The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGSLTTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGST
DNGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDM
NYEPISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGS
NPNYLAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTT
ESGKSLIAKDVIPVNWMPDAIYVSNVQFY
Sequence Info Allergen Name Length Opt Bits Score E Value
AAF72990 Ory s 1 269 1889 346.1 7.6e-97
P58738 Zea m 1 269 1469 271.2 2.6e-74
ACA23876 Pas n 1.0101 265 1439 265.9 1e-72
AAF72991 Ory s 1 267 1289 239.2 1.2e-64
AAF72983 Ory s 1 267 1264 234.7 2.6e-63
CAA81613 Phl p 1.0101 263 1146 213.7 5.5e-57
P43213 Phl p 1 263 1133 211.4 2.7e-56
P43216 Hol l 1 265 1120 209.0 1.4e-55
CAA10140 Hol l 1 263 1114 208.0 2.9e-55
CAA10520 Poa p a 263 1108 206.9 6e-55
AAL14078 Cyn d 1 262 1103 206.0 1.1e-54
CAA93121 Hol l 1.0102 248 1092 204.1 4e-54
CAB63699 Lol p 1.0103 263 1092 204.0 4.3e-54
Q41260 Pha a 1 269 1091 203.9 5.1e-54
AAA63279 Lol p 1.0101 263 1083 202.4 1.3e-53
AAL14079 Cyn d 1.0203 262 1082 202.3 1.5e-53
A0A4D6FZ45 Uro m 1.0101 262 1082 202.3 1.5e-53
AAL14077 Cyn d 1.0202 262 1082 202.3 1.5e-53
P14946 Lol p 1 263 1080 201.9 1.9e-53
A0A4D6G2J8 Uro m 1.0201 229 1069 200.0 6.2e-53
O04701 Cyn d 1 246 1068 199.8 7.7e-53
QCX36431 Zoy m 1.0101 272 1069 199.9 7.8e-53
AAA63278 Lol p 1.0102 252 1066 199.4 1e-52
Q40638 Ory s 1 263 1060 198.3 2.3e-52
AAF72987 Ory s 1 275 1053 197.1 5.7e-52
AAF80379 Cyn d 1.0204 244 1046 195.9 1.2e-51
AAF72984 Ory s 1 268 1043 195.3 1.9e-51
AAK96255 Cyn d 1.0201 244 1041 195.0 2.1e-51
ABC58726 Sor h 1.0101 239 1032 193.4 6.3e-51
Q07154 Zea m 1 191 1022 191.7 1.6e-50
AAD10496 Tri a ps93 271 1000 187.6 3.9e-49
AAF72989 Ory s 1 271 996 186.9 6.4e-49
AAB61710 Ory s 1 261 978 183.7 5.6e-48
AAF72985 Ory s 1 286 972 182.6 1.3e-47
AAF72988 Ory s 1 327 804 152.6 1.7e-38
AAA50175 Gly m 2 277 800 152.0 2.2e-38
AAF72986 Ory s 1 275 717 137.2 6.1e-34
CAB37496 Ara t expansin 265 453 90.1 8.5e-20
BAA85432 Ory s 1 284 386 78.2 3.7e-16
AAG13596 Ory s 1 275 362 73.9 6.9e-15
CAA10346 Cyn d 2 122 241 52.7 7.2e-09
CAA10345 Dac g 2 122 237 52.0 1.2e-08
CAA10348 Poa p 2 122 237 52.0 1.2e-08
P43214 Phl p 2 122 237 52.0 1.2e-08
P14947 Lol p 2 97 194 44.5 1.8e-06
P93124 Dac g 3 96 191 43.9 2.5e-06
CAA51775 Lol p 2 88 186 43.1 4.1e-06
AAP80171 Cyn d 15 112 188 43.3 4.5e-06
Q7M1X8 Dac g 1.0101 34 172 41.1 6.5e-06
2JNZ_A Phl p 3.0101 108 181 42.1 1e-05
Q7M1X6 Ant o 1.0101 32 154 37.9 5.6e-05
P14948 Lol p 3 97 166 39.5 5.6e-05
CAA90746 Tri a 3 118 149 36.3 0.00059
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 346.1 bits 1889,  Expect = 8e-97
 Identities = 269/269 100%, Positives = 269/269 100%, Gaps = 0/269 0%
Query  1    MGSLTTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGST 60
            MGSLTTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGST
Sbjct  1    MGSLTTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGST 60
Query  61   DNGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDM 120
            DNGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDM
Sbjct  61   DNGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDM 120
Query  121  NYEPISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGS 180
            NYEPISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGS
Sbjct  121  NYEPISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGS 180
Query  181  NPNYLAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTT 240
            NPNYLAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTT
Sbjct  181  NPNYLAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTT 240
Query  241  ESGKSLIAKDVIPVNWMPDAIYVSNVQFY 269
            ESGKSLIAKDVIPVNWMPDAIYVSNVQFY
Sbjct  241  ESGKSLIAKDVIPVNWMPDAIYVSNVQFY 269

Sequence Alignment: 2. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 271.2 bits 1469,  Expect = 3e-74
 Identities = 196/269 72%, Positives = 230/269 85%, Gaps = 0/269 0%
Query  1    MGSLTTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGST 60
            MGSL  NI++  AV+AALV GGSCGPPKVPPGPNITTNYN  WL ARATWYGQP G+G+ 
Sbjct  1    MGSLVNNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAP 60
Query  61   DNGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDM 120
            DNGGACGIKNVNLPPY+GM +CGNVPIFKDG+GCGSCYEV+C++   CS  PVTV+ITDM
Sbjct  61   DNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDM 120
Query  121  NYEPISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGS 180
            NYEPI+ YHFD+SGKAFG++A PG   ++R  GI+D++FRRVRCKYP GQK+ FH+EKG 
Sbjct  121  NYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGC 180
Query  181  NPNYLAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTT 240
            NPNYLAVLVK+VADDGD++ M++Q+     W+PMKLSWGAIWRMDTA  LK PFSIR+T+
Sbjct  181  NPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTS 240
Query  241  ESGKSLIAKDVIPVNWMPDAIYVSNVQFY 269
            ESGK +IAKDVIP NW PDA+Y SNVQFY
Sbjct  241  ESGKKVIAKDVIPANWRPDAVYTSNVQFY 269

Sequence Alignment: 3. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 265.9 bits 1439,  Expect = 1e-72
 Identities = 199/265 75%, Positives = 224/265 84%, Gaps = 3/265 1%
Query  1    MGSLTTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGST 60
            MGSL   IV   AV+AALV GGSCGPPKVPPGPNITTNYN  WLPA+ATWYGQP G+G  
Sbjct  1    MGSLA-KIVAVAAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLPAKATWYGQPNGAGPD 59
Query  61   DNGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDM 120
            DNGGACGIKNVNLPPYNG  +CGN PIFKDG+GCGSCYE++C +P  CS QPVTVFITDM
Sbjct  60   DNGGACGIKNVNLPPYNGFTACGNPPIFKDGKGCGSCYEIRCNKPE-CSGQPVTVFITDM 118
Query  121  NYEPISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGS 180
            NYEPI+ YHFD+SGKAFGAMA PG   +LR  GI D++FRRVRCKY GGQK+ FHVEKGS
Sbjct  119  NYEPIAPYHFDLSGKAFGAMAKPGLNDKLRHYGIFDLEFRRVRCKYQGGQKIVFHVEKGS 178
Query  181  NPNYLAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTT 240
            NPNYLA+LVKFVADDGD++ M+L+E     W+PMKLSWGAIWRMDT   L  PFSIR+T+
Sbjct  179  NPNYLAMLVKFVADDGDIVLMELKEKS-SDWKPMKLSWGAIWRMDTPKALVPPFSIRLTS 237
Query  241  ESGKSLIAKDVIPVNWMPDAIYVSNVQF 268
            ESGK +IA+DVIPVNW PD +Y SNVQF
Sbjct  238  ESGKKVIAQDVIPVNWKPDTVYNSNVQF 265

Sequence Alignment: 4. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 239.2 bits 1289,  Expect = 1e-64
 Identities = 174/263 66%, Positives = 209/263 79%, Gaps = 0/263 0%
Query  5    TTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGSTDNGG 64
            ++ ++LA  V AA+V   SCGPPKVPPGPNIT  Y   WL AR TWYG+P G+G  DNGG
Sbjct  3    SSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDNGG 62
Query  65   ACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEP 124
            ACG K+++  P+ GM SCGN PIFKDG+GCGSC+EVKC +P ACS +PV + ITDMN EP
Sbjct  63   ACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTEP 122
Query  125  ISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNY 184
            I+AYHFD+SG AFGAMA  GK+ ELRKAGIIDMQFRRVRCKYPG  KVTFHVEKGSNPNY
Sbjct  123  IAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNY 182
Query  185  LAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGK 244
            +AVLVK+V  DGDV++++L+E G   W+P+  SWGAIWR+DT  PLK PFS+RVTTES +
Sbjct  183  FAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQ 242
Query  245  SLIAKDVIPVNWMPDAIYVSNVQ 267
             L+A DVIP NW  +A+Y S +Q
Sbjct  243  KLVANDVIPDNWKANALYKSEIQ 265

Sequence Alignment: 5. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 234.7 bits 1264,  Expect = 3e-63
 Identities = 168/263 63%, Positives = 210/263 79%, Gaps = 0/263 0%
Query  5    TTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGSTDNGG 64
            +++++LA  VVAA+V   SCGPPKVPPGPNITT+Y   WL A+ATWYG P G+G  DNGG
Sbjct  3    SSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDNGG 62
Query  65   ACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEP 124
            ACG K+V+  P+ GM SCGN PIFKDG+GCGSC+E+KC +P ACS +P  + +TDMN EP
Sbjct  63   ACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEP 122
Query  125  ISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNY 184
            I+AYHFD+SG AFGAMA  GK+ ELRKAGIID QFRRV+CKYP   K+TFH+EK SNPNY
Sbjct  123  IAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNY 182
Query  185  LAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGK 244
            LA+LVK+VA DGDV++++++E G   W+ +K SWGAIWR+DT  PLK PFS+RVTTE G+
Sbjct  183  LALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGE 242
Query  245  SLIAKDVIPVNWMPDAIYVSNVQ 267
             +IA+D IP  W  D++Y SNVQ
Sbjct  243  KIIAEDAIPDGWKADSVYKSNVQ 265

Sequence Alignment: 6. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 213.7 bits 1146,  Expect = 5e-57
 Identities = 157/259 60%, Positives = 194/259 74%, Gaps = 1/259 0%
Query  5    TTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGSTDNGG 64
            +++++L VA+ A ++G    G PKVPPGPNIT  Y   WL A++TWYG+P  +G  DNGG
Sbjct  4    SSSVLLVVALFAVFLGSAH-GIPKVPPGPNITATYGDKWLDAKSTWYGKPTAAGPKDNGG 62
Query  65   ACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEP 124
            ACG K+V+ PP++GM  CGN PIFK GRGCGSC+E+KC +P ACS +PV V ITD N EP
Sbjct  63   ACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEP 122
Query  125  ISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNY 184
            I+AYHFD+SG AFG+MA  G E +LR AG +++QFRRV+CKYP G KVTFHVEKGSNPNY
Sbjct  123  IAAYHFDLSGIAFGSMAKKGDEQKLRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNY 182
Query  185  LAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGK 244
            LA+LVKFVA DGDV+ +D++E G   W  +K SWGAIWR+DT   LK PF++R TTE G 
Sbjct  183  LALLVKFVAGDGDVVAVDIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGT 242
Query  245  SLIAKDVIPVNWMPDAIYVS 264
               AKDVIP  W  D  Y S
Sbjct  243  KGEAKDVIPEGWKADTAYES 262

Sequence Alignment: 7. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 211.4 bits 1133,  Expect = 3e-56
 Identities = 155/260 59%, Positives = 191/260 73%, Gaps = 0/260 0%
Query  5    TTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGSTDNGG 64
            +++ VL V V+ A+  G + G PKVPPGPNIT  Y   WL A++TWYG+P G+G  DNGG
Sbjct  3    SSSSVLLVVVLFAVFLGSAYGIPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGG 62
Query  65   ACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEP 124
            ACG K+V+ PP++GM  CGN PIFK GRGCGSC+E+KC +P ACS +PV V ITD N EP
Sbjct  63   ACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEP 122
Query  125  ISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNY 184
            I+ YHFD+SG AFGAMA  G E +LR AG +++QFRRV+CKYP G KVTFHVEKGSNPNY
Sbjct  123  IAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNY 182
Query  185  LAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGK 244
            LA+LVK+V  DGDV+ +D++E G   W  +K SWGAIWR+DT   L  PF++R TTE G 
Sbjct  183  LALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGT 242
Query  245  SLIAKDVIPVNWMPDAIYVS 264
               A+DVIP  W  D  Y S
Sbjct  243  KTEAEDVIPEGWKADTSYES 262

Sequence Alignment: 8. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 209.0 bits 1120,  Expect = 1e-55
 Identities = 150/262 57%, Positives = 193/262 73%, Gaps = 0/262 0%
Query  1    MGSLTTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGST 60
            M S + +++L VA + A+  G + G  KVPPGPNIT  Y   WL A++TWYG+P G+G  
Sbjct  1    MASSSRSVLLLVAALFAVFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPK 60
Query  61   DNGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDM 120
            DNGGACG K+V+ PP++GM  CGN PIFKDGRGCGSC+E+KC +P +CS +PVTV ITD 
Sbjct  61   DNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEPVTVHITDD 120
Query  121  NYEPISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGS 180
            N EPI+ YHFD+SG AFG+MA  G+E +LR AG ++++FRRV+CKYP G K TFHVEKGS
Sbjct  121  NEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGS 180
Query  181  NPNYLAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTT 240
            NPNYLA+LVK++  DGDV+ +D++E G   W  +K SWGA+WR+DT   L  PF++R TT
Sbjct  181  NPNYLALLVKYIDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTT 240
Query  241  ESGKSLIAKDVIPVNWMPDAIY 262
            E G    A+DVIP  W  D  Y
Sbjct  241  EGGTKGEAEDVIPEGWKADTAY 262

Sequence Alignment: 9. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 208.0 bits 1114,  Expect = 3e-55
 Identities = 149/260 57%, Positives = 194/260 74%, Gaps = 0/260 0%
Query  5    TTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGSTDNGG 64
            ++++VL V  + A+  G + G  KVPPGPNIT  Y   WL A++TWYG+P G+G  DNGG
Sbjct  3    SSSLVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGG 62
Query  65   ACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEP 124
            ACG K+V+ PP++GM  CGN PIFK GRGCGSC+E+KC +P +CS +P+ V ITD N EP
Sbjct  63   ACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPIVVHITDDNEEP 122
Query  125  ISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNY 184
            I+AYH+D+SGKAFGAMA  G+E +LR AG ++++FRRV+C+YP G KVTFHVEKGSNPNY
Sbjct  123  IAAYHLDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPKGTKVTFHVEKGSNPNY 182
Query  185  LAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGK 244
            LA+LVK+V  DGDV+ +D++E G   W  +K SWGA+WR+DT   L  PF++R TTE G 
Sbjct  183  LALLVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGT 242
Query  245  SLIAKDVIPVNWMPDAIYVS 264
             + A+DVIP  W  D  Y S
Sbjct  243  KVEAEDVIPEGWKADTAYES 262

Sequence Alignment: 10. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 206.9 bits 1108,  Expect = 6e-55
 Identities = 150/259 57%, Positives = 193/259 74%, Gaps = 1/259 0%
Query  5    TTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGSTDNGG 64
            +++++L VA+ A ++G    G  KVPPGPNIT  Y   WL A++TWYG+P G+G  DNGG
Sbjct  4    SSSVLLVVALFAVFLGTAH-GIAKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGG 62
Query  65   ACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEP 124
            ACG K+V+  P++GM  CGN PIFK GRGCGSC+E+KC +P +CS +PV V ITD N EP
Sbjct  63   ACGYKDVDKAPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPVLVHITDDNEEP 122
Query  125  ISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNY 184
            I+AYHFD+SGKAFGAMA  G+E +LR AG ++++FRRV+C+YP G KVTFHVEKGSNPNY
Sbjct  123  IAAYHFDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPEGTKVTFHVEKGSNPNY 182
Query  185  LAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGK 244
            LA+LVK+V  DGDV+ +D++E G   W  +K SWG+IWR+DT   L  PF++R TTE G 
Sbjct  183  LALLVKYVTGDGDVVAVDIKEKGKDKWIELKESWGSIWRVDTPDKLTGPFTVRYTTEGGT 242
Query  245  SLIAKDVIPVNWMPDAIYVS 264
               A+DVIP  W  D  Y S
Sbjct  243  KGEAEDVIPEGWKADTAYAS 262

Sequence Alignment: 11. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 206.0 bits 1103,  Expect = 1e-54
 Identities = 154/260 59%, Positives = 198/260 76%, Gaps = 3/260 1%
Query  8    IVLAVAVV-AALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQ-PYGSGSTDNGGA 65
            ++ AVAVV A++VGG  C      PGPNIT  Y   WL A+AT+YG  P G+   D+GGA
Sbjct  1    MLAAVAVVLASMVGGAWCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGA 59
Query  66   CGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEPI 125
            CG K+V+  P++GM  CGN PIFKDG GCGSCYE+KC++PA CS +PV + ITD NYE I
Sbjct  60   CGYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHI 119
Query  126  SAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYL 185
            +AYHFD+SGKAFGAMA  G+E +LRKAG + +QFRRV+C+YP   K+TFHVEKGS+PNYL
Sbjct  120  AAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYL 179
Query  186  AVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKS 245
            A+LVK+ A DG+++ +D++  G   + PMKLSWGAIWRMD   PLK PF+IR+T+ESG  
Sbjct  180  ALLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGH 239
Query  246  LIAKDVIPVNWMPDAIYVSNVQF 268
            +  +DVIP +W PD +Y S +QF
Sbjct  240  VEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 12. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 204.1 bits 1092,  Expect = 4e-54
 Identities = 144/242 59%, Positives = 181/242 74%, Gaps = 0/242 0%
Query  21   GGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGSTDNGGACGIKNVNLPPYNGMI 80
            G + G  KVPPGPNIT  Y   WL A++TWYG+P G+G  DNGGACG K+V+ PP++GM 
Sbjct  4    GSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMT 63
Query  81   SCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEPISAYHFDFSGKAFGAM 140
             CGN PIFKDGRGCGSC+E+KC +P +CS +PVTV ITD N EPI+ YHFD+SG AFG+M
Sbjct  64   GCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSM 123
Query  141  ACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVIQ 200
            A  G+E +LR AG ++++FRRV+CKYP G K TFHVEKGSNPNYLA+LVK++  DGDV+ 
Sbjct  124  AKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVA 183
Query  201  MDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLIAKDVIPVNWMPDA 260
            +D++E G   W  +K SWGA+WR+DT   L  PF++R TTE G    A+DVIP  W  D 
Sbjct  184  VDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADT 243
Query  261  IY 262
             Y
Sbjct  244  AY 245

Sequence Alignment: 13. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 204.0 bits 1092,  Expect = 4e-54
 Identities = 147/257 57%, Positives = 188/257 73%, Gaps = 1/257 0%
Query  5    TTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGSTDNGG 64
            +++++L VA+ A ++G    G  KVPPGPNIT  Y   WL A++TWYG+P G+G  DNGG
Sbjct  4    SSSVLLVVALFAVFLGSAH-GIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGG 62
Query  65   ACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEP 124
            ACG K+V+  P+NGM  CGN PIFKDGRGCGSC+E+KC +P +CS + VTV ITD N EP
Sbjct  63   ACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEP 122
Query  125  ISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNY 184
            I+ YHFD+SG AFG+MA  G+E +LR AG +++QFRRV+CKYP G K TFHVEK SNPNY
Sbjct  123  IAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPNY 182
Query  185  LAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGK 244
            LA+LVK+V  DGDV+ +D++E G   W  +K SWGA+WR+DT   L  PF++R TTE G 
Sbjct  183  LAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGT 242
Query  245  SLIAKDVIPVNWMPDAIY 262
                +DVIP  W  D  Y
Sbjct  243  KSEVEDVIPEGWKADTSY 260

Sequence Alignment: 14. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 203.9 bits 1091,  Expect = 5e-54
 Identities = 148/257 57%, Positives = 188/257 73%, Gaps = 0/257 0%
Query  3    SLTTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGSTDN 62
            S +++ +L VA + A+  G + G  KVPPGPNIT  Y   WL A++TWYG+P G+G  DN
Sbjct  7    SSSSSSLLVVAALLAVFVGSAQGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 66
Query  63   GGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNY 122
            GGACG K+V+  P+NGM  CGN PIFKDGRGCGSC+E+KC +P +CS +P+TV ITD N 
Sbjct  67   GGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFELKCSKPESCSGEPITVHITDDNE 126
Query  123  EPISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNP 182
            EPI+ YHFD+SG AFG+MA  G+E  +R AG +++QFRRV+CKYP G K TFHVEKGSNP
Sbjct  127  EPIAPYHFDLSGHAFGSMAKKGEEENVRGAGELELQFRRVKCKYPDGTKPTFHVEKGSNP 186
Query  183  NYLAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTES 242
            NYLA+LVK+V  DGDV+ +D++E G   W  +K SWGAIWR+DT   L  PF++R TTE 
Sbjct  187  NYLALLVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEG 246
Query  243  GKSLIAKDVIPVNWMPD 259
            G     +DVIP  W  D
Sbjct  247  GTKAEFEDVIPEGWKAD 263

Sequence Alignment: 15. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 202.4 bits 1083,  Expect = 1e-53
 Identities = 146/257 56%, Positives = 186/257 72%, Gaps = 1/257 0%
Query  5    TTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGSTDNGG 64
            +++++L VA+ A ++G    G  KVPPGPNIT  Y   WL A++TWYG+P G+G  DNGG
Sbjct  4    SSSVLLVVALFAVFLGSAH-GIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGG 62
Query  65   ACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEP 124
            ACG KNV+  P+NGM  CGN PIFKDGRGCGSC+E+KC +P +CS + VTV ITD N EP
Sbjct  63   ACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEP 122
Query  125  ISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNY 184
            I+ YHFD+SG AFG+MA  G+E  +R AG +++QFRRV+CKYP   K TFHVEK SNPNY
Sbjct  123  IAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNY 182
Query  185  LAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGK 244
            LA+LVK+V  DGDV+ +D++E G   W  +K SWGA+WR+DT   L  PF++R TTE G 
Sbjct  183  LAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGT 242
Query  245  SLIAKDVIPVNWMPDAIY 262
                +DVIP  W  D  Y
Sbjct  243  KSEFEDVIPEGWKADTSY 260

Sequence Alignment: 16. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 202.3 bits 1082,  Expect = 1e-53
 Identities = 150/258 58%, Positives = 194/258 75%, Gaps = 3/258 1%
Query  9    VLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQ-PYGSGSTDNGGACG 67
            V+AV V+A++VGG  C      PGPNIT  Y   WL A+AT+YG  P G+   D+GGACG
Sbjct  4    VVAV-VLASMVGGALCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACG 61
Query  68   IKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEPISA 127
             K+V+  P++ M  CGN PIFKDG GCGSCYE+KC++PA CS +PV + ITD NYE I+A
Sbjct  62   YKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAA 121
Query  128  YHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYLAV 187
            YHFD+SGKAFGAMA  G+E +LRKAG + +QFRRV+C+YP   K+ FHVEKGSNPNYLA+
Sbjct  122  YHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLAL 181
Query  188  LVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLI 247
            LVK+ A DG+++ +D++  G   + PMK SWGAIWR+D   PLK PF+IR+T+ESG  + 
Sbjct  182  LVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVE 241
Query  248  AKDVIPVNWMPDAIYVSNVQF 268
             +DVIP +W PD +Y S +QF
Sbjct  242  QEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 17. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 202.3 bits 1082,  Expect = 1e-53
 Identities = 150/258 58%, Positives = 194/258 75%, Gaps = 3/258 1%
Query  9    VLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQ-PYGSGSTDNGGACG 67
            V+AV V+A++VGG  C      PGPNIT  Y   WL A+AT+YG  P G+   D+GGACG
Sbjct  4    VVAV-VLASMVGGALCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACG 61
Query  68   IKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEPISA 127
             K+V+  P++ M  CGN PIFKDG GCGSCYE+KC++PA CS +PV + ITD NYE I+A
Sbjct  62   YKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAA 121
Query  128  YHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYLAV 187
            YHFD+SGKAFGAMA  G+E +LRKAG + +QFRRV+C+YP   K+ FHVEKGSNPNYLA+
Sbjct  122  YHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLAL 181
Query  188  LVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLI 247
            LVK+ A DG+++ +D++  G   + PMK SWGAIWR+D   PLK PF+IR+T+ESG  + 
Sbjct  182  LVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVE 241
Query  248  AKDVIPVNWMPDAIYVSNVQF 268
             +DVIP +W PD +Y S +QF
Sbjct  242  QEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 18. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 202.3 bits 1082,  Expect = 1e-53
 Identities = 150/258 58%, Positives = 194/258 75%, Gaps = 3/258 1%
Query  9    VLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQ-PYGSGSTDNGGACG 67
            V+AV V+A++VGG  C      PGPNIT  Y   WL A+AT+YG  P G+   D+GGACG
Sbjct  4    VVAV-VLASMVGGALCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACG 61
Query  68   IKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEPISA 127
             K+V+  P++GM  CGN PIFKDG  CGSCYE+KC++PA CS +PV + ITD NYE I+A
Sbjct  62   YKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAA 121
Query  128  YHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYLAV 187
            YHFD+SGKAFGAMA  G+E +LRKAG + +QFRRV+C+YP   K+ FHVEKGSNPNYLA+
Sbjct  122  YHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLAL 181
Query  188  LVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLI 247
            LVK+ A DG+++ +D++  G   + PMK SWGAIWR+D   PLK PF+IR+T+ESG  + 
Sbjct  182  LVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVE 241
Query  248  AKDVIPVNWMPDAIYVSNVQF 268
             +DVIP +W PD +Y S +QF
Sbjct  242  QEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 19. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 201.9 bits 1080,  Expect = 2e-53
 Identities = 146/257 56%, Positives = 186/257 72%, Gaps = 1/257 0%
Query  5    TTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGSTDNGG 64
            +++++L VA+ A ++G    G  KVPPGPNIT  Y   WL A++TWYG+P G+G  DNGG
Sbjct  4    SSSVLLVVALFAVFLGSAH-GIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGG 62
Query  65   ACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEP 124
            ACG KNV+  P+NGM  CGN PIFKDGRGCGSC+E+KC +P +CS + VTV ITD N EP
Sbjct  63   ACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEP 122
Query  125  ISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNY 184
            I+ YHFD+SG AFG+MA  G+E  +R AG +++QFRRV+CKYP   K TFHVEK SNPNY
Sbjct  123  IAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNY 182
Query  185  LAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGK 244
            LA+LVK+V  DGDV+ +D++E G   W  +K SWGA+WR+DT   L  PF++R TTE G 
Sbjct  183  LAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGT 242
Query  245  SLIAKDVIPVNWMPDAIY 262
                +DVIP  W  D  Y
Sbjct  243  KSEFEDVIPEGWKADTSY 260

Sequence Alignment: 20. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 200.0 bits 1069,  Expect = 6e-53
 Identities = 137/229 59%, Positives = 177/229 77%, Gaps = 0/229 0%
Query  40   NAPWLPARATWYGQPYGSGSTDNGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYE 99
            +  WL A+ATWYG+P G+G  DNGGACG K+VN  P+N M +CGN PIFKDG GCGSCYE
Sbjct  1    DGKWLDAKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNPPIFKDGLGCGSCYE 60
Query  100  VKCEQPAACSKQPVTVFITDMNYEPISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQF 159
            +KC++PA CS +PV V ITD NYEPI+AYHFD++G AFGAMA  G+E +LRKAGIIDMQF
Sbjct  61   IKCDKPAECSGEPVIVHITDQNYEPIAAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQF 120
Query  160  RRVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWG 219
            RRV+CKYP   K+ FHVEKG NPNY+A+L+K+ A DGD++ +D++E G   + P+K SWG
Sbjct  121  RRVKCKYPANTKIAFHVEKGCNPNYFALLIKYAAGDGDIVAVDIKEKGSEEFIPLKHSWG 180
Query  220  AIWRMDTATPLKAPFSIRVTTESGKSLIAKDVIPVNWMPDAIYVSNVQF 268
            AIWR+D+  P+K P ++R+T+E G +L+  D IP  W  D +Y S +QF
Sbjct  181  AIWRIDSPKPIKGPIAVRLTSEGGTTLVQDDAIPEGWKADTVYTSKLQF 229

Sequence Alignment: 21. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 199.8 bits 1068,  Expect = 8e-53
 Identities = 143/238 60%, Positives = 182/238 76%, Gaps = 1/238 0%
Query  31   PGPNITTNYNAPWLPARATWYGQ-PYGSGSTDNGGACGIKNVNLPPYNGMISCGNVPIFK 89
            PGPNIT  Y + WL ARAT+YG  P G+   D+GGACG K+V+ PP++GM +CGN PIFK
Sbjct  6    PGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFK 65
Query  90   DGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEPISAYHFDFSGKAFGAMACPGKETEL 149
            DG GC +CYE+KC++P  CS +PV V ITD NYE I+AYHFD+SGKAFGAMA  G+E +L
Sbjct  66   DGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL 125
Query  150  RKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEAGLP 209
            RKAG + +QFRRV+CKYP G K+TFH+EKGSN +YLA+LVK+ A DG+++ +D++     
Sbjct  126  RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD 185
Query  210  AWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLIAKDVIPVNWMPDAIYVSNVQF 268
             + PMK SWGAIWR+D   PLK PFSIR+T+E G  L+  DVIP NW PD +Y S +QF
Sbjct  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQF 244

Sequence Alignment: 22. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 199.9 bits 1069,  Expect = 8e-53
 Identities = 147/257 57%, Positives = 191/257 74%, Gaps = 3/257 1%
Query  11   AVAVV-AALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQ-PYGSGSTDNGGACGI 68
            AVAV+ +A+VG   C      PGPNIT  YN  W  A+AT+YG  P G+   D+GGACG 
Sbjct  14   AVAVLLSAMVGSALCEIGD-KPGPNITATYNEEWQDAKATFYGSNPRGAAPDDDGGACGY 72
Query  69   KNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEPISAY 128
            KNV+  P+ GM  CGN PIFKDG GCGSC+E+KC++PA CS +PV + ITD NYE I+AY
Sbjct  73   KNVDKAPFFGMTGCGNEPIFKDGLGCGSCFEIKCKEPAECSDKPVLIRITDKNYEHIAAY 132
Query  129  HFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYLAVL 188
            HFD+SGKAFG+MA  G+E  LRKAG + +QFRRV+C+YP   K+TFHVEKG N NYLA+L
Sbjct  133  HFDLSGKAFGSMAKQGQEDNLRKAGELTLQFRRVKCEYPSKTKITFHVEKGCNDNYLALL 192
Query  189  VKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLIA 248
            V++ A DGD++ +D++  G   + PMK SWGAIWR+D   PLK PF++R+T+ESG  L+ 
Sbjct  193  VEYAAGDGDIVAVDIKPKGSDEFLPMKPSWGAIWRIDPKKPLKGPFTVRLTSESGAKLVQ 252
Query  249  KDVIPVNWMPDAIYVSNVQF 268
            +DVIP +W P+  Y SN+Q+
Sbjct  253  EDVIPADWKPNTAYTSNLQY 272

Sequence Alignment: 23. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 199.4 bits 1066,  Expect = 1e-52
 Identities = 143/246 58%, Positives = 178/246 72%, Gaps = 0/246 0%
Query  17   ALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGSTDNGGACGIKNVNLPPY 76
            A+  G + G  KVPPGPNIT  Y   WL A++TWYG+P G+G  DNGGACG K+V+  P+
Sbjct  4    AVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPF 63
Query  77   NGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEPISAYHFDFSGKA 136
            NGM  CGN PIFKDGRGCGSC+E+KC +P +CS + VTV ITD N EPI+ YHFD+SG A
Sbjct  64   NGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHA 123
Query  137  FGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDG 196
            FG+MA  G+E  +R AG +++QFRRV+CKYP   K TFHVEKGSNPNYLA+LVK+V  DG
Sbjct  124  FGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKGSNPNYLAILVKYVDGDG 183
Query  197  DVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLIAKDVIPVNW 256
            DV+ +D++E G   W  +K SWGA+WR+DT   L  PF++R TTE G     +DVIP  W
Sbjct  184  DVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGW 243
Query  257  MPDAIY 262
              D  Y
Sbjct  244  KADTSY 249

Sequence Alignment: 24. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 198.3 bits 1060,  Expect = 2e-52
 Identities = 147/246 59%, Positives = 185/246 75%, Gaps = 3/246 1%
Query  5    TTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGSTDNGG 64
            +++++LA  VVAA+V     G PKVPPGPNITT+Y   WL AR     +P      DNGG
Sbjct  3    SSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDNGG 62
Query  65   ACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEP 124
            ACG K+V+  P+ GM SCGN PIFKDG+GCGSC+E+KC +P ACS +P  + +TDMN EP
Sbjct  63   ACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEP 122
Query  125  ISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNY 184
            I+AYHFD+SG A   MA  GK+ ELRKAGIID QFRRV+CKYP   K+TFH+EK SNPNY
Sbjct  123  IAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNY 179
Query  185  LAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGK 244
            LA+LVK+VA DGDV++++++E G   W+ +K SWGAIWR+DT  PLK PFS+RVTTE  +
Sbjct  180  LALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGAR 239
Query  245  SLIAKDVIP 253
               A+D IP
Sbjct  240  RSSAEDAIP 248

Sequence Alignment: 25. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 197.1 bits 1053,  Expect = 6e-52
 Identities = 149/264 56%, Positives = 193/264 73%, Gaps = 10/264 3%
Query  1    MGSLTTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGST 60
            MGS    I+   A+++ LV  GSC    V    +  + Y + WLPARATWYG P G+G  
Sbjct  5    MGSKVAAIL---AILSVLVVHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPD 61
Query  61   DNGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDM 120
            DNGGACG KNVN  P++ M SCGN PIFKDG+GCGSCY+++C +  +CS    TV ITDM
Sbjct  62   DNGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDM 121
Query  121  NYEPISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGS 180
            NY P++ YHFD+SG AFGAMA PG   +LR +GIID+QFRRV C YPG  K+ FHVE+GS
Sbjct  122  NYYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPG-LKINFHVEEGS 180
Query  181  NPNYLAVLVKFVADDGDVIQMDLQEA------GLPAWRPMKLSWGAIWRMDTATPLKAPF 234
            NP Y+AVLV++   DGDV+Q+DL E+          W PM+ SWG+IWR+D+   L+APF
Sbjct  181  NPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPF 240
Query  235  SIRVTTESGKSLIAKDVIPVNWMPDAIYVSNVQF 268
            S+R+ ++SGK+L+A +VIP NW P++ Y S VQF
Sbjct  241  SLRIRSDSGKTLVANNVIPANWSPNSNYRSIVQF 274

Sequence Alignment: 26. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 195.9 bits 1046,  Expect = 1e-51
 Identities = 141/238 59%, Positives = 180/238 75%, Gaps = 1/238 0%
Query  31   PGPNITTNYNAPWLPARATWYGQ-PYGSGSTDNGGACGIKNVNLPPYNGMISCGNVPIFK 89
            PGPNIT  Y   WL A+AT+YG  P G+   D+GGACG K+V+  P++GM  CGN PIFK
Sbjct  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
Query  90   DGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEPISAYHFDFSGKAFGAMACPGKETEL 149
            DG  CGSCYE+KC++PA CS +PV + ITD NYE I+AYHFD+SGKAFGAMA  G+E +L
Sbjct  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
Query  150  RKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEAGLP 209
            RKAG + +QFRRV+C+YP   K+ FHVEKGS+PNYLA+LVK+ A DG+++ +D++  G  
Sbjct  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
Query  210  AWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLIAKDVIPVNWMPDAIYVSNVQF 268
             + PMK SWGAIWRMD   PLK PF+IR+T+ESG  +   DVIP +W PD +Y S +QF
Sbjct  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF 244

Sequence Alignment: 27. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 195.3 bits 1043,  Expect = 2e-51
 Identities = 144/237 60%, Positives = 178/237 75%, Gaps = 3/237 1%
Query  31   PGPNITTNYNA-P-WLPARATWYGQPYGSGSTDNGGACGIKNVNLPPYNGMISCGNVPIF 88
            PG    +++ A P W  ARATWYG P G+G  D+GGACG KN N  P++ M SCGN PIF
Sbjct  28   PGNFSASDFTADPNWEVARATWYGAPTGAGPDDDGGACGFKNTNQYPFSSMTSCGNEPIF 87
Query  89   KDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEPISAYHFDFSGKAFGAMACPGKETE 148
            KDG+GCGSCY+++C    ACS  P TV ITDMNY P+S YHFD+SG AFGAMA PG+  +
Sbjct  88   KDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAKPGQNDQ 147
Query  149  LRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEAGL 208
            LR AGIID+QF+RV C +PG  KVTFHVE+GSNP Y+AVLV++   DGDV+Q+DL EA  
Sbjct  148  LRHAGIIDIQFKRVPCNFPG-LKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEANS 206
Query  209  PAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLIAKDVIPVNWMPDAIYVSNVQF 268
             +W PM+ SWG+IWR+D+   L APFS+R+T ESGK L+A  VIP NW P A+Y S VQ+
Sbjct  207  QSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVASQVIPANWAPMAVYRSFVQY 266

Sequence Alignment: 28. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 195.0 bits 1041,  Expect = 2e-51
 Identities = 140/238 58%, Positives = 180/238 75%, Gaps = 1/238 0%
Query  31   PGPNITTNYNAPWLPARATWYGQ-PYGSGSTDNGGACGIKNVNLPPYNGMISCGNVPIFK 89
            PGPNIT  Y   WL A+AT+YG  P G+   D+GGACG K+V+  P++GM  CGN PIFK
Sbjct  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
Query  90   DGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEPISAYHFDFSGKAFGAMACPGKETEL 149
            DG  CGSCYE+KC++PA CS +PV + ITD NYE I+AYHFD+SGKAFGAMA  G+E +L
Sbjct  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
Query  150  RKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEAGLP 209
            RKAG + +QFRRV+C+YP   K+ FHVEKGS+PNYLA+LVK+ A DG+++ +D++  G  
Sbjct  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
Query  210  AWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLIAKDVIPVNWMPDAIYVSNVQF 268
             + PMK SWGAIWR+D   PLK PF+IR+T+ESG  +   DVIP +W PD +Y S +QF
Sbjct  186  EFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF 244

Sequence Alignment: 29. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 193.4 bits 1032,  Expect = 6e-51
 Identities = 143/236 60%, Positives = 181/236 76%, Gaps = 5/236 2%
Query  26   PPKVPPGPNITTNYNAPWLPARATWYGQPYGSGSTDNGGACGIKNVNLPPYNGMISCGNV 85
            PPKV  G NIT  Y + WL  +ATWYG+P G+G  DNGGACG K+VN  P+N M +CGN+
Sbjct  1    PPKVAKGKNITETYGSDWLERKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNL 60
Query  86   PIFKDGRGCGSCYEVKCEQP--AACSKQPVTVFITDMNYEPISAYHFDFSGKAFGAMACP 143
            PIFKDG  CGSC+E+KC++P  A CS + V V ITDMNYE I+AYHFD++G AFGAMA  
Sbjct  61   PIFKDGL-CGSCFEIKCDKPKPAECSGEAVVVHITDMNYEQIAAYHFDLAGHAFGAMAKK 119
Query  144  GKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVIQMDL 203
            G+E +L KAGIIDM+FRRV+CKY  G+KVTFHVEKGSNPNYLA+LVK+V  DGD++ +D+
Sbjct  120  GQEEKLAKAGIIDMKFRRVKCKY--GEKVTFHVEKGSNPNYLALLVKYVDGDGDIVGVDI 177
Query  204  QEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLIAKDVIPVNWMPDAIYV 263
            +E G  A++P+K SWGAIWR D+  P+K P ++++TTE G      DVIP  W  D  Y 
Sbjct  178  KEKGGDAYQPLKHSWGAIWRKDSPDPIKFPVTVQITTEGGTKTAYDDVIPEGWKADTTYT 237
Query  264  S 264
            +
Sbjct  238  A 238

Sequence Alignment: 30. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 191.7 bits 1022,  Expect = 2e-50
 Identities = 135/191 70%, Positives = 162/191 84%, Gaps = 0/191 0%
Query  79   MISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEPISAYHFDFSGKAFG 138
            M +CGNVPIFKDG+GCGSCYEV+C++   CS  PVTVFITDMNYEPI+ YHFD+SGKAFG
Sbjct  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
Query  139  AMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDV 198
            ++A PG   +LR  GI+D++FRRVRCKYP GQK+ FH+EKG NPNY+AVLVKFVADDGD+
Sbjct  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
Query  199  IQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLIAKDVIPVNWMP 258
            + M++Q+     W+PMKLSWGAIWRMDTA  LK PFSIR+T+ESGK +IAKD+IP NW P
Sbjct  121  VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRP 180
Query  259  DAIYVSNVQFY 269
            DA+Y SNVQFY
Sbjct  181  DAVYTSNVQFY 191

Sequence Alignment: 31. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 187.6 bits 1000,  Expect = 4e-49
 Identities = 144/265 54%, Positives = 188/265 70%, Gaps = 10/265 3%
Query  1    MGSLTTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGST 60
            M  +++N   A+A+VA L    +     V     +  +Y + WLPA+ATWYG P G+G  
Sbjct  1    MAGVSSN---AIALVALLSMLFTSVRSAVNYDTAVARSYTSGWLPAKATWYGAPNGAGPD 57
Query  61   DNGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPA--ACSKQPVTVFIT 118
            DNGGACG KNVN  P + M +CGN PIF  G GCG CYE+KCE     +CS QP  + IT
Sbjct  58   DNGGACGFKNVNQYPISSMGACGNEPIFAGGEGCGMCYEIKCEYSNNPSCSGQPRRIVIT 117
Query  119  DMNYEPISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEK 178
            DMNY P++ YH+D+SG AFG+MA  G    LR AGIIDMQFRRV C +PG  KVTFHV++
Sbjct  118  DMNYYPVARYHLDLSGTAFGSMAKYGLNDRLRHAGIIDMQFRRVPCNFPG-MKVTFHVQR 176
Query  179  GSNPNYLAVLVKFVADDGDVIQMDLQEA--GLPA--WRPMKLSWGAIWRMDTATPLKAPF 234
            GSNPNYLAVLV++V  DG V++M+L +   G P   W+ M+ SWG++WRMDT  P++ PF
Sbjct  177  GSNPNYLAVLVEYVNVDGTVVRMELMQTMNGRPTGYWQDMRRSWGSVWRMDTNRPVQGPF 236
Query  235  SIRVTTESGKSLIAKDVIPVNWMPDAIYVSNVQFY 269
            SIR+T+++GK+L+A + IP  W  D  Y SN+QFY
Sbjct  237  SIRITSDTGKTLVANNAIPAYWQQDHAYWSNLQFY 271

Sequence Alignment: 32. Allergen Name: Ory s 1 Sequence ID: AAF72989

 Score = 186.9 bits 996,  Expect = 6e-49
 Identities = 136/227 59%, Positives = 174/227 76%, Gaps = 3/227 1%
Query  41   APWLPARATWYGQPYGSGSTDNGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEV 100
            A W  A+ATWYGQP G+G+ DNGGACG K VN  P+ GM SCGN P++K G+GCGSCY V
Sbjct  41   AAWGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV 100
Query  101  KCEQPAACSKQPVTVFITDMNYEPISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFR 160
            +C +  ACS    TV ITDMNY P+S YHFD+SG AFG +A PG+  +LR+AGIID+QF 
Sbjct  101  RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFA 160
Query  161  RVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEAGLPA--WRPMKLSW 218
            RV C++PG  KV FHVE+GS+P YLAVLV++   DGDV Q+DL+EAG     W PM+ SW
Sbjct  161  RVPCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESW 219
Query  219  GAIWRMDTATPLKAPFSIRVTTESGKSLIAKDVIPVNWMPDAIYVSNVQF 268
            G++WR+D+   L+APFSIR+ ++SGK+L+A DVIP+NW P+  Y S VQ+
Sbjct  220  GSVWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQY 269

Sequence Alignment: 33. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 183.7 bits 978,  Expect = 6e-48
 Identities = 135/229 58%, Positives = 167/229 72%, Gaps = 6/229 2%
Query  39   YNAPWLPARATWYGQPYGSGSTDNGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCY 98
            Y   WLPA+ATWYGQP G+G  DNGGACG KN N  P+  M SCGN P+F+DG+GCG+CY
Sbjct  27   YTNDWLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACY 86
Query  99   EVKCEQPAACSKQPVTVFITDMNYEPISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQ 158
            +++C    +CS QP TV ITDMNY P++ YHFD+SG AFGAMA PG   +LR AGIID+Q
Sbjct  87   QIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQ 146
Query  159  FRRVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEA---GLPA--WRP 213
            FRRV C Y  G  V FHVE GSNP YLAVLV+F   DG V+Q+D+ E+   G P   W P
Sbjct  147  FRRVPC-YHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTP 205
Query  214  MKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLIAKDVIPVNWMPDAIYVSNVQF 268
            M+ SWG+IWR+D    L+ P S+R+ +ESG+++IA  VIP NW  +  Y S VQF
Sbjct  206  MRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQF 260

Sequence Alignment: 34. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 182.6 bits 972,  Expect = 1e-47
 Identities = 143/265 53%, Positives = 191/265 72%, Gaps = 23/265 8%
Query  1    MGSLTTNIVLAVAVVAALVGGGSCGPPKVPP----------GPNITTN----YNAPWLPA 46
            MGSL++  + A AV  +L+  G C                 G +  ++    Y  PW  A
Sbjct  1    MGSLSS--LAAAAVFLSLLAVGHCAAADFNATDADADFAGNGWDFNSSDAAVYWGPWTKA 58
Query  47   RATWYGQPYGSGSTDNGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPA 106
            RATWYGQP G+G  DNGGACG K+ N  P+  M SCGN P+FKDG+GCGSCY+++C +  
Sbjct  59   RATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSCYKIRCTKDQ 118
Query  107  ACSKQPVTVFITDMNYEPISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKY 166
            +CS +  TV ITDMNY P++ +HFD+SG AFG +A PG   +LR +GIID++F RV C++
Sbjct  119  SCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIIDIEFTRVPCEF 178
Query  167  PGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEA----GLPA--WRPMKLSWGA 220
            PG  K+ FHVE+ SNP Y+AVLV++   DGDV+Q+DL E+    G P   W PM+ SWG+
Sbjct  179  PG-LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGS 237
Query  221  IWRMDTATPLKAPFSIRVTTESGKSLIAKDVIPVNWMPDAIYVSNVQF 268
            IWR+DT   L+APFSIR+  ESGK+L+A +VIP NW P+  Y S VQ+
Sbjct  238  IWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQY 285

Sequence Alignment: 35. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 152.6 bits 804,  Expect = 2e-38
 Identities = 149/242 61%, Positives = 182/242 75%, Gaps = 15/242 6%
Query  26   PPKVPPGPNITTNYNAP----WLPARATWYGQPYGSGSTDNGGACGIKNVNLPPYNGMIS 81
            PP   PG   +   +      WL ARATWYG P G+G  DNGGACG KNVNLPP++ M S
Sbjct  71   PPIPSPGTGSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTS 130
Query  82   CGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEPISAYHFDFSGKAFGAMA 141
            CGN P+FKDG+GCGSCY+++C    ACS  P TV ITDMNY P+S YHFD+SG AFGAMA
Sbjct  131  CGNEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMA 190
Query  142  CPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVIQM 201
               +  ELR AGIID+QFRRV C+YPG   VTFHVE+GSNP Y+A+LV++   DGDV+Q+
Sbjct  191  KDNRNDELRHAGIIDIQFRRVPCQYPG-LTVTFHVEQGSNPVYMAILVEYENGDGDVVQV 249
Query  202  DLQEA--------GLPA--WRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLIAKDV 251
            DL E+        G P   W PM+ SWG+IWR+DT  PL+ PFS+R+T ESGK+LIA  V
Sbjct  250  DLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQV 309
Query  252  IPVNWMPDAIYVSNVQF 268
            IP +W P+ +Y S VQF
Sbjct  310  IPADWQPNTVYSSIVQF 326

Sequence Alignment: 36. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 152.0 bits 800,  Expect = 2e-38
 Identities = 121/260 46%, Positives = 170/260 65%, Gaps = 9/260 3%
Query  6    TNIVLAVAVVAA-LVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGSTDNGG 64
            + ++  +A+++  LV    C  PK     +  +  ++ W PA ATWYG   G GS   GG
Sbjct  10   SELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSDWSPAVATWYGPANGDGS--EGG 67
Query  65   ACGIKN-VNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITD--MN 121
            ACG  N V  PP++ +IS G+  I+  G+GCGSCYEVKC   +ACS  PV V ITD    
Sbjct  68   ACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECAG 127
Query  122  YEPISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSN 181
                + YHFD+SG AFGAMA  G++  LR AG I++Q RR+ C YPG + + FHV+ GSN
Sbjct  128  CGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPG-RSIAFHVDSGSN 186
Query  182  PNYLAVLVKFVADDGDVIQMDLQEA-GLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTT 240
              Y+A LV++   DGD+ +++L+EA    +W  M+ SWGA+W+ D  +PL+APFSI++TT
Sbjct  187  QEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLTT 246
Query  241  -ESGKSLIAKDVIPVNWMPDAIYVSNVQF 268
             ESG++++A +VIP  W P   Y S V F
Sbjct  247  LESGQTIVANNVIPAGWTPGQTYRSIVNF 275

Sequence Alignment: 37. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 137.2 bits 717,  Expect = 6e-34
 Identities = 108/222 48%, Positives = 145/222 65%, Gaps = 11/222 4%
Query  43   WLPARATWYGQPYGSGSTDNGGACGIKN-VNLPPYNGMISCGNVPIFKDGRGCGSCYEVK 101
            W    ATWYG P G GS   GGACG ++ V   P++ MI+ G   +FK+G+GCGSCY++K
Sbjct  45   WSSGGATWYGGPQGDGS--EGGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIK 102
Query  102  CEQPAACSKQPVTVFITDMNYEPIS---AYHFDFSGKAFGAMACPGKETELRKAGIIDMQ 158
            C    ACS +PVTV ITD     +    A HFD SG AFGAMA  G    LR AG++ +Q
Sbjct  103  CTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQ 162
Query  159  FRRVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEA-GLPAWRPMKLS 217
            ++RV C++     V F V+ GSNP YLA+LV++   DGD+  + + +A G   W+ M+ S
Sbjct  163  YKRVPCRF--AMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQS 220
Query  218  WGAIWRMDTAT--PLKAPFSIRVTTESGKSLIAKDVIPVNWMPDAIYVSNVQF 268
            WGA WR+++ T  PL  PFSIR+T+ SGK L+A +VIP  W     Y S V +
Sbjct  221  WGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNY 273

Sequence Alignment: 38. Allergen Name: Ara t expansin Sequence ID: CAB37496

 Score = 90.1 bits 453,  Expect = 9e-20
 Identities = 75/210 35%, Positives = 117/210 55%, Gaps = 7/210 3%
Query  55   YGSGSTDNGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVT 114
            + S S  + GAC   ++    + G I+     I+KDG GCG+C++V+C+ P  CS +  T
Sbjct  34   FSSASALSSGACAYGSMATGFFAGHIAAALPSIYKDGSGCGACFQVRCKNPTLCSSKGTT 93
Query  115  VFITDMNYEPISAYHFDFSGKAFGAMACP--GKETELRKAGIIDMQFRRVRCKYPGGQKV 172
            V +TD+N    +   + +S +AF AMA P  G + +L K GI+D+++RRV C Y G +K+
Sbjct  94   VIVTDLN--KTNQTDLVLSSRAFRAMAKPVVGADRDLLKQGIVDIEYRRVPCDY-GNKKM 150
Query  173  TFHVEKGS-NPNYLAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLK 231
               VE+ S NPNYLA+ + +     +V+ + + + G   W  M  S GA+W  D      
Sbjct  151  NVRVEESSKNPNYLAIKLLYQGGQTEVVAIYIAQVGSSHWSYMTRSHGAVWVTDKVPNGA 210
Query  232  APFSIRVTT-ESGKSLIAKDVIPVNWMPDAIYVSNVQ 267
              F   VT    GK + ++ V+P NW     Y + VQ
Sbjct  211  LQFRFVVTAGYDGKMVWSQRVLPANWEAGKSYDAGVQ 247

Sequence Alignment: 39. Allergen Name: Ory s 1 Sequence ID: BAA85432

 Score = 78.2 bits 386,  Expect = 4e-16
 Identities = 86/248 34%, Positives = 131/248 52%, Gaps = 33/248 13%
Query  10   LAVAVVAALVGGGSCGPP--KVPPGPNITTNYN-APWLPARATWYGQPYGSGSTDNGGAC 66
            LAVA  A +V  G       +  P P   T Y  + W    AT+YG P G G  D GGAC
Sbjct  16   LAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTSDWHDGSATFYGDPSGMGD-DFGGAC 74
Query  67   G-IKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEPI 125
            G + N  +  Y+   +  + P+F DG GCG CYE++C +   C+    +V IT  N  P 
Sbjct  75   GYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPWCNPGSPSVVITGTNLCPP 134
Query  126  SAY--------------HFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQK 171
            + Y              HFD +  +F  +A        R AGI+ +Q+RRV C+  GG  
Sbjct  135  NWYLPNDDGGWCNPPRHHFDMAPPSFLKLA-------QRVAGIVPVQYRRVPCQRTGG-- 185
Query  172  VTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEAGLP-AWRPMKLSWGAIWRMDTATPL 230
            V F ++   N  +L + V  V   GDV  + ++ +G   AW     +WG  +++  A   
Sbjct  186  VRFCLQ--GNHYWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDN 243
Query  231  KAPFSIRVTTESG--KSLIAKDVIPVNWMPDAIYVSNVQFY 269
               +++++TT S   +++I  D I   W+    Y  +  FY
Sbjct  244  SDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCYQGSNNFY 284

Sequence Alignment: 40. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 73.9 bits 362,  Expect = 7e-15
 Identities = 63/200 31%, Positives = 106/200 53%, Gaps = 14/200 7%
Query  62   NGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMN 121
            N G+CG  ++      G ++  +  +F+ G GCG+C++V+C+    CS     V +TD  
Sbjct  50   NAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTD-- 107
Query  122  YEPISAYHFDF--SGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKG 179
             E  S    D+  S  A+ AMA PG   +LR    +D++++RV C+Y  G+ ++  VE+ 
Sbjct  108  -EARSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEK 166
Query  180  SNPNYLAVLVKFVADDG--DVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIR 237
            S P    + ++F+   G  D++ +D+   G   W+ M   +G  W   TA     P+  R
Sbjct  167  SRPPR-ELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFR 223
Query  238  VTTESG---KSLIAK-DVIPVNWMPDAIYVSNVQ 267
            V    G   K + A  +V+P  W    +Y + VQ
Sbjct  224  VVVTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257

Sequence Alignment: 41. Allergen Name: Cyn d 2 Sequence ID: CAA10346

 Score = 52.7 bits 241,  Expect = 7e-09
 Identities = 40/89 44%, Positives = 54/89 60%, Gaps = 4/89 4%
Query  171  KVTFHVEKGSNPNYLAVLVKFVADDGDVI-QMDLQEAGLPAWRPMKLSWGAIWRMDTATP 229
            KVTF VEKGSN  +LAVLVK+   +GD + +++L+E G   W  M    G +W  D+  P
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEP 85
Query  230  LKAPFSIRVTTESGKSLIAKDVIPVNWMPDAIY 262
            LK PF+ R  TE G   +  DV+P  +   A Y
Sbjct  86   LKGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 42. Allergen Name: Dac g 2 Sequence ID: CAA10345

 Score = 52.0 bits 237,  Expect = 1e-08
 Identities = 39/89 43%, Positives = 54/89 60%, Gaps = 4/89 4%
Query  171  KVTFHVEKGSNPNYLAVLVKFVADDGDVI-QMDLQEAGLPAWRPMKLSWGAIWRMDTATP 229
            KVTF VEKGSN  +LAVLVK+   +GD + +++L+E G   W  M    G +W  D+  P
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEP 85
Query  230  LKAPFSIRVTTESGKSLIAKDVIPVNWMPDAIY 262
            L+ PF+ R  TE G   +  DV+P  +   A Y
Sbjct  86   LQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 43. Allergen Name: Poa p 2 Sequence ID: CAA10348

 Score = 52.0 bits 237,  Expect = 1e-08
 Identities = 39/89 43%, Positives = 54/89 60%, Gaps = 4/89 4%
Query  171  KVTFHVEKGSNPNYLAVLVKFVADDGDVI-QMDLQEAGLPAWRPMKLSWGAIWRMDTATP 229
            KVTF VEKGSN  +LAVLVK+   +GD + +++L+E G   W  M    G +W  D+  P
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEP 85
Query  230  LKAPFSIRVTTESGKSLIAKDVIPVNWMPDAIY 262
            L+ PF+ R  TE G   +  DV+P  +   A Y
Sbjct  86   LQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 44. Allergen Name: Phl p 2 Sequence ID: P43214

 Score = 52.0 bits 237,  Expect = 1e-08
 Identities = 39/89 43%, Positives = 54/89 60%, Gaps = 4/89 4%
Query  171  KVTFHVEKGSNPNYLAVLVKFVADDGDVI-QMDLQEAGLPAWRPMKLSWGAIWRMDTATP 229
            KVTF VEKGSN  +LAVLVK+   +GD + +++L+E G   W  M    G +W  D+  P
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEP 85
Query  230  LKAPFSIRVTTESGKSLIAKDVIPVNWMPDAIY 262
            L+ PF+ R  TE G   +  DV+P  +   A Y
Sbjct  86   LQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 45. Allergen Name: Lol p 2 Sequence ID: P14947

 Score = 44.5 bits 194,  Expect = 2e-06
 Identities = 28/91 30%, Positives = 49/91 53%, Gaps = 0/91 0%
Query  172  VTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLK 231
            V F VEKGS+   LA+ +K+  +   + +++L+E G   W  +K +   +W + +  PLK
Sbjct  4    VEFTVEKGSDEKNLALSIKYNKEGDSMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLK 63
Query  232  APFSIRVTTESGKSLIAKDVIPVNWMPDAIY 262
             PF+ R  +E G   +  DV+P ++     Y
Sbjct  64   GPFNFRFVSEKGMRNVFDDVVPADFKVGTTY 94

Sequence Alignment: 46. Allergen Name: Dac g 3 Sequence ID: P93124

 Score = 43.9 bits 191,  Expect = 3e-06
 Identities = 28/91 30%, Positives = 49/91 53%, Gaps = 1/91 1%
Query  171  KVTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPL 230
            KVTF VEKGS+P  L + +K+      + +++L++ G   W P+    G +W + ++ PL
Sbjct  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLT-KKGNLWEVKSSKPL 60
Query  231  KAPFSIRVTTESGKSLIAKDVIPVNWMPDAIY 262
              PF+ R  ++ G   +  +VIP  +     Y
Sbjct  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92

Sequence Alignment: 47. Allergen Name: Lol p 2 Sequence ID: CAA51775

 Score = 43.1 bits 186,  Expect = 4e-06
 Identities = 28/82 34%, Positives = 50/82 60%, Gaps = 2/82 2%
Query  174  FHVEKGSNPNYLAVLVKFVADDGDVI-QMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKA 232
            F VEKGS+   LA+ +K+ + +GD + +++L+E G   W  +K +   +W + +  PLK 
Sbjct  2    FTVEKGSDEKNLALSIKY-SKEGDAMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLKG 60
Query  233  PFSIRVTTESGKSLIAKDVIPVNW 256
            PF+ R  +E G   +  DV+P ++
Sbjct  61   PFNFRFVSEKGMWNVFDDVVPADF 84

Sequence Alignment: 48. Allergen Name: Cyn d 15 Sequence ID: AAP80171

 Score = 43.3 bits 188,  Expect = 4e-06
 Identities = 36/90 40%, Positives = 55/90 61%, Gaps = 7/90 7%
Query  172  VTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLK 231
            + FHVE+ S+P + A+ +K  A +  + Q+D++E G     PM  S G  W +D   PLK
Sbjct  22   IIFHVEE-SSPKF-ALSIKDSAKE--ITQVDVREHGADNMDPMTKS-GDSWTIDK--PLK 74
Query  232  APFSIRVTTESGKSLIAKDVIPVNWMPDAIYVSNVQF 268
             P++IR+  E G S +  DVIP NW     Y + ++F
Sbjct  75   GPLNIRLRAEGGGSRVQDDVIPENWKAGTDYPTKLHF 111

Sequence Alignment: 49. Allergen Name: Dac g 1.0101 Sequence ID: Q7M1X8

 Score = 41.1 bits 172,  Expect = 7e-06
 Identities = 21/32 65%, Positives = 25/32 78%, Gaps = 0/32 0%
Query  27   PKVPPGPNITTNYNAPWLPARATWYGQPYGSG 58
            PKVPPGPNIT  Y   WL A++TWYG+P G+G
Sbjct  2    PKVPPGPNITATYGDKWLDAKSTWYGKPTGAG 33

Sequence Alignment: 50. Allergen Name: Phl p 3.0101 Sequence ID: 2JNZ_A

 Score = 42.1 bits 181,  Expect = 1e-05
 Identities = 25/82 30%, Positives = 47/82 57%, Gaps = 1/82 1%
Query  171  KVTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPL 230
            +VTF V+KGS+P  L + +K+      + +++L++ G   W P+    G +W + ++ PL
Sbjct  14   QVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLT-KKGNVWEVKSSKPL 72
Query  231  KAPFSIRVTTESGKSLIAKDVIP 253
              PF+ R  ++ G   +  +VIP
Sbjct  73   VGPFNFRFMSKGGMRNVFDEVIP 95

Sequence Alignment: 51. Allergen Name: Ant o 1.0101 Sequence ID: Q7M1X6

 Score = 37.9 bits 154,  Expect = 6e-05
 Identities = 19/30 63%, Positives = 23/30 76%, Gaps = 0/30 0%
Query  28   KVPPGPNITTNYNAPWLPARATWYGQPYGS 57
            KVPPGPNIT  Y   WL A++TWYG+P G+
Sbjct  3    KVPPGPNITATYGDKWLDAKSTWYGKPTGA 32

Sequence Alignment: 52. Allergen Name: Lol p 3 Sequence ID: P14948

 Score = 39.5 bits 166,  Expect = 6e-05
 Identities = 26/91 28%, Positives = 46/91 50%, Gaps = 1/91 1%
Query  171  KVTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPL 230
            KV + VEKGS+   L + +K+      + +++L++ G   W PM    G +W + +A PL
Sbjct  2    KVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMT-KKGNLWEVKSAKPL 60
Query  231  KAPFSIRVTTESGKSLIAKDVIPVNWMPDAIY 262
              P + R  ++ G   +  +VIP  +     Y
Sbjct  61   TGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTY 92

Sequence Alignment: 53. Allergen Name: Tri a 3 Sequence ID: CAA90746

 Score = 36.3 bits 149,  Expect = 0.0006
 Identities = 21/85 24%, Positives = 47/85 55%, Gaps = 1/85 1%
Query  171  KVTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPL 230
            KV + V+KGS+   LA+ + +   +  + +++L++ G   W+P+    G +W +  + PL
Sbjct  24   KVKLTVQKGSDKKKLALKIDYTRPNDSLSEVELRQYGSEEWQPLT-KKGDVWEVSCSKPL 82
Query  231  KAPFSIRVTTESGKSLIAKDVIPVNW 256
              PF+ R  +++G   +  +V   ++
Sbjct  83   VGPFNFRFLSKNGMKKVFDEVFSTDF 108

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.