The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGSLSSLAAAAVFLSLLAVGHCAAADFNATDADADFAGNGWDFNSSDAAVYWGPWTKARA
TWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSCYKIRCTKDQSC
SGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIIDIEFTRVPCEFPG
LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSIWR
LDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQYS
Sequence Info Allergen Name Length Opt Bits Score E Value
AAF72985 Ory s 1 286 2025 396.2 7e-112
AAF72987 Ory s 1 275 1433 283.3 6.7e-78
AAF72984 Ory s 1 268 1301 258.1 2.5e-70
AAF72989 Ory s 1 271 1301 258.1 2.5e-70
AAF72988 Ory s 1 327 1259 250.0 8.2e-68
AAB61710 Ory s 1 261 1228 244.2 3.8e-66
AAD10496 Tri a ps93 271 1093 218.4 2.2e-58
P58738 Zea m 1 269 1042 208.7 1.9e-55
ACA23876 Pas n 1.0101 265 1026 205.6 1.5e-54
AAF72991 Ory s 1 267 992 199.2 1.4e-52
AAF72990 Ory s 1 269 972 195.3 2e-51
A0A4D6G2J8 Uro m 1.0201 229 926 186.6 7.2e-49
AAF72983 Ory s 1 267 927 186.8 7.5e-49
CAB63699 Lol p 1.0103 263 911 183.7 6.1e-48
P43216 Hol l 1 265 906 182.7 1.2e-47
CAA93121 Hol l 1.0102 248 903 182.2 1.6e-47
P43213 Phl p 1 263 899 181.4 3e-47
AAA63279 Lol p 1.0101 263 897 181.0 3.9e-47
CAA10140 Hol l 1 263 896 180.8 4.5e-47
CAA10520 Poa p a 263 893 180.3 6.6e-47
AAA63278 Lol p 1.0102 252 891 179.9 8.2e-47
P14946 Lol p 1 263 891 179.9 8.6e-47
Q41260 Pha a 1 269 880 177.8 3.8e-46
CAA81613 Phl p 1.0101 263 874 176.6 8.2e-46
AAL14079 Cyn d 1.0203 262 869 175.7 1.6e-45
A0A4D6FZ45 Uro m 1.0101 262 869 175.7 1.6e-45
QCX36431 Zoy m 1.0101 272 862 174.3 4.2e-45
O04701 Cyn d 1 246 857 173.4 7.2e-45
AAL14077 Cyn d 1.0202 262 856 173.2 8.8e-45
AAF80379 Cyn d 1.0204 244 848 171.7 2.3e-44
AAK96255 Cyn d 1.0201 244 847 171.5 2.7e-44
AAL14078 Cyn d 1 262 847 171.5 2.9e-44
Q07154 Zea m 1 191 841 170.4 4.4e-44
ABC58726 Sor h 1.0101 239 822 166.7 7.1e-43
AAA50175 Gly m 2 277 786 159.8 9.9e-41
AAF72986 Ory s 1 275 785 159.7 1.1e-40
Q40638 Ory s 1 263 766 156.0 1.3e-39
CAB37496 Ara t expansin 265 427 91.4 3.9e-20
BAA85432 Ory s 1 284 345 75.7 2.2e-15
AAG13596 Ory s 1 275 338 74.4 5.3e-15
CAA10348 Poa p 2 122 189 46.2 7.2e-07
CAA10345 Dac g 2 122 189 46.2 7.2e-07
P43214 Phl p 2 122 189 46.2 7.2e-07
CAA10346 Cyn d 2 122 184 45.2 1.4e-06
P14947 Lol p 2 97 160 40.7 2.5e-05
P93124 Dac g 3 96 149 38.6 0.00011
CAA51775 Lol p 2 88 148 38.4 0.00011
2JNZ_A Phl p 3.0101 108 133 35.5 0.001
AAP80171 Cyn d 15 112 133 35.5 0.0011
Q7M1X8 Dac g 1.0101 34 109 31.3 0.0062
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 396.2 bits 2025,  Expect = 7e-112
 Identities = 286/286 100%, Positives = 286/286 100%, Gaps = 0/286 0%
Query  1    MGSLSSLAAAAVFLSLLAVGHCAAADFNATDADADFAGNGWDFNSSDAAVYWGPWTKARA 60
            MGSLSSLAAAAVFLSLLAVGHCAAADFNATDADADFAGNGWDFNSSDAAVYWGPWTKARA
Sbjct  1    MGSLSSLAAAAVFLSLLAVGHCAAADFNATDADADFAGNGWDFNSSDAAVYWGPWTKARA 60
Query  61   TWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSCYKIRCTKDQSC 120
            TWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSCYKIRCTKDQSC
Sbjct  61   TWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSCYKIRCTKDQSC 120
Query  121  SGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIIDIEFTRVPCEFPG 180
            SGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIIDIEFTRVPCEFPG
Sbjct  121  SGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIIDIEFTRVPCEFPG 180
Query  181  LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSIWR 240
            LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSIWR
Sbjct  181  LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSIWR 240
Query  241  LDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQYS 286
            LDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQYS
Sbjct  241  LDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQYS 286

Sequence Alignment: 2. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 283.3 bits 1433,  Expect = 7e-78
 Identities = 210/270 77%, Positives = 232/270 85%, Gaps = 17/270 6%
Query  1    MGSLSSLAAAAVFLSLLAV-GHCAAADFNATDADADFAGNGWDFNSSDAAVYWGPWTKAR 59
            MG  S +AA    LS+L V G C               G+  ++N SDA+ Y   W  AR
Sbjct  5    MG--SKVAAILAILSVLVVHGSCK--------------GHPVNYNVSDASAYGSGWLPAR 48
Query  60   ATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSCYKIRCTKDQS 119
            ATWYG P GAGPDDNGGACGFK+ NQYPF SMTSCGN+P+FKDGKGCGSCY+IRC KD S
Sbjct  49   ATWYGAPTGAGPDDNGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPS 108
Query  120  CSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIIDIEFTRVPCEFP 179
            CSG  ETVIITDMNYYPVA +HFDLSGTAFG +AKPGLNDKLRHSGIIDI+F RVPC +P
Sbjct  109  CSGNIETVIITDMNYYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYP 168
Query  180  GLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSIW 239
            GLKI FHVEE SNPVYFAVLVEYED DGDVVQVDLMESK+A+G  TG WTPMRESWGSIW
Sbjct  169  GLKINFHVEEGSNPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIW 228
Query  240  RLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQYS 286
            RLD+NHRLQAPFS+RIR++SGKTLVANNVIPANW PN+ YRS VQ+S
Sbjct  229  RLDSNHRLQAPFSLRIRSDSGKTLVANNVIPANWSPNSNYRSIVQFS 275

Sequence Alignment: 3. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 258.1 bits 1301,  Expect = 2e-70
 Identities = 195/260 75%, Positives = 220/260 84%, Gaps = 28/260 10%
Query  3    SLSSLAAAAVFLSLLAVGHCAAA---DFNATDADADFAGNGWDFNSSDAAVYWGP-WTKA 58
            S+S  AA A ++S+L V   A A   +F+A+D  AD                  P W  A
Sbjct  4    SISKKAAVAALFSFLVVTCVAGARPGNFSASDFTAD------------------PNWEVA 45
Query  59   RATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSCYKIRCTKDQ 118
            RATWYG P GAGPDD+GGACGFK+TNQYPF SMTSCGN+P+FKDGKGCGSCY+IRC    
Sbjct  46   RATWYGAPTGAGPDDDGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHP 105
Query  119  SCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIIDIEFTRVPCEF 178
            +CSG  ETVIITDMNYYPV+ +HFDLSGTAFG +AKPG ND+LRH+GIIDI+F RVPC F
Sbjct  106  ACSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNF 165
Query  179  PGLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSI 238
            PGLK+ FHVEE SNPVYFAVLVEYEDGDGDVVQVDLME+ +        WTPMRESWGSI
Sbjct  166  PGLKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEANSQ------SWTPMRESWGSI 219
Query  239  WRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQYS 286
            WRLD+NHRL APFS+RI NESGK LVA+ VIPANW P   YRSFVQYS
Sbjct  220  WRLDSNHRLTAPFSLRITNESGKQLVASQVIPANWAPMAVYRSFVQYS 267

Sequence Alignment: 4. Allergen Name: Ory s 1 Sequence ID: AAF72989

 Score = 258.1 bits 1301,  Expect = 3e-70
 Identities = 177/245 72%, Positives = 207/245 84%, Gaps = 4/245 1%
Query  38   GNGWDFNSSDAAVYWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQ 97
            G G  +N S+A      W  A+ATWYGQPNGAG  DNGGACGFK  NQYPFM MTSCGNQ
Sbjct  26   GEGRWYNESEAIGGAAAWGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQ 85
Query  98   PLFKDGKGCGSCYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGL 157
            PL+K GKGCGSCY++RC ++ +CSG ++TV ITDMNY+P++ +HFDLSG AFGRLAKPG 
Sbjct  86   PLYKGGKGCGSCYRVRCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGR 145
Query  158  NDKLRHSGIIDIEFTRVPCEFPGLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMES 217
             D LR +GIID++F RVPCEFPGLK+GFHVEE S+PVY+AVLVEYE+GDGDV QVDL E+
Sbjct  146  ADDLRRAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEA 205
Query  218  KTAHGPPTGKWTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNT 277
                G   G+WTPMRESWGS+WRLD+NHRL+APFSIRIR++SGKTLVA +VIP NW PNT
Sbjct  206  ----GAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNT 261
Query  278  FYRSFVQYS 286
            FYRSFVQYS
Sbjct  262  FYRSFVQYS 270

Sequence Alignment: 5. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 250.0 bits 1259,  Expect = 8e-68
 Identities = 173/233 74%, Positives = 198/233 84%, Gaps = 4/233 1%
Query  53   GPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSCYKI 112
            G W  ARATWYG PNGAGPDDNGGACGFK+ N  PF +MTSCGN+PLFKDGKGCGSCY+I
Sbjct  90   GGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQI 149
Query  113  RCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIIDIEFT 172
            RC    +CSG  ETVIITDMNYYPV+ +HFDLSGTAFG +AK   ND+LRH+GIIDI+F 
Sbjct  150  RCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQFR 209
Query  173  RVPCEFPGLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTA----HGPPTGKW 228
            RVPC++PGL + FHVE+ SNPVY A+LVEYE+GDGDVVQVDLMES+ +     G PTG W
Sbjct  210  RVPCQYPGLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTGVW 269
Query  229  TPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQY 285
            TPMRESWGSIWRLDTNH LQ PFS+RI NESGKTL+A+ VIPA+W+PNT Y S VQ+
Sbjct  270  TPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSSIVQF 326

Sequence Alignment: 6. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 244.2 bits 1228,  Expect = 4e-66
 Identities = 169/235 71%, Positives = 197/235 83%, Gaps = 1/235 0%
Query  50   VYWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSC 109
            VY   W  A+ATWYGQPNGAGPDDNGGACGFK+TNQYPFMSMTSCGN+PLF+DGKGCG+C
Sbjct  26   VYTNDWLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGAC 85
Query  110  YKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIIDI 169
            Y+IRCT + SCSG+  TVIITDMNYYPVA +HFDLSGTAFG +A+PGLND+LRH+GIIDI
Sbjct  86   YQIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDI 145
Query  170  EFTRVPCEFPGLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWT 229
            +F RVPC   GL + FHVE  SNPVY+AVLVE+ + DG VVQ+D+MES    G PT  WT
Sbjct  146  QFRRVPCYHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMES-LPSGKPTRVWT 204
Query  230  PMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQY 285
            PMR SWGSIWRLD NHRLQ P S+R+ +ESG+T++A+ VIPANWR NT Y S VQ+
Sbjct  205  PMRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQF 260

Sequence Alignment: 7. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 218.4 bits 1093,  Expect = 2e-58
 Identities = 147/242 60%, Positives = 192/242 79%, Gaps = 4/242 1%
Query  42   DFNSSDAAVYWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFK 101
            +++++ A  Y   W  A+ATWYG PNGAGPDDNGGACGFK+ NQYP  SM +CGN+P+F 
Sbjct  27   NYDTAVARSYTSGWLPAKATWYGAPNGAGPDDNGGACGFKNVNQYPISSMGACGNEPIFA 86
Query  102  DGKGCGSCYKIRC--TKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLND 159
             G+GCG CY+I+C  + + SCSG+   ++ITDMNYYPVA +H+DLSGTAFG +AK GLND
Sbjct  87   GGEGCGMCYEIKCEYSNNPSCSGQPRRIVITDMNYYPVARYHLDLSGTAFGSMAKYGLND 146
Query  160  KLRHSGIIDIEFTRVPCEFPGLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKT 219
            +LRH+GIID++F RVPC FPG+K+ FHV+  SNP Y+AVLVEY + DG VV+++LM+  T
Sbjct  147  RLRHAGIIDMQFRRVPCNFPGMKVTFHVQRGSNPNYLAVLVEYVNVDGTVVRMELMQ--T 204
Query  220  AHGPPTGKWTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFY 279
             +G PTG W  MR SWGS+WR+DTN  +Q PFSIRI +++GKTLVANN IPA W+ +  Y
Sbjct  205  MNGRPTGYWQDMRRSWGSVWRMDTNRPVQGPFSIRITSDTGKTLVANNAIPAYWQQDHAY 264
Query  280  RSFVQY 285
             S +Q+
Sbjct  265  WSNLQF 270

Sequence Alignment: 8. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 208.7 bits 1042,  Expect = 2e-55
 Identities = 152/265 57%, Positives = 196/265 73%, Gaps = 23/265 8%
Query  1    MGSLSS--LAAAAVFLSLLAVGHCAAADFNATDADADFAGNGWDFNSSDAAVYWGPWTKA 58
            MGSL +  +   AV+ +L+A G C                 G +  ++    Y G W  A
Sbjct  1    MGSLVNNIMVVGAVLAALVAGGSCGPPKVPP----------GPNITTN----YNGKWLTA 46
Query  59   RATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSCYKIRCTKDQ 118
            RATWYGQPNGAG  DNGGACG K+ N  P+  MT+CGN P+FKDGKGCGSCY++RC +  
Sbjct  47   RATWYGQPNGAGAPDNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKP 106
Query  119  SCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIIDIEFTRVPCEF 178
             CSG   TV ITDMNY P+AP+HFDLSG AFG LAKPGLNDK+RH GI+D+EF RV C++
Sbjct  107  ECSGNPVTVYITDMNYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKY 166
Query  179  P-GLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGS 237
            P G KI FH+E+  NP Y+AVLV+Y   DGD+V +++ +  +A      +W PM+ SWG+
Sbjct  167  PAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSA------EWKPMKLSWGA 220
Query  238  IWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQY 285
            IWR+DT   L+ PFSIR+ +ESGK ++A +VIPANWRP+  Y S VQ+
Sbjct  221  IWRMDTAKALKGPFSIRLTSESGKKVIAKDVIPANWRPDAVYTSNVQF 268

Sequence Alignment: 9. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 205.6 bits 1026,  Expect = 2e-54
 Identities = 155/263 58%, Positives = 197/263 74%, Gaps = 24/263 9%
Query  1    MGSLSSLAA-AAVFLSLLAVGHCAAADFNATDADADFAGNGWDFNSSDAAVYWGPWTKAR 59
            MGSL+ + A AAV+ +L+A G C                 G +  ++    Y G W  A+
Sbjct  1    MGSLAKIVAVAAVLAALVAGGSCGPPKVPP----------GPNITTN----YNGKWLPAK 46
Query  60   ATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSCYKIRCTKDQS 119
            ATWYGQPNGAGPDDNGGACG K+ N  P+   T+CGN P+FKDGKGCGSCY+IRC K + 
Sbjct  47   ATWYGQPNGAGPDDNGGACGIKNVNLPPYNGFTACGNPPIFKDGKGCGSCYEIRCNKPE- 105
Query  120  CSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIIDIEFTRVPCEFP 179
            CSG+  TV ITDMNY P+AP+HFDLSG AFG +AKPGLNDKLRH GI D+EF RV C++ 
Sbjct  106  CSGQPVTVFITDMNYEPIAPYHFDLSGKAFGAMAKPGLNDKLRHYGIFDLEFRRVRCKYQ 165
Query  180  G-LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSI 238
            G  KI FHVE+ SNP Y+A+LV++   DGD+V ++L E  +        W PM+ SWG+I
Sbjct  166  GGQKIVFHVEKGSNPNYLAMLVKFVADDGDIVLMELKEKSS-------DWKPMKLSWGAI 218
Query  239  WRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQY 285
            WR+DT   L  PFSIR+ +ESGK ++A +VIP NW+P+T Y S VQ+
Sbjct  219  WRMDTPKALVPPFSIRLTSESGKKVIAQDVIPVNWKPDTVYNSNVQF 265

Sequence Alignment: 10. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 199.2 bits 992,  Expect = 1e-52
 Identities = 131/230 56%, Positives = 177/230 76%, Gaps = 7/230 3%
Query  49   AVYWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGS 108
            A Y   W +AR TWYG+P GAGPDDNGGACG+K  ++ PF+ M SCGN P+FKDGKGCGS
Sbjct  35   AAYGKQWLEARGTWYGKPKGAGPDDNGGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGS 94
Query  109  CYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIID 168
            C++++C+K ++CS +   + ITDMN  P+A +HFDLSG AFG +AK G +++LR +GIID
Sbjct  95   CFEVKCSKPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIID 154
Query  169  IEFTRVPCEFPG-LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGK 227
            ++F RV C++PG  K+ FHVE+ SNP YFAVLV+Y  GDGDVV+V+L E  +       +
Sbjct  155  MQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELKEKGSE------E 208
Query  228  WTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQ 284
            W P+ ESWG+IWR+DT   L+ PFS+R+  ES + LVAN+VIP NW+ N +Y+S +Q
Sbjct  209  WKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDVIPDNWKANALYKSEIQ 265

Sequence Alignment: 11. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 195.3 bits 972,  Expect = 2e-51
 Identities = 143/265 53%, Positives = 191/265 72%, Gaps = 23/265 8%
Query  1    MGSLSS--LAAAAVFLSLLAVGHCAAADFNATDADADFAGNGWDFNSSDAAVYWGPWTKA 58
            MGSL++  + A AV  +L+  G C                 G +  ++    Y  PW  A
Sbjct  1    MGSLTTNIVLAVAVVAALVGGGSCGPPKVPP----------GPNITTN----YNAPWLPA 46
Query  59   RATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSCYKIRCTKDQ 118
            RATWYGQP G+G  DNGGACG K+ N  P+  M SCGN P+FKDG+GCGSCY+++C +  
Sbjct  47   RATWYGQPYGSGSTDNGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPA 106
Query  119  SCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIIDIEFTRVPCEF 178
            +CS +  TV ITDMNY P++ +HFD+SG AFG +A PG   +LR +GIID++F RV C++
Sbjct  107  ACSKQPVTVFITDMNYEPISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKY 166
Query  179  PG-LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGS 237
            PG  K+ FHVE+ SNP Y+AVLV++   DGDV+Q+DL E+    G P   W PM+ SWG+
Sbjct  167  PGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEA----GLPA--WRPMKLSWGA 220
Query  238  IWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQY 285
            IWR+DT   L+APFSIR+  ESGK+L+A +VIP NW P+  Y S VQ+
Sbjct  221  IWRMDTATPLKAPFSIRVTTESGKSLIAKDVIPVNWMPDAIYVSNVQF 268

Sequence Alignment: 12. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 186.6 bits 926,  Expect = 7e-49
 Identities = 122/227 53%, Positives = 166/227 73%, Gaps = 7/227 3%
Query  53   GPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSCYKI 112
            G W  A+ATWYG+P GAGPDDNGGACG+K  N+ PF SM +CGN P+FKDG GCGSCY+I
Sbjct  2    GKWLDAKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNPPIFKDGLGCGSCYEI 61
Query  113  RCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIIDIEFT 172
            +C K   CSG    V ITD NY P+A +HFDL+GTAFG +AK G  +KLR +GIID++F 
Sbjct  62   KCDKPAECSGEPVIVHITDQNYEPIAAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQFR 121
Query  173  RVPCEFPG-LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPM 231
            RV C++P   KI FHVE+  NP YFA+L++Y  GDGD+V VD+ E  +       ++ P+
Sbjct  122  RVKCKYPANTKIAFHVEKGCNPNYFALLIKYAAGDGDIVAVDIKEKGSE------EFIPL 175
Query  232  RESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQY 285
            + SWG+IWR+D+   ++ P ++R+ +E G TLV ++ IP  W+ +T Y S +Q+
Sbjct  176  KHSWGAIWRIDSPKPIKGPIAVRLTSEGGTTLVQDDAIPEGWKADTVYTSKLQF 229

Sequence Alignment: 13. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 186.8 bits 927,  Expect = 8e-49
 Identities = 119/228 52%, Positives = 170/228 74%, Gaps = 7/228 3%
Query  51   YWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSCY 110
            Y   W +A+ATWYG P GAGP DNGGACG+K  ++ PF+ M SCGN P+FKDGKGCGSC+
Sbjct  37   YGDKWLEAKATWYGAPKGAGPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCF 96
Query  111  KIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIIDIE 170
            +I+C+K ++CS +   + +TDMN  P+A +HFDLSG AFG +AK G +++LR +GIID +
Sbjct  97   EIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQ 156
Query  171  FTRVPCEFPG-LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWT 229
            F RV C++P   KI FH+E+ SNP Y+A+LV+Y  GDGDVV+V++ E  +       +W 
Sbjct  157  FRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSE------EWK 210
Query  230  PMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQ 284
             ++ESWG+IWR+DT   L+ PFS+R+  E G+ ++A + IP  W+ ++ Y+S VQ
Sbjct  211  ALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDAIPDGWKADSVYKSNVQ 265

Sequence Alignment: 14. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 183.7 bits 911,  Expect = 6e-48
 Identities = 123/225 54%, Positives = 162/225 72%, Gaps = 7/225 3%
Query  49   AVYWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGS 108
            A Y   W  A++TWYG+P GAGP DNGGACG+K  ++ PF  MT CGN P+FKDG+GCGS
Sbjct  35   AEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGS 94
Query  109  CYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIID 168
            C++I+CTK +SCSG + TV ITD N  P+AP+HFDLSG AFG +AK G   KLR +G ++
Sbjct  95   CFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELE 154
Query  169  IEFTRVPCEFP-GLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGK 227
            ++F RV C++P G K  FHVE+ SNP Y+A+LV+Y DGDGDVV VD+ E     G    K
Sbjct  155  LQFRRVKCKYPDGTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEK----GKD--K 208
Query  228  WTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFY 279
            W  ++ESWG++WR+DT  +L  PF++R   E G      +VIP  W+ +T Y
Sbjct  209  WIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSY 260

Sequence Alignment: 15. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 182.7 bits 906,  Expect = 1e-47
 Identities = 124/227 54%, Positives = 163/227 71%, Gaps = 7/227 3%
Query  49   AVYWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGS 108
            A Y   W  A++TWYG+P GAGP DNGGACG+K  ++ PF  MT CGN P+FKDG+GCGS
Sbjct  37   ATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGS 96
Query  109  CYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIID 168
            C++I+CTK +SCSG   TV ITD N  P+AP+HFDLSG AFG +AK G   KLR +G ++
Sbjct  97   CFEIKCTKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELE 156
Query  169  IEFTRVPCEFP-GLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGK 227
            ++F RV C++P G K  FHVE+ SNP Y+A+LV+Y DGDGDVV VD+ E     G    K
Sbjct  157  LKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEK----GK--DK 210
Query  228  WTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRS 281
            W  ++ESWG++WR+DT  +L  PF++R   E G    A +VIP  W+ +T Y +
Sbjct  211  WIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEA 264

Sequence Alignment: 16. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 182.2 bits 903,  Expect = 2e-47
 Identities = 123/227 54%, Positives = 163/227 71%, Gaps = 7/227 3%
Query  49   AVYWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGS 108
            A Y   W  A++TWYG+P GAGP DNGGACG+K  ++ PF  MT CGN P+FKDG+GCGS
Sbjct  20   ATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGS 79
Query  109  CYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIID 168
            C++I+C+K +SCSG   TV ITD N  P+AP+HFDLSG AFG +AK G   KLR +G ++
Sbjct  80   CFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELE 139
Query  169  IEFTRVPCEFP-GLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGK 227
            ++F RV C++P G K  FHVE+ SNP Y+A+LV+Y DGDGDVV VD+ E     G    K
Sbjct  140  LKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEK----GK--DK 193
Query  228  WTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRS 281
            W  ++ESWG++WR+DT  +L  PF++R   E G    A +VIP  W+ +T Y +
Sbjct  194  WIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEA 247

Sequence Alignment: 17. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 181.4 bits 899,  Expect = 3e-47
 Identities = 122/227 53%, Positives = 162/227 71%, Gaps = 7/227 3%
Query  49   AVYWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGS 108
            A Y   W  A++TWYG+P GAGP DNGGACG+K  ++ PF  MT CGN P+FK G+GCGS
Sbjct  35   ATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGS 94
Query  109  CYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIID 168
            C++I+CTK ++CSG    V ITD N  P+AP+HFDLSG AFG +AK G   KLR +G ++
Sbjct  95   CFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELE 154
Query  169  IEFTRVPCEFP-GLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGK 227
            ++F RV C++P G K+ FHVE+ SNP Y+A+LV+Y +GDGDVV VD+ E     G    K
Sbjct  155  LQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKEK----GK--DK 208
Query  228  WTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRS 281
            W  ++ESWG+IWR+DT  +L  PF++R   E G    A +VIP  W+ +T Y S
Sbjct  209  WIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYES 262

Sequence Alignment: 18. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 181.0 bits 897,  Expect = 4e-47
 Identities = 121/225 53%, Positives = 162/225 72%, Gaps = 7/225 3%
Query  49   AVYWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGS 108
            A Y   W  A++TWYG+P GAGP DNGGACG+K+ ++ PF  MT CGN P+FKDG+GCGS
Sbjct  35   AEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGS 94
Query  109  CYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIID 168
            C++I+CTK +SCSG + TV ITD N  P+AP+HFDLSG AFG +AK G    +R +G ++
Sbjct  95   CFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELE 154
Query  169  IEFTRVPCEFPG-LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGK 227
            ++F RV C++P   K  FHVE+ SNP Y+A+LV+Y DGDGDVV VD+ E     G    K
Sbjct  155  LQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEK----GKD--K 208
Query  228  WTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFY 279
            WT ++ESWG++WR+DT  +L  PF++R   E G      +VIP  W+ +T Y
Sbjct  209  WTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSY 260

Sequence Alignment: 19. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 180.8 bits 896,  Expect = 4e-47
 Identities = 122/227 53%, Positives = 162/227 71%, Gaps = 7/227 3%
Query  49   AVYWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGS 108
            A Y   W  A++TWYG+P GAGP DNGGACG+K  ++ PF  MT CGN P+FK G+GCGS
Sbjct  35   ATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGS 94
Query  109  CYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIID 168
            C++I+CTK +SCSG    V ITD N  P+A +H+DLSG AFG +AK G   KLR +G ++
Sbjct  95   CFEIKCTKPESCSGEPIVVHITDDNEEPIAAYHLDLSGKAFGAMAKKGEEQKLRSAGELE 154
Query  169  IEFTRVPCEFP-GLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGK 227
            ++F RV CE+P G K+ FHVE+ SNP Y+A+LV+Y DGDGDVV VD+ E     G    K
Sbjct  155  LKFRRVKCEYPKGTKVTFHVEKGSNPNYLALLVKYVDGDGDVVAVDIKEK----GK--DK 208
Query  228  WTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRS 281
            W  ++ESWG++WR+DT  +L  PF++R   E G  + A +VIP  W+ +T Y S
Sbjct  209  WIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKVEAEDVIPEGWKADTAYES 262

Sequence Alignment: 20. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 180.3 bits 893,  Expect = 7e-47
 Identities = 124/227 54%, Positives = 160/227 70%, Gaps = 7/227 3%
Query  49   AVYWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGS 108
            A Y   W  A++TWYG+P GAGP DNGGACG+K  ++ PF  MT CGN P+FK G+GCGS
Sbjct  35   ATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFSGMTGCGNTPIFKSGRGCGS 94
Query  109  CYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIID 168
            C++I+CTK +SCSG    V ITD N  P+A +HFDLSG AFG +AK G   KLR +G ++
Sbjct  95   CFEIKCTKPESCSGEPVLVHITDDNEEPIAAYHFDLSGKAFGAMAKKGEEQKLRSAGELE 154
Query  169  IEFTRVPCEFP-GLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGK 227
            ++F RV CE+P G K+ FHVE+ SNP Y+A+LV+Y  GDGDVV VD+ E     G    K
Sbjct  155  LKFRRVKCEYPEGTKVTFHVEKGSNPNYLALLVKYVTGDGDVVAVDIKEK----GK--DK 208
Query  228  WTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRS 281
            W  ++ESWGSIWR+DT  +L  PF++R   E G    A +VIP  W+ +T Y S
Sbjct  209  WIELKESWGSIWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYAS 262

Sequence Alignment: 21. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 179.9 bits 891,  Expect = 8e-47
 Identities = 120/225 53%, Positives = 160/225 71%, Gaps = 7/225 3%
Query  49   AVYWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGS 108
            A Y   W  A++TWYG+P GAGP DNGGACG+K  ++ PF  MT CGN P+FKDG+GCGS
Sbjct  24   AEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGS 83
Query  109  CYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIID 168
            C++I+CTK +SCSG + TV ITD N  P+AP+HFDLSG AFG +AK G    +R +G ++
Sbjct  84   CFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELE 143
Query  169  IEFTRVPCEFPG-LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGK 227
            ++F RV C++P   K  FHVE+ SNP Y+A+LV+Y DGDGDVV VD+ E     G    K
Sbjct  144  LQFRRVKCKYPDDTKPTFHVEKGSNPNYLAILVKYVDGDGDVVAVDIKEK----GKD--K 197
Query  228  WTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFY 279
            W  ++ESWG++WR+DT  +L  PF++R   E G      +VIP  W+ +T Y
Sbjct  198  WIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSY 249

Sequence Alignment: 22. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 179.9 bits 891,  Expect = 9e-47
 Identities = 120/225 53%, Positives = 161/225 71%, Gaps = 7/225 3%
Query  49   AVYWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGS 108
            A Y   W  A++TWYG+P GAGP DNGGACG+K+ ++ PF  MT CGN P+FKDG+GCGS
Sbjct  35   AEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGS 94
Query  109  CYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIID 168
            C++I+CTK +SCSG + TV ITD N  P+AP+HFDLSG AFG +AK G    +R +G ++
Sbjct  95   CFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELE 154
Query  169  IEFTRVPCEFPG-LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGK 227
            ++F RV C++P   K  FHVE+ SNP Y+A+LV+Y DGDGDVV VD+ E     G    K
Sbjct  155  LQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEK----GKD--K 208
Query  228  WTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFY 279
            W  ++ESWG++WR+DT  +L  PF++R   E G      +VIP  W+ +T Y
Sbjct  209  WIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSY 260

Sequence Alignment: 23. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 177.8 bits 880,  Expect = 4e-46
 Identities = 118/223 52%, Positives = 159/223 71%, Gaps = 7/223 3%
Query  49   AVYWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGS 108
            A Y   W  A++TWYG+P GAGP DNGGACG+K  ++ PF  MT CGN P+FKDG+GCGS
Sbjct  41   AEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGS 100
Query  109  CYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIID 168
            C++++C+K +SCSG   TV ITD N  P+AP+HFDLSG AFG +AK G  + +R +G ++
Sbjct  101  CFELKCSKPESCSGEPITVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEENVRGAGELE 160
Query  169  IEFTRVPCEFP-GLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGK 227
            ++F RV C++P G K  FHVE+ SNP Y+A+LV+Y DGDGDVV VD+ E          K
Sbjct  161  LQFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYVDGDGDVVAVDIKEKGK------DK 214
Query  228  WTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNT 277
            W  ++ESWG+IWR+DT  +L  PF++R   E G      +VIP  W+ +T
Sbjct  215  WIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKAEFEDVIPEGWKADT 264

Sequence Alignment: 24. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 176.6 bits 874,  Expect = 8e-46
 Identities = 120/227 52%, Positives = 159/227 70%, Gaps = 7/227 3%
Query  49   AVYWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGS 108
            A Y   W  A++TWYG+P  AGP DNGGACG+K  ++ PF  MT CGN P+FK G+GCGS
Sbjct  35   ATYGDKWLDAKSTWYGKPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGS 94
Query  109  CYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIID 168
            C++I+CTK ++CSG    V ITD N  P+A +HFDLSG AFG +AK G   KLR +G ++
Sbjct  95   CFEIKCTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSAGEVE 154
Query  169  IEFTRVPCEFP-GLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGK 227
            I+F RV C++P G K+ FHVE+ SNP Y+A+LV++  GDGDVV VD+ E     G    K
Sbjct  155  IQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVDIKEK----GK--DK 208
Query  228  WTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRS 281
            W  ++ESWG+IWR+DT   L+ PF++R   E G    A +VIP  W+ +T Y S
Sbjct  209  WIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVIPEGWKADTAYES 262

Sequence Alignment: 25. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 175.7 bits 869,  Expect = 2e-45
 Identities = 122/231 52%, Positives = 169/231 73%, Gaps = 8/231 3%
Query  49   AVYWGPWTKARATWYGQ-PNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCG 107
            A Y   W  A+AT+YG  P GA PDD+GGACG+K  ++ PF SMT CGN+P+FKDG GCG
Sbjct  30   ATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDSMTGCGNEPIFKDGLGCG 89
Query  108  SCYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGII 167
            SCY+I+C +   CSG    + ITD NY  +A +HFDLSG AFG +AK G  DKLR +G +
Sbjct  90   SCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGEL 149
Query  168  DIEFTRVPCEFPG-LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTG 226
             ++F RV CE+P   KI FHVE+ SNP Y+A+LV+Y  GDG++V VD+ +SK   G  + 
Sbjct  150  MLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDI-KSK---G--SD 203
Query  227  KWTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQY 285
            ++ PM++SWG+IWR+D    L+ PF+IR+ +ESG  +   +VIP +W+P+T Y+S +Q+
Sbjct  204  EFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 26. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 175.7 bits 869,  Expect = 2e-45
 Identities = 122/231 52%, Positives = 169/231 73%, Gaps = 8/231 3%
Query  49   AVYWGPWTKARATWYGQ-PNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCG 107
            A Y   W  A+AT+YG  P GA PDD+GGACG+K  ++ PF SMT CGN+P+FKDG GCG
Sbjct  30   ATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDSMTGCGNEPIFKDGLGCG 89
Query  108  SCYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGII 167
            SCY+I+C +   CSG    + ITD NY  +A +HFDLSG AFG +AK G  DKLR +G +
Sbjct  90   SCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGEL 149
Query  168  DIEFTRVPCEFPG-LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTG 226
             ++F RV CE+P   KI FHVE+ SNP Y+A+LV+Y  GDG++V VD+ +SK   G  + 
Sbjct  150  MLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDI-KSK---G--SD 203
Query  227  KWTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQY 285
            ++ PM++SWG+IWR+D    L+ PF+IR+ +ESG  +   +VIP +W+P+T Y+S +Q+
Sbjct  204  EFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 27. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 174.3 bits 862,  Expect = 4e-45
 Identities = 121/229 52%, Positives = 163/229 71%, Gaps = 12/229 5%
Query  49   AVYWGPWTKARATWYGQ-PNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCG 107
            A Y   W  A+AT+YG  P GA PDD+GGACG+K+ ++ PF  MT CGN+P+FKDG GCG
Sbjct  40   ATYNEEWQDAKATFYGSNPRGAAPDDDGGACGYKNVDKAPFFGMTGCGNEPIFKDGLGCG 99
Query  108  SCYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGII 167
            SC++I+C +   CS +   + ITD NY  +A +HFDLSG AFG +AK G  D LR +G +
Sbjct  100  SCFEIKCKEPAECSDKPVLIRITDKNYEHIAAYHFDLSGKAFGSMAKQGQEDNLRKAGEL 159
Query  168  DIEFTRVPCEFPG-LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTG 226
             ++F RV CE+P   KI FHVE+  N  Y+A+LVEY  GDGD+V VD+         P G
Sbjct  160  TLQFRRVKCEYPSKTKITFHVEKGCNDNYLALLVEYAAGDGDIVAVDI--------KPKG 211
Query  227  --KWTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQ 284
              ++ PM+ SWG+IWR+D    L+ PF++R+ +ESG  LV  +VIPA+W+PNT Y S +Q
Sbjct  212  SDEFLPMKPSWGAIWRIDPKKPLKGPFTVRLTSESGAKLVQEDVIPADWKPNTAYTSNLQ 271
Query  285  Y 285
            Y
Sbjct  272  Y 272

Sequence Alignment: 28. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 173.4 bits 857,  Expect = 7e-45
 Identities = 120/231 51%, Positives = 165/231 71%, Gaps = 8/231 3%
Query  49   AVYWGPWTKARATWYGQ-PNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCG 107
            A Y   W +ARAT+YG  P GA PDD+GGACG+K  ++ PF  MT+CGN+P+FKDG GC 
Sbjct  12   ATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFKDGLGCR 71
Query  108  SCYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGII 167
            +CY+I+C +   CSG    V ITD NY  +A +HFDLSG AFG +AK G  DKLR +G +
Sbjct  72   ACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKLRKAGEL 131
Query  168  DIEFTRVPCEFP-GLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTG 226
             ++F RV C++P G KI FH+E+ SN  Y+A+LV+Y  GDG++V VD+    +       
Sbjct  132  TLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDS------D 185
Query  227  KWTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQY 285
            ++ PM+ SWG+IWR+D    L+ PFSIR+ +E G  LV ++VIPANW+P+T Y S +Q+
Sbjct  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQF 244

Sequence Alignment: 29. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 173.2 bits 856,  Expect = 9e-45
 Identities = 120/231 51%, Positives = 167/231 72%, Gaps = 8/231 3%
Query  49   AVYWGPWTKARATWYGQ-PNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCG 107
            A Y   W  A+AT+YG  P GA PDD+GGACG+K  ++ PF  MT CGN+P+FKDG  CG
Sbjct  30   ATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACG 89
Query  108  SCYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGII 167
            SCY+I+C +   CSG    + ITD NY  +A +HFDLSG AFG +AK G  DKLR +G +
Sbjct  90   SCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGEL 149
Query  168  DIEFTRVPCEFPG-LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTG 226
             ++F RV CE+P   KI FHVE+ SNP Y+A+LV+Y  GDG++V VD+ +SK   G  + 
Sbjct  150  MLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDI-KSK---G--SD 203
Query  227  KWTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQY 285
            ++ PM++SWG+IWR+D    L+ PF+IR+ +ESG  +   +VIP +W+P+T Y+S +Q+
Sbjct  204  EFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 30. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 171.7 bits 848,  Expect = 2e-44
 Identities = 118/229 51%, Positives = 165/229 72%, Gaps = 12/229 5%
Query  49   AVYWGPWTKARATWYGQ-PNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCG 107
            A Y   W  A+AT+YG  P GA PDD+GGACG+K  ++ PF  MT CGN+P+FKDG  CG
Sbjct  12   ATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACG 71
Query  108  SCYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGII 167
            SCY+I+C +   CSG    + ITD NY  +A +HFDLSG AFG +AK G  DKLR +G +
Sbjct  72   SCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGEL 131
Query  168  DIEFTRVPCEFPG-LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTG 226
             ++F RV CE+P   KI FHVE+ S+P Y+A+LV+Y  GDG++V VD+         P G
Sbjct  132  MLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDI--------KPKG 183
Query  227  --KWTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQ 284
              ++ PM++SWG+IWR+D    L+ PF+IR+ +ESG  +  ++VIP +W+P+T Y+S +Q
Sbjct  184  SDEFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQ 243
Query  285  Y 285
            +
Sbjct  244  F 244

Sequence Alignment: 31. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 171.5 bits 847,  Expect = 3e-44
 Identities = 118/229 51%, Positives = 165/229 72%, Gaps = 12/229 5%
Query  49   AVYWGPWTKARATWYGQ-PNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCG 107
            A Y   W  A+AT+YG  P GA PDD+GGACG+K  ++ PF  MT CGN+P+FKDG  CG
Sbjct  12   ATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACG 71
Query  108  SCYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGII 167
            SCY+I+C +   CSG    + ITD NY  +A +HFDLSG AFG +AK G  DKLR +G +
Sbjct  72   SCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGEL 131
Query  168  DIEFTRVPCEFPG-LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTG 226
             ++F RV CE+P   KI FHVE+ S+P Y+A+LV+Y  GDG++V VD+         P G
Sbjct  132  MLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDI--------KPKG 183
Query  227  --KWTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQ 284
              ++ PM++SWG+IWR+D    L+ PF+IR+ +ESG  +  ++VIP +W+P+T Y+S +Q
Sbjct  184  SDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQ 243
Query  285  Y 285
            +
Sbjct  244  F 244

Sequence Alignment: 32. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 171.5 bits 847,  Expect = 3e-44
 Identities = 123/244 50%, Positives = 168/244 68%, Gaps = 17/244 6%
Query  34   ADFAGNGW----DFNSSD-AAVYWGPWTKARATWYGQ-PNGAGPDDNGGACGFKHTNQYP 87
            A   G  W    D    +  A Y   W  A+AT+YG  P GA PDD+GGACG+K  ++ P
Sbjct  10   ASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAP 69
Query  88   FMSMTSCGNQPLFKDGKGCGSCYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGT 147
            F  MT CGN+P+FKDG GCGSCY+I+C +   CSG    + ITD NY  +A +HFDLSG 
Sbjct  70   FDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGK 129
Query  148  AFGRLAKPGLNDKLRHSGIIDIEFTRVPCEFPG-LKIGFHVEEYSNPVYFAVLVEYEDGD 206
            AFG +AK G  DKLR +G + ++F RV CE+P   KI FHVE+ S+P Y+A+LV+Y  GD
Sbjct  130  AFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGD 189
Query  207  GDVVQVDLMESKTAHGPPTGK--WTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLV 264
            G++V VD+         P G   + PM+ SWG+IWR+D    L+ PF+IR+ +ESG  + 
Sbjct  190  GNIVGVDI--------KPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVE 241
Query  265  ANNVIPANWRPNTFYRSFVQY 285
              +VIP +W+P+T Y+S +Q+
Sbjct  242  QEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 33. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 170.4 bits 841,  Expect = 4e-44
 Identities = 114/189 60%, Positives = 148/189 78%, Gaps = 7/189 3%
Query  91   MTSCGNQPLFKDGKGCGSCYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFG 150
            MT+CGN P+FKDGKGCGSCY++RC +   CSG   TV ITDMNY P+AP+HFDLSG AFG
Sbjct  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
Query  151  RLAKPGLNDKLRHSGIIDIEFTRVPCEFP-GLKIGFHVEEYSNPVYFAVLVEYEDGDGDV 209
             LAKPGLNDKLRH GI+D+EF RV C++P G KI FH+E+  NP Y AVLV++   DGD+
Sbjct  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
Query  210  VQVDLMESKTAHGPPTGKWTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVI 269
            V +++ +  +A      +W PM+ SWG+IWR+DT   L+ PFSIR+ +ESGK ++A ++I
Sbjct  121  VLMEIQDKLSA------EWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDII 174
Query  270  PANWRPNTFYRSFVQY 285
            PANWRP+  Y S VQ+
Sbjct  175  PANWRPDAVYTSNVQF 190

Sequence Alignment: 34. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 166.7 bits 822,  Expect = 7e-43
 Identities = 115/221 52%, Positives = 158/221 71%, Gaps = 10/221 4%
Query  51   YWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSCY 110
            Y   W + +ATWYG+P GAGPDDNGGACG+K  N+ PF SM +CGN P+FKDG  CGSC+
Sbjct  14   YGSDWLERKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNLPIFKDGL-CGSCF 72
Query  111  KIRCTKDQS--CSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIID 168
            +I+C K +   CSG +  V ITDMNY  +A +HFDL+G AFG +AK G  +KL  +GIID
Sbjct  73   EIKCDKPKPAECSGEAVVVHITDMNYEQIAAYHFDLAGHAFGAMAKKGQEEKLAKAGIID 132
Query  169  IEFTRVPCEFPGLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKW 228
            ++F RV C++ G K+ FHVE+ SNP Y+A+LV+Y DGDGD+V VD+ E     G     +
Sbjct  133  MKFRRVKCKY-GEKVTFHVEKGSNPNYLALLVKYVDGDGDIVGVDIKEK----GGDA--Y 185
Query  229  TPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFY 279
             P++ SWG+IWR D+   ++ P +++I  E G     ++VIP  W+ +T Y
Sbjct  186  QPLKHSWGAIWRKDSPDPIKFPVTVQITTEGGTKTAYDDVIPEGWKADTTY 236

Sequence Alignment: 35. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 159.8 bits 786,  Expect = 1e-40
 Identities = 116/231 50%, Positives = 160/231 69%, Gaps = 15/231 6%
Query  49   AVYWGP----WTKARATWYGQPNGAGPDDNGGACGFKHT-NQYPFMSMTSCGNQPLFKDG 103
            A Y+ P    W+ A ATWYG  NG G +  GGACG+ +   Q PF S+ S G+  ++  G
Sbjct  38   ASYYSPSSSDWSPAVATWYGPANGDGSE--GGACGYGNAVGQPPFSSLISAGSPLIYDSG 95
Query  104  KGCGSCYKIRCTKDQSCSGRSETVIITD--MNYYPVAPFHFDLSGTAFGRLAKPGLNDKL 161
            KGCGSCY+++CT + +CSG    V+ITD        A +HFDLSG AFG +A  G ++ L
Sbjct  96   KGCGSCYEVKCTGNSACSGNPVKVVITDECAGCGSDAQYHFDLSGNAFGAMAISGQDENL 155
Query  162  RHSGIIDIEFTRVPCEFPGLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAH 221
            R++G I+I+  R+ C +PG  I FHV+  SN  YFA LVEYEDGDGD+ +V+L E+    
Sbjct  156  RNAGKINIQHRRIECNYPGRSIAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALD-- 213
Query  222  GPPTGKWTPMRESWGSIWRLDTNHRLQAPFSIRIRN-ESGKTLVANNVIPANWRPNTFYR 280
               +G W  M++SWG++W++D    L+APFSI++   ESG+T+VANNVIPA W P   YR
Sbjct  214  ---SGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLTTLESGQTIVANNVIPAGWTPGQTYR 270
Query  281  SFVQYS 286
            S V ++
Sbjct  271  SIVNFA 276

Sequence Alignment: 36. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 159.7 bits 785,  Expect = 1e-40
 Identities = 114/224 50%, Positives = 157/224 70%, Gaps = 14/224 6%
Query  55   WTKARATWYGQPNGAGPDDNGGACGFKHT-NQYPFMSMTSCGNQPLFKDGKGCGSCYKIR 113
            W+   ATWYG P G G +  GGACG++    Q PF SM + G   LFK+GKGCGSCY+I+
Sbjct  45   WSSGGATWYGGPQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIK 102
Query  114  CTKDQSCSGRSETVIITDMNYYPVA---PFHFDLSGTAFGRLAKPGLNDKLRHSGIIDIE 170
            CT +++CSGR  TV+ITD     V      HFD+SGTAFG +A  G+ D+LR +G++ I+
Sbjct  103  CTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQ 162
Query  171  FTRVPCEFPGLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTP 230
            + RVPC F  + + F V+  SNP Y+A+LV+Y +GDGD+  V +M+++   G     W  
Sbjct  163  YKRVPCRF-AMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGG-----WKA 216
Query  231  MRESWGSIWRLDTN--HRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQYS 286
            M++SWG+ WRL++N    L  PFSIR+ + SGK LVANNVIP+ W+    YRS V Y+
Sbjct  217  MQQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNYA 274

Sequence Alignment: 37. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 156.0 bits 766,  Expect = 1e-39
 Identities = 104/211 49%, Positives = 149/211 70%, Gaps = 10/211 4%
Query  51   YWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSCY 110
            Y   W +AR     +P    P DNGGACG+K  ++ PF+ M SCGN P+FKDGKGCGSC+
Sbjct  37   YGDKWLEARPPGMVRPRVLAPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCF 96
Query  111  KIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIIDIE 170
            +I+C+K ++CS +   + +TDMN  P+A +HFDLSG A   +AK G +++LR +GIID +
Sbjct  97   EIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQ 153
Query  171  FTRVPCEFPG-LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWT 229
            F RV C++P   KI FH+E+ SNP Y+A+LV+Y  GDGDVV+V++ E  +       +W 
Sbjct  154  FRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSE------EWK 207
Query  230  PMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIP 270
             ++ESWG+IWR+DT   L+ PFS+R+  E  +   A + IP
Sbjct  208  ALKESWGAIWRIDTPKPLKGPFSVRVTTEGARRSSAEDAIP 248

Sequence Alignment: 38. Allergen Name: Ara t expansin Sequence ID: CAB37496

 Score = 91.4 bits 427,  Expect = 4e-20
 Identities = 73/204 35%, Positives = 112/204 54%, Gaps = 14/204 6%
Query  74   NGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSCYKIRCTKDQSCSGRSETVIITDMN 133
            + GAC +       F    +     ++KDG GCG+C+++RC     CS +  TVI+TD+N
Sbjct  41   SSGACAYGSMATGFFAGHIAAALPSIYKDGSGCGACFQVRCKNPTLCSSKGTTVIVTDLN 100
Query  134  YYPVAPFHFDLSGTAFGRLAKP--GLNDKLRHSGIIDIEFTRVPCEFPGLKIGFHVEEYS 191
                    + LS  AF  +AKP  G +  L   GI+DIE+ RVPC++   K+   VEE S
Sbjct  101  --KTNQTDLVLSSRAFRAMAKPVVGADRDLLKQGIVDIEYRRVPCDYGNKKMNVRVEESS 158
Query  192  -NPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSIWRLDT--NHRLQ 248
             NP Y+A+ + Y+ G  +VV + + +  ++H      W+ M  S G++W  D   N  LQ
Sbjct  159  KNPNYLAIKLLYQGGQTEVVAIYIAQVGSSH------WSYMTRSHGAVWVTDKVPNGALQ 212
Query  249  APFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQYS 286
              F +      GK + +  V+PANW     Y + VQ +
Sbjct  213  FRFVVTA-GYDGKMVWSQRVLPANWEAGKSYDAGVQIT 249

Sequence Alignment: 39. Allergen Name: Ory s 1 Sequence ID: BAA85432

 Score = 75.7 bits 345,  Expect = 2e-15
 Identities = 86/255 33%, Positives = 134/255 52%, Gaps = 42/255 16%
Query  5    SSLAAAAVFLSL-LAVGHCAAADFNATDADADFAGNGWDFNSSDAAVY---WGPWTKARA 60
            SS    A+FL+  LAV    AA         D+    W    +  AV       W    A
Sbjct  3    SSWNNPAIFLAAALAVA--TAAQVVTAGFTTDLY---WQQQPAPGAVTPYKTSDWHDGSA 57
Query  61   TWYGQPNGAGPDDNGGACGFKHTNQYPFMSM-TSCGNQPLFKDGKGCGSCYKIRCTKDQS 119
            T+YG P+G G DD GGACG+   +   + S  T+  + PLF DG GCG CY++RC K   
Sbjct  58   TFYGDPSGMG-DDFGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPW 116
Query  120  CSGRSETVIITDMN------YYP------VAP--FHFDLSGTAFGRLAKPGLNDKLRHSG 165
            C+  S +V+IT  N      Y P        P   HFD++  +F +LA+       R +G
Sbjct  117  CNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ-------RVAG 169
Query  166  IIDIEFTRVPCEFPGLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPT 225
            I+ +++ RVPC+  G   G       N  ++ + V    G GDV  + +   KT+ G   
Sbjct  170  IVPVQYRRVPCQRTG---GVRFCLQGNHYWLLLYVMNVGGAGDVSSLSV---KTSGGG-- 221
Query  226  GKWTPMRESWGSIWRLDTNHRLQAPFSIRIRNESG--KTLVANNVIPANWRPNTFYR 280
            G W     +WG  +++         +++++   S   +T++ ++ I   W     Y+
Sbjct  222  GAWIQAAHNWGITYQVFAALDNSDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCYQ 278

Sequence Alignment: 40. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 74.4 bits 338,  Expect = 5e-15
 Identities = 61/202 30%, Positives = 101/202 50%, Gaps = 15/202 7%
Query  74   NGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSCYKIRCTKDQSCSGRSETVIITDMN 133
            N G+CG+            +  +  LF+ G GCG+C+++RC   + CS     V++TD  
Sbjct  50   NAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTD-E 108
Query  134  YYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIIDIEFTRVPCEFP-GLKIGFHVEEYSN 192
                    + LS  A+  +A+PG+  +LR    +D+E+ RVPCE+  G  +   VEE S 
Sbjct  109  ARSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSR 168
Query  193  PVY-FAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSIWRLDTNHRLQAPF 251
            P   +++   Y+ G  D+V VD+    +++      W  M   +G  W   T +    P+
Sbjct  169  PPRELSIRFLYQGGQTDIVAVDVATVGSSN------WKFMTRDYGPAW--STAQAPAGPL 220
Query  252  SIRIR---NESGKTLVANN-VIPANWRPNTFYRSFVQ 284
              R+       GK + A+  V+P  W     Y + VQ
Sbjct  221  QFRVVVTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257

Sequence Alignment: 41. Allergen Name: Poa p 2 Sequence ID: CAA10348

 Score = 46.2 bits 189,  Expect = 7e-07
 Identities = 35/90 38%, Positives = 54/90 60%, Gaps = 8/90 8%
Query  182  KIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSIWRL 241
            K+ F VE+ SN  ++AVLV+YE GD  + +V+L E    HG  + +W  M +  G +W +
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELRE----HG--SDEWVAMTKGEGGVWTF 80
Query  242  DTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFY 279
            D+   LQ PF+ R   E G   V ++V+P  +     Y
Sbjct  81   DSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 42. Allergen Name: Dac g 2 Sequence ID: CAA10345

 Score = 46.2 bits 189,  Expect = 7e-07
 Identities = 35/90 38%, Positives = 54/90 60%, Gaps = 8/90 8%
Query  182  KIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSIWRL 241
            K+ F VE+ SN  ++AVLV+YE GD  + +V+L E    HG  + +W  M +  G +W +
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELRE----HG--SDEWVAMTKGEGGVWTF 80
Query  242  DTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFY 279
            D+   LQ PF+ R   E G   V ++V+P  +     Y
Sbjct  81   DSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 43. Allergen Name: Phl p 2 Sequence ID: P43214

 Score = 46.2 bits 189,  Expect = 7e-07
 Identities = 35/90 38%, Positives = 54/90 60%, Gaps = 8/90 8%
Query  182  KIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSIWRL 241
            K+ F VE+ SN  ++AVLV+YE GD  + +V+L E    HG  + +W  M +  G +W +
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELRE----HG--SDEWVAMTKGEGGVWTF 80
Query  242  DTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFY 279
            D+   LQ PF+ R   E G   V ++V+P  +     Y
Sbjct  81   DSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 44. Allergen Name: Cyn d 2 Sequence ID: CAA10346

 Score = 45.2 bits 184,  Expect = 1e-06
 Identities = 34/90 37%, Positives = 54/90 60%, Gaps = 8/90 8%
Query  182  KIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSIWRL 241
            K+ F VE+ SN  ++AVLV+YE GD  + +V+L E    HG  + +W  M +  G +W +
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELRE----HG--SDEWVAMTKGEGGVWTF 80
Query  242  DTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFY 279
            D+   L+ PF+ R   E G   V ++V+P  +     Y
Sbjct  81   DSEEPLKGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 45. Allergen Name: Lol p 2 Sequence ID: P14947

 Score = 40.7 bits 160,  Expect = 3e-05
 Identities = 27/91 29%, Positives = 59/91 64%, Gaps = 8/91 8%
Query  183  IGFHVEEYSNPVYFAVLVEY-EDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSIWRL 241
            + F VE+ S+   +A+ ++Y ++GD  + +V+L E    HG  + +W  ++++   +W +
Sbjct  4    VEFTVEKGSDEKNLALSIKYNKEGDS-MAEVELKE----HG--SNEWLALKKNGDGVWEI 56
Query  242  DTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYR 280
             ++  L+ PF+ R  +E G   V ++V+PA+++  T Y+
Sbjct  57   KSDKPLKGPFNFRFVSEKGMRNVFDDVVPADFKVGTTYK 95

Sequence Alignment: 46. Allergen Name: Dac g 3 Sequence ID: P93124

 Score = 38.6 bits 149,  Expect = 0.0001
 Identities = 26/92 28%, Positives = 53/92 57%, Gaps = 7/92 7%
Query  181  LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSIWR 240
            +K+ F VE+ S+P  + + ++Y      + +V+L +    HG  + +W P+ +  G++W 
Sbjct  1    VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQ----HG--SEEWEPLTKK-GNLWE 53
Query  241  LDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFY 279
            + ++  L  PF+ R  ++ G   V + VIP  ++  T Y
Sbjct  54   VKSSKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92

Sequence Alignment: 47. Allergen Name: Lol p 2 Sequence ID: CAA51775

 Score = 38.4 bits 148,  Expect = 0.0001
 Identities = 26/86 30%, Positives = 56/86 65%, Gaps = 8/86 9%
Query  185  FHVEEYSNPVYFAVLVEY-EDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSIWRLDT 243
            F VE+ S+   +A+ ++Y ++GD  + +V+L E    HG  + +W  ++++   +W + +
Sbjct  2    FTVEKGSDEKNLALSIKYSKEGDA-MAEVELKE----HG--SNEWLALKKNGDGVWEIKS 54
Query  244  NHRLQAPFSIRIRNESGKTLVANNVIPANWRPNT 277
            +  L+ PF+ R  +E G   V ++V+PA+++  T
Sbjct  55   DKPLKGPFNFRFVSEKGMWNVFDDVVPADFKVGT 88

Sequence Alignment: 48. Allergen Name: Phl p 3.0101 Sequence ID: 2JNZ_A

 Score = 35.5 bits 133,  Expect = 0.001
 Identities = 23/93 24%, Positives = 52/93 55%, Gaps = 7/93 7%
Query  181  LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSIWR 240
            +++ F V++ S+P  + + ++Y      + +V+L +    HG  + +W P+ +  G++W 
Sbjct  13   VQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQ----HG--SEEWEPLTKK-GNVWE 65
Query  241  LDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYR 280
            + ++  L  PF+ R  ++ G   V + VIP  +     Y+
Sbjct  66   VKSSKPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105

Sequence Alignment: 49. Allergen Name: Cyn d 15 Sequence ID: AAP80171

 Score = 35.5 bits 133,  Expect = 0.001
 Identities = 38/92 41%, Positives = 60/92 65%, Gaps = 13/92 14%
Query  181  LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSIWR 240
            + I FHVEE S+P  FA+ +  +D   ++ QVD+ E    HG       PM +S G  W 
Sbjct  20   VNIIFHVEE-SSP-KFALSI--KDSAKEITQVDVRE----HG--ADNMDPMTKS-GDSWT 68
Query  241  LDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQY 285
            +D    L+ P++IR+R E G + V ++VIP NW+  T Y + +++
Sbjct  69   ID--KPLKGPLNIRLRAEGGGSRVQDDVIPENWKAGTDYPTKLHF 111

Sequence Alignment: 50. Allergen Name: Dac g 1.0101 Sequence ID: Q7M1X8

 Score = 31.3 bits 109,  Expect = 0.006
 Identities = 13/23 56%, Positives = 16/23 69%, Gaps = 0/23 0%
Query  49   AVYWGPWTKARATWYGQPNGAGP 71
            A Y   W  A++TWYG+P GAGP
Sbjct  12   ATYGDKWLDAKSTWYGKPTGAGP 34

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.