The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND
ASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK
Sequence Info Allergen Name Length Opt Bits Score E Value
AAK28533 Cor a 8 115 792 154.5 6.6e-40
Q8VX12 Fra a 3.0101 117 504 101.5 6.1e-24
Q4PLT6 Fra a 3.0202 117 501 101.0 8.9e-24
Q4PLT9 Fra a 3.0102 117 501 101.0 8.9e-24
Q9M5X8 Pru av 3 117 499 100.6 1.1e-23
Q0Z8V0 Rub i 3.0101 117 492 99.3 2.8e-23
AAL25839 Hev b 12 116 488 98.6 4.6e-23
Q4PLU0 Fra a 3.0201 117 488 98.6 4.7e-23
ACN11576 Pru du 3.0101 123 484 97.8 8.1e-23
Q9M5X7 Mal d 3 115 480 97.1 1.3e-22
ADC80502 Pha v 3.0101 115 476 96.4 2.1e-22
Q9M5X6 Pyr c 3 115 457 92.9 2.4e-21
XP_019446786 Lup an 3.0101 116 457 92.9 2.4e-21
A0A059ST23 Pun g 1.0301 120 453 92.1 4.1e-21
A0A059STC4 Pun g 1.0101 120 446 90.8 1e-20
A0A161AT60 Pis s 3.0101 120 444 90.5 1.3e-20
P85894 Mor n 3.0101 91 442 90.1 1.3e-20
ABX56711 Ara h 9.0101 116 441 89.9 1.9e-20
P82534 Pru d 3 91 438 89.3 2.2e-20
ANC85020 Art ar 3.0102 116 438 89.4 2.7e-20
ACE07187 Art v 3.0202 116 438 89.4 2.7e-20
ANC85027 Art si 3.0102 116 438 89.4 2.7e-20
A0AT29 Len c 3.0101 118 437 89.2 3.1e-20
ABY21307 Pla or 3.0101 118 436 89.0 3.6e-20
ADC80503 Pha v 3.0201 118 435 88.8 4.1e-20
A0A059SSZ0 Pun g 1.0201 120 433 88.4 5.3e-20
P81651 Pru ar 3 91 431 88.0 5.4e-20
CAL07989 Pla a 3.0101 118 432 88.3 6e-20
ANC85023 Art gm 3.0102 117 430 87.9 7.6e-20
ANC85022 Art gm 3.0101 117 430 87.9 7.6e-20
CAB96876 Pru p 3 91 428 87.5 7.8e-20
P81402 Pru p 3 91 426 87.1 1e-19
ANC85025 Art la 3.0102 115 427 87.3 1.1e-19
QIN55516 Art ca 3.0102 117 425 87.0 1.4e-19
EU564845 Art v 3.0201 114 422 86.4 2.1e-19
ANC85019 Art ar 3.0101 116 422 86.4 2.1e-19
ANC85024 Art la 3.0101 116 422 86.4 2.1e-19
EU564847 Art v 3.0301 117 420 86.1 2.7e-19
ANC85018 Art an 3.0102 117 416 85.3 4.5e-19
ANC85021 Art ca 3.0101 117 413 84.8 6.7e-19
ANC85017 Art an 3.0101 117 413 84.8 6.7e-19
ANC85026 Art si 3.0101 116 411 84.4 8.5e-19
W0U0V5 Can s 3.0101 91 400 82.3 2.8e-18
P93224 Sola l 3.0101 114 394 81.3 7.4e-18
AAB42069 Lyc e 3 114 394 81.3 7.4e-18
P19656-1 Zea m 14.0101 120 382 79.1 3.6e-17
P19656-2 Zea m 14.0102 128 378 78.3 6.3e-17
ACV04796 Api g 2 118 377 78.1 6.6e-17
ABX75045 Ara h 9.0201 92 370 76.8 1.3e-16
AAA32970 Hor v 1 117 362 75.4 4.5e-16
CAA42832 Hor v 1 134 359 74.8 7.4e-16
A0A510A9S3 Ara h 17.0101 93 355 74.1 8.9e-16
CAH69206 Tri tu 14.0101 115 340 71.3 7.3e-15
ABU95411 Sin a 3.0101 92 334 70.2 1.3e-14
P82007 Hel a 3.0101 116 333 70.0 1.8e-14
NP_001316123 Sola l 7.0101 115 321 67.8 8.2e-14
19846220 Tri a 14.0101 90 295 63.0 1.8e-12
O04403 Par j 2 133 205 46.5 2.5e-07
O04004 Amb a 6 118 201 45.7 3.7e-07
P55958 Par j 2 133 199 45.4 5.4e-07
Q40905 Par j 1 138 178 41.5 8.1e-06
O04404 Par j 1 176 164 39.0 6e-05
P0C088 Art v 3.0101 37 151 36.4 7.8e-05
P43217 Par j 1 139 160 38.2 8.1e-05
CAI94601 Par j 1.0103 139 156 37.5 0.00014
CAA54587 Par j 1.0101 133 150 36.4 0.00028
10998016 Cas s 8 36 139 34.2 0.00035
XP_018816661 Jug r 8.0101 96 126 31.9 0.0044
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cor a 8 Sequence ID: AAK28533

 Score = 154.5 bits 792,  Expect = 7e-40
 Identities = 115/115 100%, Positives = 115/115 100%, Gaps = 0/115 0%
Query  1    MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND 60
            MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND
Sbjct  1    MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND 60
Query  61   ASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            ASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK
Sbjct  61   ASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115

Sequence Alignment: 2. Allergen Name: Fra a 3.0101 Sequence ID: Q8VX12

 Score = 101.5 bits 504,  Expect = 6e-24
 Identities = 66/112 58%, Positives = 90/112 80%, Gaps = 1/112 0%
Query  3    SLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDAS 62
            ++KL    LLC++VA P+A+A +TC Q+  N++PC+ Y+K+GG +P +CC G+R +N  +
Sbjct  6    AMKLSLVALLCIVVALPIAQA-ITCGQVASNISPCLTYVKSGGAVPAACCSGIRNLNGMA 64
Query  63   RTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            +TT+DRQ+ACNCLK  A GI GLNPNLAAGLPGKCGV++PYKIS +TNC  VK
Sbjct  65   KTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAVK 117

Sequence Alignment: 3. Allergen Name: Fra a 3.0202 Sequence ID: Q4PLT6

 Score = 101.0 bits 501,  Expect = 9e-24
 Identities = 66/112 58%, Positives = 90/112 80%, Gaps = 1/112 0%
Query  3    SLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDAS 62
            ++KL    LLC++VA P+A+A +TC Q+  +++PCV Y+K+GG +P +CC G+R++N A+
Sbjct  6    AMKLSLVALLCIVVALPIAQA-ITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSAA 64
Query  63   RTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            +TT+DRQ+ CNCLK  +  I GLNPNLAAGLPGKCGVN+PYKIS STNC  VK
Sbjct  65   KTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCGVNVPYKISTSTNCAAVK 117

Sequence Alignment: 4. Allergen Name: Fra a 3.0102 Sequence ID: Q4PLT9

 Score = 101.0 bits 501,  Expect = 9e-24
 Identities = 66/112 58%, Positives = 88/112 78%, Gaps = 1/112 0%
Query  3    SLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDAS 62
            ++KL    LLC++VA P+A+A +TC Q+  N++PCV Y+K+GG +P  CC G+R +N  +
Sbjct  6    AMKLSLVALLCIVVALPIAQA-ITCGQVASNISPCVTYVKSGGAVPAPCCSGIRNLNGMA 64
Query  63   RTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            +TT+DRQ+ CNCLK  A GI GLNPNLAAGLPGKCGV++PYKIS +TNC  VK
Sbjct  65   KTTADRQATCNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAVK 117

Sequence Alignment: 5. Allergen Name: Pru av 3 Sequence ID: Q9M5X8

 Score = 100.6 bits 499,  Expect = 1e-23
 Identities = 64/110 58%, Positives = 85/110 77%, Gaps = 1/110 0%
Query  5    KLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRT 64
            KL   V LCM+V+ P+A+A LTC Q+  NL PC+ Y++ GG +PP+CC G+R +N+ ++T
Sbjct  8    KLALVVALCMVVSVPIAQA-LTCGQVSSNLAPCIAYVRGGGAVPPACCNGIRNINNLAKT 66
Query  65   TSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            T+DRQ+ACNCLK  +  + G+N N AA LPGKCGVN+PYKISPSTNC  VK
Sbjct  67   TADRQTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATVK 117

Sequence Alignment: 6. Allergen Name: Rub i 3.0101 Sequence ID: Q0Z8V0

 Score = 99.3 bits 492,  Expect = 3e-23
 Identities = 67/111 60%, Positives = 85/111 76%, Gaps = 1/111 0%
Query  4    LKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASR 63
            +KL    LLC++VA PVA+A +TC Q+  N+ PC  Y+KNGG +P +CC GVR +N  ++
Sbjct  7    MKLALVALLCIVVAVPVAQA-ITCGQVTQNVAPCFNYVKNGGAVPAACCNGVRNLNSQAK 65
Query  64   TTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            TT+DRQ  CNCLK+ A  I GLNP+LAAGLPGKCGV++PYKIS STNC  VK
Sbjct  66   TTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKCGVSVPYKISTSTNCATVK 117

Sequence Alignment: 7. Allergen Name: Hev b 12 Sequence ID: AAL25839

 Score = 98.6 bits 488,  Expect = 5e-23
 Identities = 66/115 57%, Positives = 86/115 74%, Gaps = 1/115 0%
Query  1    MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPP-SCCKGVRAVN 59
            M +LK+V  ++LCM+VAAP+   ++TC Q++  L PC+ YLK  G  PP +CC GVR +N
Sbjct  1    MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPATCCNGVRTIN 60
Query  60   DASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            +A++TT+DR++AC CLK  A  + GLNP   AGLPGKCGVNIPYKIS STNC  VK
Sbjct  61   NAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGVNIPYKISLSTNCATVK 116

Sequence Alignment: 8. Allergen Name: Fra a 3.0201 Sequence ID: Q4PLU0

 Score = 98.6 bits 488,  Expect = 5e-23
 Identities = 64/112 57%, Positives = 90/112 80%, Gaps = 1/112 0%
Query  3    SLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDAS 62
            ++KL    LLC++VA P+A+A +TC Q+  +++PCV Y+K+GG +P +CC G+R++N A+
Sbjct  6    AMKLSLVALLCIVVALPIAQA-ITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSAA 64
Query  63   RTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            +TT+DRQ+ CNCLK  +  I GLNP+LAAGLPGKCGV++PYKIS STNC  VK
Sbjct  65   KTTADRQATCNCLKQASGAIKGLNPSLAAGLPGKCGVSVPYKISTSTNCAAVK 117

Sequence Alignment: 9. Allergen Name: Pru du 3.0101 Sequence ID: ACN11576

 Score = 97.8 bits 484,  Expect = 8e-23
 Identities = 70/112 62%, Positives = 84/112 75%, Gaps = 4/112 3%
Query  4    LKLVC--AVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDA 61
            LKLVC  AV+ CM V  P A A+++C Q+  NLTPC+ Y+ NGG L PSCC GVR++   
Sbjct  8    LKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANGGALNPSCCTGVRSLYSL 67
Query  62   SRTTSDRQSACNCLKDTAKGIAGLNPN--LAAGLPGKCGVNIPYKISPSTNCNNVK 115
            ++TT+DRQS CNCLK    GI   N N  LAAGLPGKCGVNIPYKISPST+C  +K
Sbjct  68   AQTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTDCKTIK 123

Sequence Alignment: 10. Allergen Name: Mal d 3 Sequence ID: Q9M5X7

 Score = 97.1 bits 480,  Expect = 1e-22
 Identities = 66/108 61%, Positives = 85/108 78%, Gaps = 3/108 2%
Query  5    KLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRT 64
            KL   V LCM V+  VA A +TC Q+  +L PC+ Y+++GG +PP+CC G+R +N  +RT
Sbjct  8    KLALVVALCMAVS--VAHA-ITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLART 64
Query  65   TSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            T+DRQ+ACNCLK+ A  I+G+NPN AAGLPGKCGVN+PYKIS STNC  VK
Sbjct  65   TADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATVK 115

Sequence Alignment: 11. Allergen Name: Pha v 3.0101 Sequence ID: ADC80502

 Score = 96.4 bits 476,  Expect = 2e-22
 Identities = 61/114 53%, Positives = 81/114 71%, Gaps = 0/114 0%
Query  1    MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND 60
            M S+K+ C V+LCM+V        +TC Q++ NL PCV +L+NGG +P  CC GVR + +
Sbjct  1    MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMN 60
Query  61   ASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNV 114
            ++R+T+DR+  CNCLK  A  + GLNPN A  LPGKCGVNIPYKIS STNC ++
Sbjct  61   SARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114

Sequence Alignment: 12. Allergen Name: Pyr c 3 Sequence ID: Q9M5X6

 Score = 92.9 bits 457,  Expect = 2e-21
 Identities = 61/109 55%, Positives = 82/109 75%, Gaps = 3/109 2%
Query  4    LKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASR 63
            +KL   V LCM V+  VA A +TC Q+  NL PC+ Y+++GG +PP+CC G++ +N  ++
Sbjct  7    IKLALVVALCMAVS--VAHA-ITCSQVSANLAPCINYVRSGGAVPPACCNGIKTINGLAK 63
Query  64   TTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            TT DRQ+ACNCLK+ A  ++G+NP  A  LPGKCGVN+PYKIS STNC  VK
Sbjct  64   TTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVNVPYKISTSTNCATVK 115

Sequence Alignment: 13. Allergen Name: Lup an 3.0101 Sequence ID: XP_019446786

 Score = 92.9 bits 457,  Expect = 2e-21
 Identities = 62/113 54%, Positives = 85/113 75%, Gaps = 2/113 1%
Query  2    GSLKLVCAVLLCMMV-AAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND 60
            G +KL CAVL+CM+V +AP+ +A +TC Q+  NL  C+ YL++GG +P  CC G++ + +
Sbjct  3    GIVKLACAVLICMVVVSAPLTKA-ITCGQVTANLAQCLNYLRSGGAVPAPCCNGIKNILN 61
Query  61   ASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
             ++TT DR++ACNCLK  A    GLNP+ A  LPGKCGVNIPYKIS STNC ++K
Sbjct  62   LAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGVNIPYKISTSTNCASIK 116

Sequence Alignment: 14. Allergen Name: Pun g 1.0301 Sequence ID: A0A059ST23

 Score = 92.1 bits 453,  Expect = 4e-21
 Identities = 64/114 56%, Positives = 85/114 74%, Gaps = 2/114 1%
Query  2    GSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLK-NG-GVLPPSCCKGVRAVN 59
            G L+L   VL+CM VA+ VA A +TC Q+  +L  C+ Y + NG G +P +CC G+R++N
Sbjct  5    GFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLN 64
Query  60   DASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
             A++TT DRQ+AC CLK  A  I+G+N  L AG PGKCGV+IPYKI+PSTNC+NVK
Sbjct  65   SAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120

Sequence Alignment: 15. Allergen Name: Pun g 1.0101 Sequence ID: A0A059STC4

 Score = 90.8 bits 446,  Expect = 1e-20
 Identities = 60/114 52%, Positives = 83/114 72%, Gaps = 2/114 1%
Query  2    GSLKLVCAVLLCMMVAAPVA-RASLTCPQIKGNLTPCVLYLKN-GGVLPPSCCKGVRAVN 59
            G +KL CAV+   +VAAP+A  A++TC Q+  +L PC+ Y ++ GG +PP+CC G++ ++
Sbjct  5    GLFKLACAVFAVALVAAPIATEAAVTCGQVASSLAPCIPYARSAGGAVPPACCSGIKTLD 64
Query  60   DASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
              +RTT DRQ+ C CLK  +  I+G+N  L A LP KCGVNIPYKISPST+C  VK
Sbjct  65   GMARTTPDRQATCKCLKSASTSISGINYGLVASLPAKCGVNIPYKISPSTDCARVK 120

Sequence Alignment: 16. Allergen Name: Pis s 3.0101 Sequence ID: A0A161AT60

 Score = 90.5 bits 444,  Expect = 1e-20
 Identities = 64/113 56%, Positives = 82/113 72%, Gaps = 3/113 2%
Query  3    SLKLVC-AVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLK--NGGVLPPSCCKGVRAVN 59
            S+KL C A+++CM+V AP+A A+L+C  +  ++ PCV YL+  N    PP CC GV+ + 
Sbjct  4    SMKLACVALVICMVVIAPMAEAALSCGTVSADMAPCVTYLQAPNNASPPPPCCAGVKKLL 63
Query  60   DASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
             A+ TT DRQ+ACNCLK  A  I  LN N AA LPGKCGV+IPYKIS STNCN V+
Sbjct  64   AAATTTPDRQAACNCLKSAAGSIPKLNTNNAAALPGKCGVSIPYKISTSTNCNTVR 119

Sequence Alignment: 17. Allergen Name: Mor n 3.0101 Sequence ID: P85894

 Score = 90.1 bits 442,  Expect = 1e-20
 Identities = 57/91 62%, Positives = 75/91 82%, Gaps = 0/91 0%
Query  25   LTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAG 84
            +TC Q+  +L PC+ YL+ GGV+P +CC GVR++N+A++TT+DRQ+ACNCLK     I G
Sbjct  1    ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKG 60
Query  85   LNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            LN NLAAGLPGKCGV++PYKISPST+C +VK
Sbjct  61   LNLNLAAGLPGKCGVSVPYKISPSTDCKSVK 91

Sequence Alignment: 18. Allergen Name: Ara h 9.0101 Sequence ID: ABX56711

 Score = 89.9 bits 441,  Expect = 2e-20
 Identities = 63/114 55%, Positives = 80/114 70%, Gaps = 2/114 1%
Query  1    MGSLKLVCAVLLCM-MVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVN 59
            M SLK+   +L+CM MV AP+  A ++C Q+   L PC+ +L  GG  PP+CC GVR + 
Sbjct  1    MASLKFAFVMLVCMAMVGAPMVNA-ISCGQVNSALAPCIPFLTKGGAPPPACCSGVRGLL 59
Query  60   DASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
             A RTT+DRQ+ACNCLK  A  + GLN   AA LPG+CGV+IPYKIS STNC  +K
Sbjct  60   GALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGVSIPYKISTSTNCATIK 115

Sequence Alignment: 19. Allergen Name: Pru d 3 Sequence ID: P82534

 Score = 89.3 bits 438,  Expect = 2e-20
 Identities = 56/91 61%, Positives = 71/91 78%, Gaps = 0/91 0%
Query  25   LTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAG 84
            +TC Q+  NL PC+ Y+K GG +PP+CC G+R VN+ +RTT+DR++ACNCLK  +  I G
Sbjct  1    ITCGQVSSNLAPCINYVKGGGAVPPACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPG 60
Query  85   LNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            +NPN AA LPGKCGVN+PYKIS STNC  VK
Sbjct  61   VNPNNAAALPGKCGVNVPYKISASTNCATVK 91

Sequence Alignment: 20. Allergen Name: Art ar 3.0102 Sequence ID: ANC85020

 Score = 89.4 bits 438,  Expect = 3e-20
 Identities = 60/114 52%, Positives = 82/114 71%, Gaps = 1/114 0%
Query  1    MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND 60
            M  +K+ CA+++CM++++  A A LTC  +   +TPC+ YLK GG +P  CC GV+ +ND
Sbjct  3    MKMMKFFCAMVVCMVLSSSYAEA-LTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLND 61
Query  61   ASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            A++TT DRQ+ACNCLK + K    L  ++AA LP KCGVNIPYKIS  T+CN VK
Sbjct  62   AAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 21. Allergen Name: Art v 3.0202 Sequence ID: ACE07187

 Score = 89.4 bits 438,  Expect = 3e-20
 Identities = 60/114 52%, Positives = 82/114 71%, Gaps = 1/114 0%
Query  1    MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND 60
            M  +K+ CA+++CM++++  A A LTC  +   +TPC+ YLK GG +P  CC GV+ +ND
Sbjct  3    MKMMKFFCAMVVCMVLSSSYAEA-LTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLND 61
Query  61   ASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            A++TT DRQ+ACNCLK + K    L  ++AA LP KCGVNIPYKIS  T+CN VK
Sbjct  62   AAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 22. Allergen Name: Art si 3.0102 Sequence ID: ANC85027

 Score = 89.4 bits 438,  Expect = 3e-20
 Identities = 60/114 52%, Positives = 82/114 71%, Gaps = 1/114 0%
Query  1    MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND 60
            M  +K+ CA+++CM++++  A A LTC  +   +TPC+ YLK GG +P  CC GV+ +ND
Sbjct  3    MKMMKFFCAMVVCMVLSSSYAEA-LTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLND 61
Query  61   ASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            A++TT DRQ+ACNCLK + K    L  ++AA LP KCGVNIPYKIS  T+CN VK
Sbjct  62   AAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 23. Allergen Name: Len c 3.0101 Sequence ID: A0AT29

 Score = 89.2 bits 437,  Expect = 3e-20
 Identities = 62/112 55%, Positives = 78/112 69%, Gaps = 1/112 0%
Query  4    LKLVCAVL-LCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDAS 62
            +KL C VL +CM+V AP+A  +++C  +  +L+PC+ YL  G    P CC GV+ +  A+
Sbjct  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAA 64
Query  63   RTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
             TT DRQ+ACNCLK  A  I  LN N AA LPGKCGVNIPYKIS +TNCN VK
Sbjct  65   NTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117

Sequence Alignment: 24. Allergen Name: Pla or 3.0101 Sequence ID: ABY21307

 Score = 89.0 bits 436,  Expect = 4e-20
 Identities = 57/111 51%, Positives = 80/111 72%, Gaps = 0/111 0%
Query  5    KLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRT 64
            KL C +L CM+  AP A A++TC  +   LTPC+ YL++GG + P+CC GV+A+N+ ++T
Sbjct  8    KLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKT 67
Query  65   TSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            T DRQ+AC CLK  +  I+G+    AA L GKCGVN+PYKISP+ +C+ VK
Sbjct  68   TPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118

Sequence Alignment: 25. Allergen Name: Pha v 3.0201 Sequence ID: ADC80503

 Score = 88.8 bits 435,  Expect = 4e-20
 Identities = 61/115 53%, Positives = 81/115 70%, Gaps = 2/115 1%
Query  1    MGSLKLVCAV-LLCMMV-AAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAV 58
            M +L   C V +LC++V  AP A A+++C Q+  +L  C+ +L  GG +P SCC GVR++
Sbjct  1    MATLNSACVVAVLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGGPVPASCCSGVRSL 60
Query  59   NDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            N A++TT DRQ+ CNCLK  A  I G+N N A  LPGKCGV+IPYKIS STNC  +K
Sbjct  61   NAAAKTTPDRQAVCNCLKSAAGAIPGFNANNAGILPGKCGVSIPYKISTSTNCATIK 117

Sequence Alignment: 26. Allergen Name: Pun g 1.0201 Sequence ID: A0A059SSZ0

 Score = 88.4 bits 433,  Expect = 5e-20
 Identities = 63/109 57%, Positives = 84/109 77%, Gaps = 3/109 2%
Query  6    LVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPS--CCKGVRAVNDASR 63
            LV A++LCM+VAA V  +++TC Q+  +LTPC+ Y + G V  PS  CC GVR++N+A++
Sbjct  10   LVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYAR-GVVAAPSAACCSGVRSLNNAAK 68
Query  64   TTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            TT DRQ+ACNCLK  A+ I G+N      LPGKCGV+IPYKISPST+C+ VK
Sbjct  69   TTPDRQTACNCLKVIARSITGINYGRVGALPGKCGVSIPYKISPSTDCSRVK 120

Sequence Alignment: 27. Allergen Name: Pru ar 3 Sequence ID: P81651

 Score = 88.0 bits 431,  Expect = 5e-20
 Identities = 55/91 60%, Positives = 71/91 78%, Gaps = 0/91 0%
Query  25   LTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAG 84
            +TC Q+  +L PC+ Y++ GG +PP+CC G+R VN+ +RTT DR++ACNCLK  +  I+G
Sbjct  1    ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISG 60
Query  85   LNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            +NPN AA LPGKCGVNIPYKIS STNC  VK
Sbjct  61   VNPNNAAALPGKCGVNIPYKISASTNCATVK 91

Sequence Alignment: 28. Allergen Name: Pla a 3.0101 Sequence ID: CAL07989

 Score = 88.3 bits 432,  Expect = 6e-20
 Identities = 56/111 50%, Positives = 80/111 72%, Gaps = 0/111 0%
Query  5    KLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRT 64
            KL C +L CM+  AP A A++TC  +   LTPC+ +L++GG + P+CC GV+A+N+ ++T
Sbjct  8    KLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAVAPACCNGVKALNNDAKT 67
Query  65   TSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            T DRQ+AC CLK  +  I+G+    AA L GKCGVN+PYKISP+ +C+ VK
Sbjct  68   TPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118

Sequence Alignment: 29. Allergen Name: Art gm 3.0102 Sequence ID: ANC85023

 Score = 87.9 bits 430,  Expect = 8e-20
 Identities = 57/115 49%, Positives = 80/115 69%, Gaps = 0/115 0%
Query  1    MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND 60
            M  +K+ C +++CM+V++  A A+LTC  +   ++PC+ +LK GG +P  CC GV+ +ND
Sbjct  3    MKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCLSFLKQGGEVPADCCTGVKGLND 62
Query  61   ASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            A++TT DRQ+ACNCLK + K    L  + A  LP KCGVNIPYKIS  T+CN VK
Sbjct  63   AAKTTPDRQTACNCLKTSFKSNKDLKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 30. Allergen Name: Art gm 3.0101 Sequence ID: ANC85022

 Score = 87.9 bits 430,  Expect = 8e-20
 Identities = 57/115 49%, Positives = 80/115 69%, Gaps = 0/115 0%
Query  1    MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND 60
            M  +K+ C +++CM+V++  A A+LTC  +   ++PC  +LK GG +P  CC GV+ +ND
Sbjct  3    MKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCTSFLKQGGEVPADCCTGVKGLND 62
Query  61   ASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            A++TT DRQ+ACNCLK + K    +  + AA LP KCGVNIPYKIS  T+CN VK
Sbjct  63   AAKTTPDRQTACNCLKTSFKSNKDFKSDNAAVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 31. Allergen Name: Pru p 3 Sequence ID: CAB96876

 Score = 87.5 bits 428,  Expect = 8e-20
 Identities = 54/91 59%, Positives = 70/91 76%, Gaps = 0/91 0%
Query  25   LTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAG 84
            +TC Q+  +L PC+ Y++ GG +PP+CC G+R VN+ +RTT DRQ+ACNCLK  +  + G
Sbjct  1    ITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  85   LNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            +NPN AA LPGKCGV+IPYKIS STNC  VK
Sbjct  61   VNPNNAAALPGKCGVSIPYKISASTNCATVK 91

Sequence Alignment: 32. Allergen Name: Pru p 3 Sequence ID: P81402

 Score = 87.1 bits 426,  Expect = 1e-19
 Identities = 54/91 59%, Positives = 69/91 75%, Gaps = 0/91 0%
Query  25   LTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAG 84
            +TC Q+   L PC+ Y++ GG +PP+CC G+R VN+ +RTT DRQ+ACNCLK  +  + G
Sbjct  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  85   LNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            +NPN AA LPGKCGV+IPYKIS STNC  VK
Sbjct  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91

Sequence Alignment: 33. Allergen Name: Art la 3.0102 Sequence ID: ANC85025

 Score = 87.3 bits 427,  Expect = 1e-19
 Identities = 55/115 47%, Positives = 80/115 69%, Gaps = 0/115 0%
Query  1    MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND 60
            M  +K+ C +++CM+V +  A A+LTC  +   ++PC+ YLK GG +P  CC GV+ +ND
Sbjct  1    MKMMKVFCVMVVCMVVKSSYAEAALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLND 60
Query  61   ASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            A++TT DRQ+ACNCLK + K    L  ++A  LP KCG+N+PYK+S  T+CN VK
Sbjct  61   ATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 115

Sequence Alignment: 34. Allergen Name: Art ca 3.0102 Sequence ID: QIN55516

 Score = 87.0 bits 425,  Expect = 1e-19
 Identities = 58/115 50%, Positives = 77/115 66%, Gaps = 0/115 0%
Query  1    MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND 60
            M  +K+ C +++CM+V +  A A+LTC  +   +TPC+ +LK GG +P  CC GV+ +ND
Sbjct  3    MKMMKVFCVMIVCMVVLSSYAEAALTCSDVSNKITPCLSFLKQGGEVPADCCTGVKGLND 62
Query  61   ASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            A++T  DRQ ACNCLK T K    L  + A  LP KCGVNIPYKIS  T+CN VK
Sbjct  63   AAKTGPDRQKACNCLKTTFKSNKDLKSDNAVVLPSKCGVNIPYKISLETDCNTVK 117

Sequence Alignment: 35. Allergen Name: Art v 3.0201 Sequence ID: EU564845

 Score = 86.4 bits 422,  Expect = 2e-19
 Identities = 58/114 50%, Positives = 80/114 70%, Gaps = 1/114 0%
Query  1    MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND 60
            M  +K+ CA+++CM+V++  A A L C  +   ++ C+ YLK GG +P  CC GV+ +ND
Sbjct  1    MKMMKFFCAMVVCMVVSSSYAEA-LKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLND 59
Query  61   ASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            A++TT DRQ+ACNCLK T K    +  ++AA LP KCGVNIPYKIS  T+CN VK
Sbjct  60   AAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKVK 114

Sequence Alignment: 36. Allergen Name: Art ar 3.0101 Sequence ID: ANC85019

 Score = 86.4 bits 422,  Expect = 2e-19
 Identities = 58/114 50%, Positives = 80/114 70%, Gaps = 1/114 0%
Query  1    MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND 60
            M  +K+ CA+++CM+V++  A A L C  +   ++ C+ YLK GG +P  CC GV+ +ND
Sbjct  3    MKMMKFFCAMVVCMVVSSSYAEA-LKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLND 61
Query  61   ASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            A++TT DRQ+ACNCLK T K    +  ++AA LP KCGVNIPYKIS  T+CN VK
Sbjct  62   AAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 37. Allergen Name: Art la 3.0101 Sequence ID: ANC85024

 Score = 86.4 bits 422,  Expect = 2e-19
 Identities = 58/114 50%, Positives = 80/114 70%, Gaps = 1/114 0%
Query  1    MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND 60
            M  +K+ CA+++CM+V++  A A L C  +   ++ C+ YLK GG +P  CC GV+ +ND
Sbjct  3    MKMMKFFCAMVVCMVVSSSYAEA-LKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLND 61
Query  61   ASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            A++TT DRQ+ACNCLK T K    +  ++AA LP KCGVNIPYKIS  T+CN VK
Sbjct  62   AAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 38. Allergen Name: Art v 3.0301 Sequence ID: EU564847

 Score = 86.1 bits 420,  Expect = 3e-19
 Identities = 53/112 47%, Positives = 79/112 70%, Gaps = 0/112 0%
Query  4    LKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASR 63
            +K+ C +++CM+V+   A ++LTC  +   ++PC+ YLK GG +P  CC GV+ +NDA++
Sbjct  6    MKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATK 65
Query  64   TTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            TT DRQ+ACNCLK + K    L  ++A  LP KCG+N+PYK+S  T+CN VK
Sbjct  66   TTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117

Sequence Alignment: 39. Allergen Name: Art an 3.0102 Sequence ID: ANC85018

 Score = 85.3 bits 416,  Expect = 5e-19
 Identities = 56/115 48%, Positives = 78/115 67%, Gaps = 0/115 0%
Query  1    MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND 60
            M  +K+ C +++CM+V +  A A+LTC  +   ++PC  +L+ GG +P  CC GV+ +ND
Sbjct  3    MKMMKVFCVMVVCMVVTSSYAEAALTCNDVTKKISPCTSFLEKGGEVPVDCCTGVKGLND 62
Query  61   ASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            A++TT DRQ+ACNCLK + K    +    AA LP KCGVNIPYKIS  T+CN VK
Sbjct  63   AAKTTPDRQAACNCLKTSFKSSNNFKEENAAVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 40. Allergen Name: Art ca 3.0101 Sequence ID: ANC85021

 Score = 84.8 bits 413,  Expect = 7e-19
 Identities = 56/115 48%, Positives = 77/115 66%, Gaps = 0/115 0%
Query  1    MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND 60
            M  +K+ C +++CM+V++  A A+LTC  +   + PC  +LK GG +   CC GV+ +ND
Sbjct  3    MKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVSADCCTGVKGLND 62
Query  61   ASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            A++TT DRQ+ACNCLK T K    +  + A  LP KCGVNIPYKIS  T+CN VK
Sbjct  63   AAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 41. Allergen Name: Art an 3.0101 Sequence ID: ANC85017

 Score = 84.8 bits 413,  Expect = 7e-19
 Identities = 56/115 48%, Positives = 77/115 66%, Gaps = 0/115 0%
Query  1    MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND 60
            M  +K+ C +++CM+V++  A A+LTC  +   + PC  +LK GG +   CC GV+ +ND
Sbjct  3    MKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVSADCCTGVKGLND 62
Query  61   ASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            A++TT DRQ+ACNCLK T K    +  + A  LP KCGVNIPYKIS  T+CN VK
Sbjct  63   AAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 42. Allergen Name: Art si 3.0101 Sequence ID: ANC85026

 Score = 84.4 bits 411,  Expect = 9e-19
 Identities = 55/114 48%, Positives = 79/114 69%, Gaps = 1/114 0%
Query  1    MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND 60
            M  +K+ C +++CM+V++  A A LTC  +   ++PC+ YLK GG +P +CC GV+ +ND
Sbjct  3    MKMMKVFCVMVVCMVVSSSYAEA-LTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLND 61
Query  61   ASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            A++TT DRQ+AC CLK++ K    L  + A  LP KCGV IPYK+S  T+CN VK
Sbjct  62   AAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116

Sequence Alignment: 43. Allergen Name: Can s 3.0101 Sequence ID: W0U0V5

 Score = 82.3 bits 400,  Expect = 3e-18
 Identities = 51/91 56%, Positives = 71/91 78%, Gaps = 0/91 0%
Query  25   LTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAG 84
            +TC Q+  +L PC+ YLK GG +P  CC  +++++ A++T +DRQ+AC CLK  A  I G
Sbjct  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
Query  85   LNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            +N NLA+GLPGKCGV+IPYKISPST+C++VK
Sbjct  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91

Sequence Alignment: 44. Allergen Name: Sola l 3.0101 Sequence ID: P93224

 Score = 81.3 bits 394,  Expect = 7e-18
 Identities = 56/109 51%, Positives = 76/109 69%, Gaps = 2/109 1%
Query  5    KLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRT 64
            K+ C V++CM+V AP A  SL+C ++   L PC+ YL+  G L   CC GV+ +  A++T
Sbjct  6    KIACFVVFCMVVVAPHAE-SLSCGEVTSGLAPCLPYLEGRGPLG-GCCGGVKGLLGAAKT 63
Query  65   TSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
              DR++AC CLK  A  I G++   AAGLPG CGVNIPYKISPST+C+ V+
Sbjct  64   PEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114

Sequence Alignment: 45. Allergen Name: Lyc e 3 Sequence ID: AAB42069

 Score = 81.3 bits 394,  Expect = 7e-18
 Identities = 56/109 51%, Positives = 76/109 69%, Gaps = 2/109 1%
Query  5    KLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRT 64
            K+ C V++CM+V AP A  SL+C ++   L PC+ YL+  G L   CC GV+ +  A++T
Sbjct  6    KIACFVVFCMVVVAPHAE-SLSCGEVTSGLAPCLPYLEGRGPLG-GCCGGVKGLLGAAKT 63
Query  65   TSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
              DR++AC CLK  A  I G++   AAGLPG CGVNIPYKISPST+C+ V+
Sbjct  64   PEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114

Sequence Alignment: 46. Allergen Name: Zea m 14.0101 Sequence ID: P19656-1

 Score = 79.1 bits 382,  Expect = 4e-17
 Identities = 51/106 48%, Positives = 78/106 73%, Gaps = 1/106 0%
Query  9    AVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPS-CCKGVRAVNDASRTTSD 67
            AV+  +++AA  + A+++C Q+   + PC+ Y +  G  P + CC GVR++N+A+RTT+D
Sbjct  13   AVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTAD 72
Query  68   RQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNV 114
            R++ACNCLK+ A G++GLN   AA +P KCGV+IPY IS ST+C+ V
Sbjct  73   RRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119

Sequence Alignment: 47. Allergen Name: Zea m 14.0102 Sequence ID: P19656-2

 Score = 78.3 bits 378,  Expect = 6e-17
 Identities = 50/104 48%, Positives = 77/104 74%, Gaps = 1/104 0%
Query  9    AVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPS-CCKGVRAVNDASRTTSD 67
            AV+  +++AA  + A+++C Q+   + PC+ Y +  G  P + CC GVR++N+A+RTT+D
Sbjct  13   AVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTAD 72
Query  68   RQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCN 112
            R++ACNCLK+ A G++GLN   AA +P KCGV+IPY IS ST+C+
Sbjct  73   RRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCS 117

Sequence Alignment: 48. Allergen Name: Api g 2 Sequence ID: ACV04796

 Score = 78.1 bits 377,  Expect = 7e-17
 Identities = 54/114 47%, Positives = 72/114 63%, Gaps = 3/114 2%
Query  1    MGSLKLVCAVLLCMMVAA---PVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRA 57
            MG  K+  AV + +MV     P     LTC Q+ G L  C+ YLK GG   P+CC GV+ 
Sbjct  1    MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYPSPACCGGVKG 60
Query  58   VNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNV 114
            +N  ++T +DR+ AC CLK  A  + G+N   A+ LPGKCG+ IPY ISPST+C+ V
Sbjct  61   LNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKCGIRIPYPISPSTDCSRV 117

Sequence Alignment: 49. Allergen Name: Ara h 9.0201 Sequence ID: ABX75045

 Score = 76.8 bits 370,  Expect = 1e-16
 Identities = 50/91 54%, Positives = 63/91 69%, Gaps = 0/91 0%
Query  25   LTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAG 84
            L+C Q+   L PC+ +L  GGV    CC GVR +  A++TT+DRQ+ACNCLK  A  + G
Sbjct  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
Query  85   LNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            LN   AA LPG+CGV+IPYKIS STNC  +K
Sbjct  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91

Sequence Alignment: 50. Allergen Name: Hor v 1 Sequence ID: AAA32970

 Score = 75.4 bits 362,  Expect = 4e-16
 Identities = 49/108 45%, Positives = 72/108 66%, Gaps = 2/108 1%
Query  6    LVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPS-CCKGVRAVNDASRT 64
            L+ A L+ M+ AAP A  +L C Q+   + PC+ Y++ GG  P   CC GVR +++ +++
Sbjct  8    LMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQ-GGPGPSGECCNGVRDLHNQAQS 66
Query  65   TSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNV 114
            + DRQ+ CNCLK  A+GI  LN N AA +P KC VN+PY ISP  +C+ +
Sbjct  67   SGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRI 116

Sequence Alignment: 51. Allergen Name: Hor v 1 Sequence ID: CAA42832

 Score = 74.8 bits 359,  Expect = 7e-16
 Identities = 49/106 46%, Positives = 71/106 66%, Gaps = 2/106 1%
Query  6    LVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPS-CCKGVRAVNDASRT 64
            L+ A L+ M+ AAP A  +L C Q+   + PC+ Y++ GG  P   CC GVR +++ +++
Sbjct  8    LMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQ-GGPGPSGECCNGVRDLHNQAQS 66
Query  65   TSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCN 112
            + DRQ+ CNCLK  A+GI  LN N AA +P KC VN+PY ISP  +C+
Sbjct  67   SGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCS 114

Sequence Alignment: 52. Allergen Name: Ara h 17.0101 Sequence ID: A0A510A9S3

 Score = 74.1 bits 355,  Expect = 9e-16
 Identities = 46/92 50%, Positives = 65/92 70%, Gaps = 1/92 1%
Query  24   SLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIA 83
            ++ C  +  ++ PC  YLK+GG +   CC G++ +N  ++TTSDRQ+ CNCLK  A  + 
Sbjct  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
Query  84   G-LNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
              +NPN AA LPGKCGV+IPYKIS S NC+++K
Sbjct  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93

Sequence Alignment: 53. Allergen Name: Tri tu 14.0101 Sequence ID: CAH69206

 Score = 71.3 bits 340,  Expect = 7e-15
 Identities = 46/105 43%, Positives = 75/105 71%, Gaps = 6/105 5%
Query  6    LVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPS-CCKGVRAVNDASRT 64
            ++ AV+  M++A  V  A+++C Q+   L+PC+ Y +  G  P + CC GVR++  ++R+
Sbjct  10   VLVAVVAAMLLA--VTEAAVSCGQVSSALSPCISYARGNGASPSAACCSGVRSLASSARS 67
Query  65   TSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
            T+D+Q+AC C+K  A   AGLN   AAG+P KCGV++PY IS S +C+ ++
Sbjct  68   TADKQAACKCIKSAA---AGLNAGKAAGIPTKCGVSVPYAISSSVDCSKIR 115

Sequence Alignment: 54. Allergen Name: Sin a 3.0101 Sequence ID: ABU95411

 Score = 70.2 bits 334,  Expect = 1e-14
 Identities = 47/92 51%, Positives = 56/92 60%, Gaps = 0/92 0%
Query  24   SLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIA 83
            +L+C  +  NL  C+ YL     LP  CC GV  +N+ +RTT DRQ AC CL   A    
Sbjct  1    ALSCGTVNSNLAACIGYLTQNAPLPKGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFP 60
Query  84   GLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115
             LN   AA LP  CGVNIPYKIS STNCN+V+
Sbjct  61   SLNAARAAALPKACGVNIPYKISKSTNCNSVR 92

Sequence Alignment: 55. Allergen Name: Hel a 3.0101 Sequence ID: P82007

 Score = 70.0 bits 333,  Expect = 2e-14
 Identities = 47/110 42%, Positives = 71/110 64%, Gaps = 4/110 3%
Query  1    MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND 60
            MG   L   V+  +MV   VA   +TC  + GNLTPC+ YL++GG   P+CC G + +  
Sbjct  6    MGVAILAMIVMAQLMVHPSVA---ITCNDVTGNLTPCLPYLRSGGKPTPACCAGAKKLLG 62
Query  61   ASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNV 114
            A+RT +DR++AC C K  A  +  + P++A+ LPGKCG++    I+P+ NCN +
Sbjct  63   ATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCGISTSIPINPNVNCNTI 115

Sequence Alignment: 56. Allergen Name: Sola l 7.0101 Sequence ID: NP_001316123

 Score = 67.8 bits 321,  Expect = 8e-14
 Identities = 43/114 37%, Positives = 69/114 60%, Gaps = 0/114 0%
Query  1    MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND 60
            M ++ ++  V+L +   A VAR ++TC Q+  NL PCV +L  GG    +CC GVR +N 
Sbjct  1    MKAIAILVLVVLAVFQLAMVARGAITCGQVDANLAPCVPFLTQGGEPGAACCSGVRTLNG 60
Query  61   ASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNV 114
             ++++ DR++ACNC+K  A     L  + A  LP KCG+++   IS + NC+ +
Sbjct  61   NTQSSDDRRTACNCVKAAANRYPNLKDDAAQSLPSKCGISLTVPISRTVNCDTI 114

Sequence Alignment: 57. Allergen Name: Tri a 14.0101 Sequence ID: 19846220

 Score = 63.0 bits 295,  Expect = 2e-12
 Identities = 39/90 43%, Positives = 59/90 65%, Gaps = 0/90 0%
Query  25   LTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAG 84
            + C ++   + PC+ Y++ G      CC GV+ +++ +R+ SDRQSACNCLK  A+GI  
Sbjct  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
Query  85   LNPNLAAGLPGKCGVNIPYKISPSTNCNNV 114
            LN + A  +P KCGVN+PY IS + +C+ V
Sbjct  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90

Sequence Alignment: 58. Allergen Name: Par j 2 Sequence ID: O04403

 Score = 46.5 bits 205,  Expect = 3e-07
 Identities = 34/113 30%, Positives = 64/113 56%, Gaps = 9/113 7%
Query  1    MGSLKLVCAVLL----CMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPP-SCCKGV 55
            M +L ++ A L       + +AP A     C ++  ++ PC+ ++K     P  SCC G 
Sbjct  6    MAALVVIAAALAWTSSAELASAP-APGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGT 64
Query  56   RAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVN--IPYKISPSTNCNN 113
            + +++  +TT  ++ AC C+    KGI+G+   L A +P KCG+   +P  I+   +C+ 
Sbjct  65   KKLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSK 123
Query  114  VK 115
            ++
Sbjct  124  IE 125

Sequence Alignment: 59. Allergen Name: Amb a 6 Sequence ID: O04004

 Score = 45.7 bits 201,  Expect = 4e-07
 Identities = 35/104 33%, Positives = 56/104 53%, Gaps = 4/104 3%
Query  9    AVLLCMMVAAPVA-RASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRTTSD 67
            AV L ++   P    AS TC  ++  L PC  +L  G     +CC GV  +N++ +T +D
Sbjct  11   AVGLLLVSWRPTMFAASPTCDTVQNILAPCAGFL-TGQEPSKACCTGVNNLNNSRKTKAD 69
Query  68   RQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYK-ISPSTNCNNV 114
            R + CNC+K+  K IA  +P     L  KCGV   +  +  + +C+ +
Sbjct  70   RVAVCNCIKELTKSIA-YDPKRMPLLSTKCGVKPDFPAVDKNLDCSKL 116

Sequence Alignment: 60. Allergen Name: Par j 2 Sequence ID: P55958

 Score = 45.4 bits 199,  Expect = 5e-07
 Identities = 34/113 30%, Positives = 62/113 54%, Gaps = 9/113 7%
Query  1    MGSLKLVCAVLLCMMVAAPV---ARASLTCPQIKGNLTPCVLYLKNGGVLPPS--CCKGV 55
            M +L ++ A L     A P    A     C ++  ++ PC+ ++K G    PS  CC G 
Sbjct  6    MAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVK-GEEKEPSKECCSGT 64
Query  56   RAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVN--IPYKISPSTNCNN 113
            + +++  +TT  ++ AC C+    KGI+G+   L A +P KC +   +P  I+   +C+ 
Sbjct  65   KKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLP-PITADFDCSK 123
Query  114  VK 115
            ++
Sbjct  124  IQ 125

Sequence Alignment: 61. Allergen Name: Par j 1 Sequence ID: Q40905

 Score = 41.5 bits 178,  Expect = 8e-06
 Identities = 30/100 30%, Positives = 54/100 54%, Gaps = 8/100 8%
Query  6    LVCAVLL----CMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPS--CCKGVRAVN 59
            +V AVL+      +  AP   +  TC  + G L PC+ +++ G    PS  CC G + ++
Sbjct  15   IVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQ-GKEKEPSKGCCSGAKRLD 73
Query  60   DASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISP 107
              ++T   R  AC C++   K  + ++  L + +P  CG+ +  K+ P
Sbjct  74   GETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGI-VDSKLPP 120

Sequence Alignment: 62. Allergen Name: Par j 1 Sequence ID: O04404

 Score = 39.0 bits 164,  Expect = 6e-05
 Identities = 25/88 28%, Positives = 46/88 52%, Gaps = 4/88 4%
Query  18   APVARASLTCPQIKGNLTPCVLYLKNGGVLPPS--CCKGVRAVNDASRTTSDRQSACNCL 75
            AP   +  TC  +   L PC+ +++ G    PS  CC G + ++  ++T   R  AC C+
Sbjct  32   APAPGSEETCGTVVRALMPCLPFVQ-GKEKEPSKGCCSGAKRLDGETKTGLQRVHACECI 90
Query  76   KDTAKGIAGLNPNLAAGLPGKCGVNIPYKISP 107
            +   K  + ++  L + +P  CG+ +  K+ P
Sbjct  91   QTAMKTYSDIDGKLVSEVPKHCGI-VDSKLPP 121

Sequence Alignment: 63. Allergen Name: Art v 3.0101 Sequence ID: P0C088

 Score = 36.4 bits 151,  Expect = 8e-05
 Identities = 17/37 45%, Positives = 25/37 67%, Gaps = 0/37 0%
Query  24   SLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND 60
            +LTC  +   ++PC+ YLK GG +P  CC GV+ +ND
Sbjct  1    ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND 37

Sequence Alignment: 64. Allergen Name: Par j 1 Sequence ID: P43217

 Score = 38.2 bits 160,  Expect = 8e-05
 Identities = 25/87 28%, Positives = 47/87 54%, Gaps = 7/87 8%
Query  26   TCPQIKGNLTPCVLYLKNGGVLPPS--CCKGVRAVNDASRTTSDRQSACNCLKDTAKGIA 83
            TC  +   L PC+ +++ G    PS  CC G + ++  ++T   R  AC C++   K  +
Sbjct  3    TCGTMVRALMPCLPFVQ-GKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYS 61
Query  84   GLNPNLAAGLPGKCGVNIPYKISP---STNCNNV 114
             ++  L + +P  CG+ +  K+ P   + +C  V
Sbjct  62   DIDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTV 94

Sequence Alignment: 65. Allergen Name: Par j 1.0103 Sequence ID: CAI94601

 Score = 37.5 bits 156,  Expect = 0.0001
 Identities = 23/80 28%, Positives = 43/80 53%, Gaps = 4/80 5%
Query  26   TCPQIKGNLTPCVLYLKNGGVLPPS--CCKGVRAVNDASRTTSDRQSACNCLKDTAKGIA 83
            TC  +   L PC+ +++ G    PS  CC G + ++  ++T   R  AC C++   K  +
Sbjct  3    TCGTMVRALMPCLPFVQ-GKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYS 61
Query  84   GLNPNLAAGLPGKCGVNIPYKISP 107
             ++  L + +P  CG+ +  K+ P
Sbjct  62   DIDGKLVSEVPKHCGI-VDSKLPP 84

Sequence Alignment: 66. Allergen Name: Par j 1.0101 Sequence ID: CAA54587

 Score = 36.4 bits 150,  Expect = 0.0003
 Identities = 23/79 29%, Positives = 44/79 55%, Gaps = 7/79 8%
Query  34   LTPCVLYLKNGGVLPPS--CCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAA 91
            L PC+ +++ G    PS  CC G + ++  ++T   R  AC C++   K  + ++  L +
Sbjct  5    LMPCLPFVQ-GKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
Query  92   GLPGKCGVNIPYKISP---STNCNNV 114
             +P  CG+ +  K+ P   + +C  V
Sbjct  64   EVPKHCGI-VDSKLPPIDVNMDCKTV 88

Sequence Alignment: 67. Allergen Name: Cas s 8 Sequence ID: 10998016

 Score = 34.2 bits 139,  Expect = 0.0004
 Identities = 19/33 57%, Positives = 26/33 78%, Gaps = 2/33 6%
Query  24   SLTCPQIKGNLTPCVLYLK-NGGVLPP-SCCKGVR 56
            S+TC Q+  +L PC+ YLK NGG  PP +CC+GV+
Sbjct  1    SITCTQVSKSLMPCLTYLKSNGGSPPPGTCCQGVK 35

Sequence Alignment: 68. Allergen Name: Jug r 8.0101 Sequence ID: XP_018816661

 Score = 31.9 bits 126,  Expect = 0.004
 Identities = 28/86 32%, Positives = 48/86 55%, Gaps = 21/86 24%
Query  4    LKLVCAVLLCMMVA-------APVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVR 56
            +K VC VLLC++VA       AP+   ++TC   +  L+PC+  + +      +CC+ +R
Sbjct  1    MKKVCCVLLCVVVAVAVLLSEAPLVAEAVTCNYTE--LSPCLAAIVSPAKPSATCCQKLR 58
Query  57   AVNDASRTTSDRQSACNCLKDTAKGIAG-LNPNLAAGLPGKCGVNIP 102
                        Q  C C+      +   +N   A  +   CGV++P
Sbjct  59   -----------EQKPCLCVYYKNPNLKQYINSPGAKKVASSCGVSLP 94

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.