A +   QL  + IS A  GT + +
Sbjct  371  TISGTSMASPHIAGLLAYYVSLAPAKDSAYAVADVTPKQLKAALISVATEGTLTDI 426

Sequence Alignment: 10. Allergen Name: Cur l 4.0101 Sequence ID: ACF19589

 Score = 126.4 bits 527,  Expect = 3e-30
 Identities = 167/388 43%, Positives = 245/388 63%, Gaps = 47/388 12%
Query  4    LKVLATSLATLAVVDAGTLLTASNTDAVIPSSYIVVMNDDVSTAEFSTHREWATNVHA-- 61
            L   + +++T  +      + +S +   +P+SY+VV    V  A  S H +W  +VH+  
Sbjct  12   LAAASPTFSTETIHKQSAPVLSSTSAKEVPNSYMVVFKKHVKDA--SKHHDWVQSVHSKN 69
Query  62   ---RLSRRKNGETGP-------G-KH-FEINGLKGYTASFDENTAKDIANDPAVKYIEPD 109
               R+  RK     P       G KH +E++GLKGY+  FD+ T + I N P V YIE D
Sbjct  70   TQERMELRKRSSDLPVSNEVFAGLKHTYELSGLKGYSGHFDDETLEAIRNHPDVDYIERD 129
Query  110  M---IVNATANVVQSNVPSWGLARISSKRT---GT-TSYTYDSTAGEGVVFYGVDTGIDI 162
                I+       ++N P WGLARIS + +   GT   Y Y +  GEGV  Y +DTG ++
Sbjct  130  SEVRILGGDEPETENNSP-WGLARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNV 188
Query  163  SHSDFGGRAKWGTNVVDND-NTDGNGHGTHTASTAAGSKYGVAKKATLVAVKVLGADGSG 221
             H DF GRAKWG  + + D + DGNGHGTH + T AG KYGVAKKA + AVKVL ++GSG
Sbjct  189  DHVDFEGRAKWGKTIPNGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSG 248
Query  222  TNSGVISGMDWAVK---DAKSRGANGKY------VMNTSLGGEFSKAVNDAAANVVKSGI 272
            T S V+ G+++A K   +A S   NGK         N SLGG  S  ++ A    V +G+
Sbjct  249  TMSDVVKGVEFAAKSHSEAVSAAKNGKKKGFKGSTANMSLGGGKSTTLDMAVNAAVDAGL 308
Query  273  FLSVAAGNEAENASNSSPASAAEACTIAASTSTDGSASFTNFGSVVDLYAPGQSITAAYP 332
             ++VAAGN+  ++ N SPA+A  A T+ AST  D  A F+N+G   D++APG +I + + 
Sbjct  309  HFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWI 368
Query  333  GG--GSKTLSGTSMAAPHVAGVAAYLMALE----------GVSAGNACARIVQLAT-SSI 379
            G    + T+SGTSMA+PH+AG+ AY+++L+           ++     A ++ + T  ++
Sbjct  369  GSKHATNTISGTSMASPHIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLIAIGTVGAL 428
Query  380  SRAPSGTTSKLLYNG 394
            S  PS T + L +NG
Sbjct  429  SDVPSNTANVLAWNG 443

Sequence Alignment: 11. Allergen Name: Asp f 18.0101 Sequence ID: Y13338

 Score = 125.3 bits 522,  Expect = 6e-30
 Identities = 175/389 44%, Positives = 249/389 64%, Gaps = 55/389 14%
Query  2    GFLKVLATSL---ATLAVVD-----AGTLLTASNTDAVIPSSYIVVMNDDVSTAEFSTHR 53
            G+L +    L   A+  VVD     A  +L++ N   V P SYIVV    V+    + H 
Sbjct  3    GYLSLSILPLLVAASPVVVDSIHNGAAPILSSMNAKEV-PDSYIVVFKKHVNAESAAAHH 61
Query  54   EWATNVHA----RLSRRKNGETGPGKH--------FEING-LKGYTASFDENTAKDIAND 100
             W  ++H+    R+  RK    G G+         F+I G L GY+  F E+  + +   
Sbjct  62   SWVQDIHSAQNERVELRKRSLFGFGEEAYLGLKNTFDIAGSLVGYSGHFHEDVIEQVRKH 121
Query  101  PAVKYIEPDMIVNATAN-VVQSNVPSWGLARISSKRT---GT-TSYTYDSTAGEGVVFYG 155
            P V+YIE D  V+   +  V+ + P WGLARIS + +   GT   Y Y S  GEGV  Y 
Sbjct  122  PDVEYIEKDSEVHTMEDPTVEKSAP-WGLARISHRDSLSFGTFNKYLYASEGGEGVDAYT 180
Query  156  VDTGIDISHSDFGGRAKWGTNV-VDNDNTDGNGHGTHTASTAAGSKYGVAKKATLVAVKV 214
            +DTGI++ H DF GRA+WG  +  D+++ DGNGHGTH + T AG KYGVAKKA L AVKV
Sbjct  181  IDTGINVDHVDFEGRAQWGKTIPTDDEDADGNGHGTHCSGTIAGRKYGVAKKANLYAVKV 240
Query  215  LGADGSGTNSGVISGMDWAVK----------DAKSRGANGKYVMNTSLGGEFSKAVNDAA 264
            L + GSGT S V++G++WAVK          D K +G  G  V N SLGG  S+ +  A 
Sbjct  241  LRSSGSGTMSDVVAGVEWAVKSHLKKVKDAKDGKIKGFKGS-VANMSLGGGKSRTLEAAV 299
Query  265  ANVVKSGIFLSVAAGNEAENASNSSPASAAEACTIAASTSTDGSASFTNFGSVVDLYAPG 324
               V++G+ ++VAAGN+  +A N SPA+A    T+ AST  D  A F+N+G   D++APG
Sbjct  300  NAGVEAGLHFAVAAGNDNADACNYSPAAAENPITVGASTLQDERAYFSNYGKCTDIFAPG 359
Query  325  QSITAAYPGG--GSKTLSGTSMAAPHVAGVAAYLMALEGVSAGNACA-----------RI 371
             +I + + G      T+SGTSMA+PH+AG+ AY+++L+  S  +A A            I
Sbjct  360  LNILSTWIGSKHAVNTISGTSMASPHIAGLLAYFVSLQP-SKDSAFAVDELTPKKLKKDI 418
Query  372  VQLATS-SISRAPSGTTSKLLYNG 394
            + +AT  +++  PS T + L +NG
Sbjct  419  IAIATQGALTDIPSDTPNLLAWNG 442

Sequence Alignment: 12. Allergen Name: Alt a 15.0101 Sequence ID: A0A0F6N3V8

 Score = 123.7 bits 515,  Expect = 2e-29
 Identities = 165/362 45%, Positives = 230/362 63%, Gaps = 41/362 11%
Query  32   IPSSYIVVMNDDVSTAEFSTHREWATNVHA-----RLSRRKNGETGP-------G-KH-F 77
            +P+SY+VV    V  A  S H +W  +VH+     R+  RK     P       G KH +
Sbjct  11   VPNSYMVVFKKHVKDA--SKHHDWVQSVHSKNNEERMELRKRSSQFPVTTEVFDGLKHVY 68
Query  78   EINGLKGYTASFDENTAKDIANDPAVKYIEPDMIVNATAN---VVQSNVPSWGLARISSK 134
            E+ G+KGY+  FD+ T + I N P V YIE D  V+   +    ++ N P WGLARIS +
Sbjct  69   EMAGMKGYSGHFDDETIEAIRNHPDVDYIERDSEVHTLGHDEPEIEKNSP-WGLARISHR 127
Query  135  RT---GT-TSYTYDSTAGEGVVFYGVDTGIDISHSDFGGRAKWGTNVVDND-NTDGNGHG 189
             +   GT   Y Y +  GEGV  Y +DTG +  H DF GRAKWG  + + D + DGNGHG
Sbjct  128  DSLSFGTWNKYLYAADGGEGVDVYVIDTGTNTKHVDFEGRAKWGKTIPNGDADEDGNGHG 187
Query  190  THTASTAAGSKYGVAKKATLVAVKVLGADGSGTNSGVISGMDWAVK----------DAKS 239
            TH + T AG KYGVAKKA + AVKVL ++GSGT S V+ G+++A K          D K 
Sbjct  188  THCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTMSDVVKGVEYAAKAHSDTVQAAKDGKK 247
Query  240  RGANGKYVMNTSLGGEFSKAVNDAAANVVKSGIFLSVAAGNEAENASNSSPASAAEACTI 299
            +G  G    N SLGG  S  ++ A    V +GI ++VAAGN+  ++ N SPA+A  A T+
Sbjct  248  KGFKGS-AANMSLGGGKSTTLDLAVNAAVDAGIHFAVAAGNDNADSCNYSPAAAENAVTV 306
Query  300  AASTSTDGSASFTNFGSVVDLYAPGQSITAAYPGG--GSKTLSGTSMAAPHVAGVAAYLM 357
             AST  D  A F+N+G   D++APG +I + + G    + T+SGTSMA+PH+AG+ AY++
Sbjct  307  GASTLLDERAYFSNYGKCNDIFAPGLNILSTWIGSEHATNTISGTSMASPHIAGLLAYML 366
Query  358  ALEGVS-AGNACARIV--QLATSSISRAPSGTTSKLLYNGINV 397
            +L+    +  A A I   +L  + IS A  G  S +  N  N+
Sbjct  367  SLQPAKDSAYAVADITPKKLKANLISVATVGALSDVPRNTKNI 409

Sequence Alignment: 13. Allergen Name: Pen o 18 Sequence ID: AAG44478

 Score = 117.5 bits 488,  Expect = 1e-27
 Identities = 172/392 43%, Positives = 245/392 62%, Gaps = 45/392 11%
Query  1    MGFLKVLATSLATLA-VVDAGTLLTASNTDAV-IPSSYIVVMNDDVSTAEFSTHREWATN 58
            + +L +LA +  T +  +  G     S+T A  IP SYIVV    V  +  S H  W  +
Sbjct  7    LTLLPLLAAASPTWSETIHNGAAPLISSTSAKEIPDSYIVVFKKHVGASAASAHHSWVQD 66
Query  59   VHA---RLSRRKNG----ETGP--G-KH-FEING-LKGYTASFDENTAKDIANDPAVKYI 106
            +H+   R+  +K      E+ P  G KH F + G L GY   F E+  + +   P V+YI
Sbjct  67   IHSDNVRMELKKRSLFGFESEPYLGVKHTFHVAGSLMGYAGHFHEDVIEQVRRHPDVEYI 126
Query  107  EPDMIVNATAN-VVQSNVPSWGLARISSKRT---GT-TSYTYDSTAGEGVVFYGVDTGID 161
            E D  V+   +  ++ N P WGLARIS + +   G+   Y Y    GEGV  Y +DTG +
Sbjct  127  EKDSEVHHFEDPAIEKNAP-WGLARISHRDSLSFGSFNKYLYAEDGGEGVDAYVIDTGTN 185
Query  162  ISHSDFGGRAKWGTNVVDND-NTDGNGHGTHTASTAAGSKYGVAKKATLVAVKVLGADGS 220
            + H DF GRA WG  +   D + DGNGHGTH + T AG KYGVAKKA + AVKVL ++GS
Sbjct  186  VDHVDFEGRASWGKTIPQGDQDVDGNGHGTHCSGTIAGKKYGVAKKANVYAVKVLRSNGS 245
Query  221  GTNSGVISGMDWAV----------KDAKSRGANGKYVMNTSLGGEFSKAVNDAAANVVKS 270
            GT S V+ G++WA           KD K++G  G  V N SLGG  S+ ++ A    V +
Sbjct  246  GTMSDVVKGVEWAAEAHIKKSKAAKDGKAKGFKGS-VANMSLGGGSSRTLDLAVNAAVDA 304
Query  271  GIFLSVAAGNEAENASNSSPASAAEACTIAASTSTDGSASFTNFGSVVDLYAPGQSITAA 330
            G+ ++VAAGN+  +A N SPA+A +A T+ AST  D  A F+N+G   D++APG +I + 
Sbjct  305  GMHFAVAAGNDNADACNYSPAAAEKAVTVGASTLADERAYFSNYGKCTDIFAPGLNILST 364
Query  331  YPGG--GSKTLSGTSMAAPHVAGVAAYLMALEGVS-AGNACARI---------VQLATS- 377
            + G      T+SGTSMA+PH+AG+ AY ++L+  S +  A   I         + +ATS 
Sbjct  365  WIGSKYAVNTISGTSMASPHIAGLLAYYVSLQPASDSAYAVEEITPKKLKDALITIATSG 424
Query  378  SISRAPSGTTSKLLYNG 394
            ++S  PS T + L +NG
Sbjct  425  ALSDIPSDTPNLLAWNG 441

Sequence Alignment: 14. Allergen Name: Fus p 9.0101 Sequence ID: A0A0U1Y1N5

 Score = 85.7 bits 348,  Expect = 4e-18
 Identities = 128/268 47%, Positives = 177/268 66%, Gaps = 29/268 10%
Query  126  WGLARISSKRT---GT-TSYTYDSTAGEGVVFYGVDTGIDISHSDFGGRAKWGTNVVDND 181
            WGLARIS + T   GT   Y Y S  GEGV  Y VDTG ++ H DF GRA WG  +   D
Sbjct  13   WGLARISHRNTLNFGTFNKYLYSSDGGEGVDAYIVDTGTNVDHVDFEGRAHWGKTIPSGD 72
Query  182  -NTDGNGHGTHTASTAAGSKYGVAKKATLVAVKVLGADGSGTNSGVISGMDWAV------ 234
             + DGNGHGTH + T AG KYGVAKKA + AVKVL ++GSG+ S V+ G+++A       
Sbjct  73   ADEDGNGHGTHCSGTVAGKKYGVAKKANVYAVKVLRSNGSGSMSDVVKGVEFAATSHLEQ 132
Query  235  ----KDAKSRGANGKYVMNTSLGGEFSKAVNDAAANVVKSGIFLSVAAGNEAENASNSSP 290
                KD K +G  G  V N SLGG  ++A++ A    V++GI ++VAAGN+  +A N SP
Sbjct  133  KKKAKDGKRKGFKGS-VANMSLGGGKTQALDAAVNAAVRTGIHFAVAAGNDNADACNYSP 191
Query  291  ASAAEACTIAASTSTDGSASFTNFGSVVDLYAPGQSITAAYPGG--GSKTLSGTSMAAPH 348
            A+A+E  T+ AS   D  A F+N+G   D++APG +I + + G      T+SGTSMA+PH
Sbjct  192  AAASEPVTVGASALDDSRAYFSNYGKCTDIFAPGLNIQSTWIGSKYAVNTISGTSMASPH 251
Query  349  VAGVAAYLM----------ALEGVSAGNACARIVQLAT-SSISRAPSGTTSKLLYNG 394
            +AG+ AY +          AL  ++       ++ +AT  ++S  PS T + L +NG
Sbjct  252  IAGLLAYYLSLQPAEDSEYALASITPKKLKENLISVATEDALSDIPSDTPNLLAWNG 308

Sequence Alignment: 15. Allergen Name: Cla c 9.0101 Sequence ID: ABQ59329

 Score = 83.6 bits 339,  Expect = 2e-17
 Identities = 129/274 47%, Positives = 179/274 65%, Gaps = 30/274 10%
Query  119  VQSNVPSWGLARISSKRT---GT-TSYTYDSTAGEGVVFYGVDTGIDISHSDFGGRAKWG 174
            V+ N P WGLARIS + +   GT   Y Y    GEGV  Y VDTG ++ H DF GRA WG
Sbjct  13   VEKNAP-WGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVDHVDFEGRASWG 71
Query  175  TNVVDND-NTDGNGHGTHTASTAAGSKYGVAKKATLVAVKVLGADGSGTNSGVISGMDWA 233
              +   D + DGNGHGTH + T AG KYGVAKKA + AVKVL ++GSG+ S V+ G+++A
Sbjct  72   KTIPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGSMSDVVKGVEYA 131
Query  234  V----------KDAKSRGANGKYVMNTSLGGEFSKAVNDAAANVVKSGIFLSVAAGNEAE 283
                       K  K +G  G    N SLGG  S  ++ A    V +GI ++VAAGN+  
Sbjct  132  AESHLEQVSIAKKGKRKGFKGS-TANMSLGGGKSPILDKAVNAAVDAGIHFAVAAGNDNA 190
Query  284  NASNSSPASAAEACTIAASTSTDGSASFTNFGSVVDLYAPGQSITAAYPGG--GSKTLSG 341
            ++ N SPA+A  A T+ AST +D  A F+N+G   D++APG +I + + G      T+SG
Sbjct  191  DSCNYSPAAAENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTWIGSKYAVNTISG 250
Query  342  TSMAAPHVAGVAAYLMALE----------GVSAGNACARIVQLAT-SSISRAPSGTTSKL 390
            TSMA+PHVAG+ AYL++L+           +S     A ++ +AT  +++  PS T + L
Sbjct  251  TSMASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALTDVPSNTANIL 310
Query  391  LYNG 394
             +NG
Sbjct  311  AWNG 314

Sequence Alignment: 16. Allergen Name: Cla h 9.0101 Sequence ID: AAX14379

 Score = 83.1 bits 337,  Expect = 3e-17
 Identities = 162/373 43%, Positives = 232/373 62%, Gaps = 49/373 13%
Query  18   DAGTLLTASNTDAVIPSSYIVVMNDDVSTAEFSTHREWATNVH-----ARLSRRKNGETG 72
            DA  +++ASN    I  +Y++   D V+    + H  W  ++H     A+   RK  ++ 
Sbjct  27   DAAPIISASNAKE-IADNYMIKFKDHVTQNLAAEHHGWVQDLHEKTQVAKTELRKRSQS- 84
Query  73   P-------G-KH-FEI-NGLKGYTASFDENTAKDIANDPAVKYIEPDMIVNA--TANVVQ 120
            P       G KH + I  GL GY   FDE+  + I   P V+ +E D  V+   + + V+
Sbjct  85   PMVDDIFNGLKHTYNIAGGLMGYAGHFDEDVIEQIRRHPDVELVERDQEVHVLGSESEVE 144
Query  121  SNVPSWGLARISSKRT---GT-TSYTYDSTAGEGVVFYGVDTGIDISHSDFGGRAKWGTN 176
             N P WGLARIS + +   GT   Y Y    GEGV  Y VDTG ++ H DF GRA WG  
Sbjct  145  KNAP-WGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVDHVDFEGRASWGKT 203
Query  177  VVDND-NTDGNGHGTHTASTAAGSKYGVAKKATLVAVKVLGADGSGTNSGVISGMDWAV- 234
            +   D + DGNGHGTH + T AG KYGVAKKA + AVKVL ++GSG+ S V+ G+++A  
Sbjct  204  IPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGSMSDVVKGVEYAAE 263
Query  235  ---------KDAKSRGANGKYVMNTSLGGEFSKAVNDAAANVVKSGIFLSVAAGNEAENA 285
                     K  K +G  G    N SLGG  S  ++ A    V +GI ++VAAGN+  ++
Sbjct  264  SHLEQVSITKKGKRKGFKGS-TANMSLGGGKSPILDKAVNAAVDAGIHFAVAAGNDNADS 322
Query  286  SNSSPASAAEACTIAASTSTDGSASFTNFGSVVDLYAPGQSITAAYPGG--GSKTLSGTS 343
             N SPA+A  A T+ AST  D  A F+N+G   D++APG +I + + G      T+SGTS
Sbjct  323  CNYSPAAAENAVTVGASTLADERAYFSNYGKCNDIFAPGLNIQSTWIGSKYAVNTISGTS 382
Query  344  MAAPHVAGVAAYLMALE----------GVSAGNACARIVQLAT-SSISRAPSGTTSKLLY 392
            MA+PHVAG+ AYL++L+           +S     A ++ +AT  +++  PS T + L +
Sbjct  383  MASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALTDVPSNTANILAW 442
Query  393  NG 394
            NG
Sbjct  443  NG 444

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.