The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGSLVNNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAP
DNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDM
NYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGC
NPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTS
ESGKKVIAKDVIPANWRPDAVYTSNVQFY
Sequence Info Allergen Name Length Opt Bits Score E Value
P58738 Zea m 1 269 1895 314.9 1.9e-87
ACA23876 Pas n 1.0101 265 1593 266.4 7.4e-73
AAF72990 Ory s 1 269 1469 246.5 7.4e-67
Q07154 Zea m 1 191 1325 223.4 4.8e-60
AAF72983 Ory s 1 267 1243 210.2 6.2e-56
AAF72991 Ory s 1 267 1227 207.6 3.7e-55
P43213 Phl p 1 263 1148 194.9 2.4e-51
CAA81613 Phl p 1.0101 263 1143 194.1 4.2e-51
P43216 Hol l 1 265 1137 193.2 8.2e-51
AAL14077 Cyn d 1.0202 262 1124 191.1 3.5e-50
A0A4D6FZ45 Uro m 1.0101 262 1124 191.1 3.5e-50
AAL14079 Cyn d 1.0203 262 1124 191.1 3.5e-50
AAL14078 Cyn d 1 262 1121 190.6 4.8e-50
Q41260 Pha a 1 269 1118 190.1 6.9e-50
O04701 Cyn d 1 246 1116 189.8 7.9e-50
CAA93121 Hol l 1.0102 248 1116 189.8 8e-50
CAA10140 Hol l 1 263 1116 189.8 8.4e-50
AAF72987 Ory s 1 275 1114 189.5 1.1e-49
QCX36431 Zoy m 1.0101 272 1110 188.8 1.7e-49
CAA10520 Poa p a 263 1105 188.0 2.9e-49
A0A4D6G2J8 Uro m 1.0201 229 1101 187.4 3.9e-49
CAB63699 Lol p 1.0103 263 1099 187.1 5.6e-49
AAA63279 Lol p 1.0101 263 1090 185.6 1.5e-48
P14946 Lol p 1 263 1088 185.3 1.9e-48
AAA63278 Lol p 1.0102 252 1086 185.0 2.3e-48
AAF80379 Cyn d 1.0204 244 1085 184.8 2.5e-48
AAK96255 Cyn d 1.0201 244 1080 184.0 4.3e-48
AAF72984 Ory s 1 268 1062 181.1 3.5e-47
AAF72985 Ory s 1 286 1042 177.9 3.5e-46
Q40638 Ory s 1 263 1031 176.1 1.1e-45
AAD10496 Tri a ps93 271 1030 176.0 1.3e-45
AAB61710 Ory s 1 261 1027 175.5 1.7e-45
ABC58726 Sor h 1.0101 239 1000 171.2 3.1e-44
AAF72989 Ory s 1 271 990 169.6 1.1e-43
AAF72988 Ory s 1 327 820 142.3 2.1e-35
AAA50175 Gly m 2 277 775 135.0 2.7e-33
AAF72986 Ory s 1 275 714 125.2 2.4e-30
CAB37496 Ara t expansin 265 426 79.0 1.9e-16
AAG13596 Ory s 1 275 390 73.2 1.1e-14
BAA85432 Ory s 1 284 378 71.3 4.3e-14
CAA10346 Cyn d 2 122 236 48.5 1.4e-07
CAA10345 Dac g 2 122 232 47.8 2.1e-07
CAA10348 Poa p 2 122 232 47.8 2.1e-07
P43214 Phl p 2 122 232 47.8 2.1e-07
P14947 Lol p 2 97 213 44.8 1.4e-06
P93124 Dac g 3 96 209 44.1 2.2e-06
CAA51775 Lol p 2 88 201 42.9 4.8e-06
Q7M1X8 Dac g 1.0101 34 186 40.5 9.8e-06
2JNZ_A Phl p 3.0101 108 190 41.1 2e-05
P14948 Lol p 3 97 183 40.0 3.9e-05
AAP80171 Cyn d 15 112 183 40.0 4.6e-05
Q7M1X6 Ant o 1.0101 32 168 37.6 6.9e-05
CAA90746 Tri a 3 118 164 36.9 0.0004
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 314.9 bits 1895,  Expect = 2e-87
 Identities = 269/269 100%, Positives = 269/269 100%, Gaps = 0/269 0%
Query  1    MGSLVNNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAP 60
            MGSLVNNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAP
Sbjct  1    MGSLVNNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAP 60
Query  61   DNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDM 120
            DNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDM
Sbjct  61   DNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDM 120
Query  121  NYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGC 180
            NYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGC
Sbjct  121  NYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGC 180
Query  181  NPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTS 240
            NPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTS
Sbjct  181  NPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTS 240
Query  241  ESGKKVIAKDVIPANWRPDAVYTSNVQFY 269
            ESGKKVIAKDVIPANWRPDAVYTSNVQFY
Sbjct  241  ESGKKVIAKDVIPANWRPDAVYTSNVQFY 269

Sequence Alignment: 2. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 266.4 bits 1593,  Expect = 7e-73
 Identities = 224/265 84%, Positives = 243/265 91%, Gaps = 3/265 1%
Query  1    MGSLVNNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAP 60
            MGSL   I+ V AVLAALVAGGSCGPPKVPPGPNITTNYNGKWL A+ATWYGQPNGAG  
Sbjct  1    MGSLAK-IVAVAAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLPAKATWYGQPNGAGPD 59
Query  61   DNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDM 120
            DNGGACGIKNVNLPPY+G TACGN PIFKDGKGCGSCYE+RC  KPECSG PVTV+ITDM
Sbjct  60   DNGGACGIKNVNLPPYNGFTACGNPPIFKDGKGCGSCYEIRCN-KPECSGQPVTVFITDM 118
Query  121  NYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGC 180
            NYEPIAPYHFDLSGKAFG++AKPGLNDK+RH GI D+EFRRVRCKY  GQKIVFH+EKG 
Sbjct  119  NYEPIAPYHFDLSGKAFGAMAKPGLNDKLRHYGIFDLEFRRVRCKYQGGQKIVFHVEKGS 178
Query  181  NPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTS 240
            NPNYLA+LVK+VADDGDIVLME+++K S++WKPMKLSWGAIWRMDT KAL  PFSIRLTS
Sbjct  179  NPNYLAMLVKFVADDGDIVLMELKEK-SSDWKPMKLSWGAIWRMDTPKALVPPFSIRLTS 237
Query  241  ESGKKVIAKDVIPANWRPDAVYTSNVQF 268
            ESGKKVIA+DVIP NW+PD VY SNVQF
Sbjct  238  ESGKKVIAQDVIPVNWKPDTVYNSNVQF 265

Sequence Alignment: 3. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 246.5 bits 1469,  Expect = 7e-67
 Identities = 196/269 72%, Positives = 230/269 85%, Gaps = 0/269 0%
Query  1    MGSLVNNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAP 60
            MGSL  NI++  AV+AALV GGSCGPPKVPPGPNITTNYN  WL ARATWYGQP G+G+ 
Sbjct  1    MGSLTTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGST 60
Query  61   DNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDM 120
            DNGGACGIKNVNLPPY+GM +CGNVPIFKDG+GCGSCYEV+C++   CS  PVTV+ITDM
Sbjct  61   DNGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDM 120
Query  121  NYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGC 180
            NYEPI+ YHFD+SGKAFG++A PG   ++R  GI+D++FRRVRCKYP GQK+ FH+EKG 
Sbjct  121  NYEPISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGS 180
Query  181  NPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTS 240
            NPNYLAVLVK+VADDGD++ M++Q+     W+PMKLSWGAIWRMDTA  LK PFSIR+T+
Sbjct  181  NPNYLAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTT 240
Query  241  ESGKKVIAKDVIPANWRPDAVYTSNVQFY 269
            ESGK +IAKDVIP NW PDA+Y SNVQFY
Sbjct  241  ESGKSLIAKDVIPVNWMPDAIYVSNVQFY 269

Sequence Alignment: 4. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 223.4 bits 1325,  Expect = 5e-60
 Identities = 186/191 97%, Positives = 191/191 100%, Gaps = 0/191 0%
Query  79   MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDMNYEPIAPYHFDLSGKAFG 138
            MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTV+ITDMNYEPIAPYHFDLSGKAFG
Sbjct  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
Query  139  SLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDI 198
            SLAKPGLNDK+RHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNY+AVLVK+VADDGDI
Sbjct  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
Query  199  VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDVIPANWRP 258
            VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKD+IPANWRP
Sbjct  121  VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRP 180
Query  259  DAVYTSNVQFY 269
            DAVYTSNVQFY
Sbjct  181  DAVYTSNVQFY 191

Sequence Alignment: 5. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 210.2 bits 1243,  Expect = 6e-56
 Identities = 167/261 63%, Positives = 211/261 80%, Gaps = 2/261 0%
Query  6    NNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAPDNGGA 65
            +++++   V+AA+V+  SCGPPKVPPGPNITT+Y  KWL A+ATWYG P GAG  DNGGA
Sbjct  4    SSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDNGGA 63
Query  66   CGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVYITDMNYEP 124
            CG K+V+  P+ GM +CGN PIFKDGKGCGSC+E++C  KPE CS  P  +++TDMN EP
Sbjct  64   CGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCS-KPEACSDKPALIHVTDMNDEP 122
Query  125  IAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNY 184
            IA YHFDLSG AFG++AK G ++++R  GI+D +FRRV+CKYPA  KI FHIEK  NPNY
Sbjct  123  IAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNY 182
Query  185  LAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGK 244
            LA+LVKYVA DGD+V +EI++K S EWK +K SWGAIWR+DT K LKGPFS+R+T+E G+
Sbjct  183  LALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGE 242
Query  245  KVIAKDVIPANWRPDAVYTSNVQ 267
            K+IA+D IP  W+ D+VY SNVQ
Sbjct  243  KIIAEDAIPDGWKADSVYKSNVQ 265

Sequence Alignment: 6. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 207.6 bits 1227,  Expect = 4e-55
 Identities = 162/259 62%, Positives = 207/259 79%, Gaps = 2/259 0%
Query  8    IMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAPDNGGACG 67
            +++   V AA+V+  SCGPPKVPPGPNIT  Y  +WL AR TWYG+P GAG  DNGGACG
Sbjct  6    LLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDNGGACG 65
Query  68   IKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVYITDMNYEPIA 126
             K+++  P+ GM +CGN PIFKDGKGCGSC+EV+C  KPE CS  PV ++ITDMN EPIA
Sbjct  66   YKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCS-KPEACSDKPVIIHITDMNTEPIA 124
Query  127  PYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLA 186
             YHFDLSG AFG++AK G ++++R  GI+D++FRRVRCKYP   K+ FH+EKG NPNY+A
Sbjct  125  AYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFA 184
Query  187  VLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKV 246
            VLVKYV  DGD+V +E+++K S EWKP+  SWGAIWR+DT K LKGPFS+R+T+ES +K+
Sbjct  185  VLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKL 244
Query  247  IAKDVIPANWRPDAVYTSNVQ 267
            +A DVIP NW+ +A+Y S +Q
Sbjct  245  VANDVIPDNWKANALYKSEIQ 265

Sequence Alignment: 7. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 194.9 bits 1148,  Expect = 2e-51
 Identities = 157/261 60%, Positives = 197/261 75%, Gaps = 4/261 1%
Query  1    MGSLVNNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAP 60
            M S  + ++VV  VL A+  G + G PKVPPGPNIT  Y  KWL A++TWYG+P GAG  
Sbjct  1    MASSSSVLLVV--VLFAVFLGSAYGIPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPK 58
Query  61   DNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVYITD 119
            DNGGACG K+V+ PP+SGMT CGN PIFK G+GCGSC+E++C  KPE CSG PV V+ITD
Sbjct  59   DNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCT-KPEACSGEPVVVHITD 117
Query  120  MNYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKG 179
             N EPIAPYHFDLSG AFG++AK G   K+R  G ++++FRRV+CKYP G K+ FH+EKG
Sbjct  118  DNEEPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKG 177
Query  180  CNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLT 239
             NPNYLA+LVKYV  DGD+V ++I++K   +W  +K SWGAIWR+DT   L GPF++R T
Sbjct  178  SNPNYLALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYT 237
Query  240  SESGKKVIAKDVIPANWRPDAVYTS 264
            +E G K  A+DVIP  W+ D  Y S
Sbjct  238  TEGGTKTEAEDVIPEGWKADTSYES 262

Sequence Alignment: 8. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 194.1 bits 1143,  Expect = 4e-51
 Identities = 154/257 59%, Positives = 199/257 77%, Gaps = 3/257 1%
Query  6    NNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAPDNGGA 65
            +++++V A++A ++ G + G PKVPPGPNIT  Y  KWL A++TWYG+P  AG  DNGGA
Sbjct  5    SSVLLVVALFAVFL-GSAHGIPKVPPGPNITATYGDKWLDAKSTWYGKPTAAGPKDNGGA 63
Query  66   CGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVYITDMNYEP 124
            CG K+V+ PP+SGMT CGN PIFK G+GCGSC+E++C  KPE CSG PV V+ITD N EP
Sbjct  64   CGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCT-KPEACSGEPVVVHITDDNEEP 122
Query  125  IAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNY 184
            IA YHFDLSG AFGS+AK G   K+R  G ++++FRRV+CKYP G K+ FH+EKG NPNY
Sbjct  123  IAAYHFDLSGIAFGSMAKKGDEQKLRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNY 182
Query  185  LAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGK 244
            LA+LVK+VA DGD+V ++I++K   +W  +K SWGAIWR+DT + LKGPF++R T+E G 
Sbjct  183  LALLVKFVAGDGDVVAVDIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGT 242
Query  245  KVIAKDVIPANWRPDAVYTS 264
            K  AKDVIP  W+ D  Y S
Sbjct  243  KGEAKDVIPEGWKADTAYES 262

Sequence Alignment: 9. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 193.2 bits 1137,  Expect = 8e-51
 Identities = 153/261 58%, Positives = 196/261 75%, Gaps = 2/261 0%
Query  1    MGSLVNNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAP 60
            M S   +++++ A L A+  G + G  KVPPGPNIT  Y  +WL A++TWYG+P GAG  
Sbjct  1    MASSSRSVLLLVAALFAVFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPK 60
Query  61   DNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVYITD 119
            DNGGACG K+V+ PP+SGMT CGN PIFKDG+GCGSC+E++C  KPE CSG PVTV+ITD
Sbjct  61   DNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIKCT-KPESCSGEPVTVHITD 119
Query  120  MNYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKG 179
             N EPIAPYHFDLSG AFGS+AK G   K+R  G ++++FRRV+CKYP G K  FH+EKG
Sbjct  120  DNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKG 179
Query  180  CNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLT 239
             NPNYLA+LVKY+  DGD+V ++I++K   +W  +K SWGA+WR+DT   L GPF++R T
Sbjct  180  SNPNYLALLVKYIDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYT 239
Query  240  SESGKKVIAKDVIPANWRPDAVY 262
            +E G K  A+DVIP  W+ D  Y
Sbjct  240  TEGGTKGEAEDVIPEGWKADTAY 262

Sequence Alignment: 10. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 191.1 bits 1124,  Expect = 3e-50
 Identities = 159/260 61%, Positives = 193/260 74%, Gaps = 2/260 0%
Query  8    IMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQ-PNGAGAPDNGGAC 66
            + VV  VLA++V G  C      PGPNIT  Y  KWL A+AT+YG  P GA   D+GGAC
Sbjct  2    LAVVAVVLASMVGGALCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  67   GIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDMNYEPIA 126
            G K+V+  P+ GMT CGN PIFKDG  CGSCYE++CKE  ECSG PV + ITD NYE IA
Sbjct  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  127  PYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLA 186
             YHFDLSGKAFG++AK G  DK+R  G + ++FRRV+C+YP+  KI FH+EKG NPNYLA
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  187  VLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKV 246
            +LVKY A DG+IV ++I+ K S E+ PMK SWGAIWR+D  K LKGPF+IRLTSESG  V
Sbjct  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
Query  247  IAKDVIPANWRPDAVYTSNVQF 268
              +DVIP +W+PD VY S +QF
Sbjct  241  EQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 11. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 191.1 bits 1124,  Expect = 3e-50
 Identities = 159/260 61%, Positives = 193/260 74%, Gaps = 2/260 0%
Query  8    IMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQ-PNGAGAPDNGGAC 66
            + VV  VLA++V G  C      PGPNIT  Y  KWL A+AT+YG  P GA   D+GGAC
Sbjct  2    LAVVAVVLASMVGGALCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  67   GIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDMNYEPIA 126
            G K+V+  P+  MT CGN PIFKDG GCGSCYE++CKE  ECSG PV + ITD NYE IA
Sbjct  61   GYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  127  PYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLA 186
             YHFDLSGKAFG++AK G  DK+R  G + ++FRRV+C+YP+  KI FH+EKG NPNYLA
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  187  VLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKV 246
            +LVKY A DG+IV ++I+ K S E+ PMK SWGAIWR+D  K LKGPF+IRLTSESG  V
Sbjct  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
Query  247  IAKDVIPANWRPDAVYTSNVQF 268
              +DVIP +W+PD VY S +QF
Sbjct  241  EQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 12. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 191.1 bits 1124,  Expect = 3e-50
 Identities = 159/260 61%, Positives = 193/260 74%, Gaps = 2/260 0%
Query  8    IMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQ-PNGAGAPDNGGAC 66
            + VV  VLA++V G  C      PGPNIT  Y  KWL A+AT+YG  P GA   D+GGAC
Sbjct  2    LAVVAVVLASMVGGALCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  67   GIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDMNYEPIA 126
            G K+V+  P+  MT CGN PIFKDG GCGSCYE++CKE  ECSG PV + ITD NYE IA
Sbjct  61   GYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  127  PYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLA 186
             YHFDLSGKAFG++AK G  DK+R  G + ++FRRV+C+YP+  KI FH+EKG NPNYLA
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  187  VLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKV 246
            +LVKY A DG+IV ++I+ K S E+ PMK SWGAIWR+D  K LKGPF+IRLTSESG  V
Sbjct  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
Query  247  IAKDVIPANWRPDAVYTSNVQF 268
              +DVIP +W+PD VY S +QF
Sbjct  241  EQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 13. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 190.6 bits 1121,  Expect = 5e-50
 Identities = 159/260 61%, Positives = 193/260 74%, Gaps = 2/260 0%
Query  8    IMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQ-PNGAGAPDNGGAC 66
            +  V  VLA++V G  C      PGPNIT  Y  KWL A+AT+YG  P GA   D+GGAC
Sbjct  2    LAAVAVVLASMVGGAWCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  67   GIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDMNYEPIA 126
            G K+V+  P+ GMT CGN PIFKDG GCGSCYE++CKE  ECSG PV + ITD NYE IA
Sbjct  61   GYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  127  PYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLA 186
             YHFDLSGKAFG++AK G  DK+R  G + ++FRRV+C+YP+  KI FH+EKG +PNYLA
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLA 180
Query  187  VLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKV 246
            +LVKY A DG+IV ++I+ K S  + PMKLSWGAIWRMD  K LKGPF+IRLTSESG  V
Sbjct  181  LLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHV 240
Query  247  IAKDVIPANWRPDAVYTSNVQF 268
              +DVIP +W+PD VY S +QF
Sbjct  241  EQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 14. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 190.1 bits 1118,  Expect = 7e-50
 Identities = 151/252 59%, Positives = 194/252 76%, Gaps = 3/252 1%
Query  6    NNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAPDNGGA 65
            ++++VV A+LA +V G + G  KVPPGPNIT  Y  KWL A++TWYG+P GAG  DNGGA
Sbjct  11   SSLLVVAALLAVFV-GSAQGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGA 69
Query  66   CGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVYITDMNYEP 124
            CG K+V+  P++GMT CGN PIFKDG+GCGSC+E++C  KPE CSG P+TV+ITD N EP
Sbjct  70   CGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFELKCS-KPESCSGEPITVHITDDNEEP 128
Query  125  IAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNY 184
            IAPYHFDLSG AFGS+AK G  + +R  G ++++FRRV+CKYP G K  FH+EKG NPNY
Sbjct  129  IAPYHFDLSGHAFGSMAKKGEEENVRGAGELELQFRRVKCKYPDGTKPTFHVEKGSNPNY 188
Query  185  LAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGK 244
            LA+LVKYV  DGD+V ++I++K   +W  +K SWGAIWR+DT   L GPF++R T+E G 
Sbjct  189  LALLVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGT 248
Query  245  KVIAKDVIPANWRPD 259
            K   +DVIP  W+ D
Sbjct  249  KAEFEDVIPEGWKAD 263

Sequence Alignment: 15. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 189.8 bits 1116,  Expect = 8e-50
 Identities = 156/238 65%, Positives = 185/238 77%, Gaps = 1/238 0%
Query  31   PGPNITTNYNGKWLTARATWYGQ-PNGAGAPDNGGACGIKNVNLPPYSGMTACGNVPIFK 89
            PGPNIT  Y  KWL ARAT+YG  P GA   D+GGACG K+V+ PP+ GMTACGN PIFK
Sbjct  6    PGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFK 65
Query  90   DGKGCGSCYEVRCKEKPECSGNPVTVYITDMNYEPIAPYHFDLSGKAFGSLAKPGLNDKI 149
            DG GC +CYE++CKE  ECSG PV V ITD NYE IA YHFDLSGKAFG++AK G  DK+
Sbjct  66   DGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL 125
Query  150  RHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSA 209
            R  G + ++FRRV+CKYP+G KI FHIEKG N +YLA+LVKY A DG+IV ++I+ + S 
Sbjct  126  RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD 185
Query  210  EWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDVIPANWRPDAVYTSNVQF 268
            E+ PMK SWGAIWR+D  K LKGPFSIRLTSE G  ++  DVIPANW+PD VYTS +QF
Sbjct  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQF 244

Sequence Alignment: 16. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 189.8 bits 1116,  Expect = 8e-50
 Identities = 148/241 61%, Positives = 185/241 76%, Gaps = 2/241 0%
Query  21   GGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAPDNGGACGIKNVNLPPYSGMT 80
            G + G  KVPPGPNIT  Y  +WL A++TWYG+P GAG  DNGGACG K+V+ PP+SGMT
Sbjct  4    GSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMT 63
Query  81   ACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVYITDMNYEPIAPYHFDLSGKAFGS 139
             CGN PIFKDG+GCGSC+E++C  KPE CSG PVTV+ITD N EPIAPYHFDLSG AFGS
Sbjct  64   GCGNTPIFKDGRGCGSCFEIKCS-KPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGS 122
Query  140  LAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIV 199
            +AK G   K+R  G ++++FRRV+CKYP G K  FH+EKG NPNYLA+LVKY+  DGD+V
Sbjct  123  MAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVV 182
Query  200  LMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDVIPANWRPD 259
             ++I++K   +W  +K SWGA+WR+DT   L GPF++R T+E G K  A+DVIP  W+ D
Sbjct  183  AVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKAD 242
Query  260  AVY 262
              Y
Sbjct  243  TAY 245

Sequence Alignment: 17. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 189.8 bits 1116,  Expect = 8e-50
 Identities = 149/255 58%, Positives = 196/255 76%, Gaps = 3/255 1%
Query  8    IMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAPDNGGACG 67
            +++V A++A ++ G + G  KVPPGPNIT  Y  KWL A++TWYG+P GAG  DNGGACG
Sbjct  7    VLLVVALFAVFL-GTAHGIAKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGGACG 65
Query  68   IKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVYITDMNYEPIA 126
             K+V+ PP+SGMT CGN PIFK G+GCGSC+E++C  KPE CSG P+ V+ITD N EPIA
Sbjct  66   YKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCT-KPESCSGEPIVVHITDDNEEPIA 124
Query  127  PYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLA 186
             YH+DLSGKAFG++AK G   K+R  G ++++FRRV+C+YP G K+ FH+EKG NPNYLA
Sbjct  125  AYHLDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPKGTKVTFHVEKGSNPNYLA 184
Query  187  VLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKV 246
            +LVKYV  DGD+V ++I++K   +W  +K SWGA+WR+DT   L GPF++R T+E G KV
Sbjct  185  LLVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKV 244
Query  247  IAKDVIPANWRPDAVYTS 264
             A+DVIP  W+ D  Y S
Sbjct  245  EAEDVIPEGWKADTAYES 262

Sequence Alignment: 18. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 189.5 bits 1114,  Expect = 1e-49
 Identities = 158/264 59%, Positives = 197/264 74%, Gaps = 10/264 3%
Query  1    MGSLVNNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAP 60
            MGS V  I+   A+L+ LV  GSC    V    +  + Y   WL ARATWYG P GAG  
Sbjct  5    MGSKVAAIL---AILSVLVVHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPD 61
Query  61   DNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDM 120
            DNGGACG KNVN  P+S MT+CGN PIFKDGKGCGSCY++RC + P CSGN  TV ITDM
Sbjct  62   DNGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDM 121
Query  121  NYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGC 180
            NY P+A YHFDLSG AFG++AKPGLNDK+RH GI+D++FRRV C YP G KI FH+E+G 
Sbjct  122  NYYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYP-GLKINFHVEEGS 180
Query  181  NPNYLAVLVKYVADDGDIVLMEIQDKLSAE------WKPMKLSWGAIWRMDTAKALKGPF 234
            NP Y+AVLV+Y   DGD+V +++ +  SA       W PM+ SWG+IWR+D+   L+ PF
Sbjct  181  NPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPF 240
Query  235  SIRLTSESGKKVIAKDVIPANWRPDAVYTSNVQF 268
            S+R+ S+SGK ++A +VIPANW P++ Y S VQF
Sbjct  241  SLRIRSDSGKTLVANNVIPANWSPNSNYRSIVQF 274

Sequence Alignment: 19. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 188.8 bits 1110,  Expect = 2e-49
 Identities = 154/260 59%, Positives = 194/260 74%, Gaps = 2/260 0%
Query  8    IMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQ-PNGAGAPDNGGAC 66
            +  V  +L+A+V    C      PGPNIT  YN +W  A+AT+YG  P GA   D+GGAC
Sbjct  12   LAAVAVLLSAMVGSALCEIGD-KPGPNITATYNEEWQDAKATFYGSNPRGAAPDDDGGAC 70
Query  67   GIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDMNYEPIA 126
            G KNV+  P+ GMT CGN PIFKDG GCGSC+E++CKE  ECS  PV + ITD NYE IA
Sbjct  71   GYKNVDKAPFFGMTGCGNEPIFKDGLGCGSCFEIKCKEPAECSDKPVLIRITDKNYEHIA 130
Query  127  PYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLA 186
             YHFDLSGKAFGS+AK G  D +R  G + ++FRRV+C+YP+  KI FH+EKGCN NYLA
Sbjct  131  AYHFDLSGKAFGSMAKQGQEDNLRKAGELTLQFRRVKCEYPSKTKITFHVEKGCNDNYLA 190
Query  187  VLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKV 246
            +LV+Y A DGDIV ++I+ K S E+ PMK SWGAIWR+D  K LKGPF++RLTSESG K+
Sbjct  191  LLVEYAAGDGDIVAVDIKPKGSDEFLPMKPSWGAIWRIDPKKPLKGPFTVRLTSESGAKL 250
Query  247  IAKDVIPANWRPDAVYTSNVQF 268
            + +DVIPA+W+P+  YTSN+Q+
Sbjct  251  VQEDVIPADWKPNTAYTSNLQY 272

Sequence Alignment: 20. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 188.0 bits 1105,  Expect = 3e-49
 Identities = 149/257 57%, Positives = 196/257 76%, Gaps = 3/257 1%
Query  6    NNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAPDNGGA 65
            +++++V A++A ++ G + G  KVPPGPNIT  Y  KWL A++TWYG+P GAG  DNGGA
Sbjct  5    SSVLLVVALFAVFL-GTAHGIAKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGGA 63
Query  66   CGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVYITDMNYEP 124
            CG K+V+  P+SGMT CGN PIFK G+GCGSC+E++C  KPE CSG PV V+ITD N EP
Sbjct  64   CGYKDVDKAPFSGMTGCGNTPIFKSGRGCGSCFEIKCT-KPESCSGEPVLVHITDDNEEP 122
Query  125  IAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNY 184
            IA YHFDLSGKAFG++AK G   K+R  G ++++FRRV+C+YP G K+ FH+EKG NPNY
Sbjct  123  IAAYHFDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPEGTKVTFHVEKGSNPNY 182
Query  185  LAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGK 244
            LA+LVKYV  DGD+V ++I++K   +W  +K SWG+IWR+DT   L GPF++R T+E G 
Sbjct  183  LALLVKYVTGDGDVVAVDIKEKGKDKWIELKESWGSIWRVDTPDKLTGPFTVRYTTEGGT 242
Query  245  KVIAKDVIPANWRPDAVYTS 264
            K  A+DVIP  W+ D  Y S
Sbjct  243  KGEAEDVIPEGWKADTAYAS 262

Sequence Alignment: 21. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 187.4 bits 1101,  Expect = 4e-49
 Identities = 143/229 62%, Positives = 181/229 79%, Gaps = 0/229 0%
Query  40   NGKWLTARATWYGQPNGAGAPDNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYE 99
            +GKWL A+ATWYG+P GAG  DNGGACG K+VN  P++ M ACGN PIFKDG GCGSCYE
Sbjct  1    DGKWLDAKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNPPIFKDGLGCGSCYE 60
Query  100  VRCKEKPECSGNPVTVYITDMNYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEF 159
            ++C +  ECSG PV V+ITD NYEPIA YHFDL+G AFG++AK G  +K+R  GI+D++F
Sbjct  61   IKCDKPAECSGEPVIVHITDQNYEPIAAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQF 120
Query  160  RRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWG 219
            RRV+CKYPA  KI FH+EKGCNPNY+A+L+KY A DGDIV ++I++K S E+ P+K SWG
Sbjct  121  RRVKCKYPANTKIAFHVEKGCNPNYFALLIKYAAGDGDIVAVDIKEKGSEEFIPLKHSWG 180
Query  220  AIWRMDTAKALKGPFSIRLTSESGKKVIAKDVIPANWRPDAVYTSNVQF 268
            AIWR+D+ K +KGP ++RLTSE G  ++  D IP  W+ D VYTS +QF
Sbjct  181  AIWRIDSPKPIKGPIAVRLTSEGGTTLVQDDAIPEGWKADTVYTSKLQF 229

Sequence Alignment: 22. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 187.1 bits 1099,  Expect = 6e-49
 Identities = 148/257 57%, Positives = 194/257 75%, Gaps = 3/257 1%
Query  6    NNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAPDNGGA 65
            +++++V A++A ++ G + G  KVPPGPNIT  Y  KWL A++TWYG+P GAG  DNGGA
Sbjct  5    SSVLLVVALFAVFL-GSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGA 63
Query  66   CGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVYITDMNYEP 124
            CG K+V+  P++GMT CGN PIFKDG+GCGSC+E++C  KPE CSG  VTV ITD N EP
Sbjct  64   CGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCT-KPESCSGEAVTVTITDDNEEP 122
Query  125  IAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNY 184
            IAPYHFDLSG AFGS+AK G   K+R  G ++++FRRV+CKYP G K  FH+EK  NPNY
Sbjct  123  IAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPNY 182
Query  185  LAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGK 244
            LA+LVKYV  DGD+V ++I++K   +W  +K SWGA+WR+DT   L GPF++R T+E G 
Sbjct  183  LAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGT 242
Query  245  KVIAKDVIPANWRPDAVYTS 264
            K   +DVIP  W+ D  Y++
Sbjct  243  KSEVEDVIPEGWKADTSYSA 262

Sequence Alignment: 23. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 185.6 bits 1090,  Expect = 2e-48
 Identities = 147/257 57%, Positives = 192/257 74%, Gaps = 3/257 1%
Query  6    NNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAPDNGGA 65
            +++++V A++A ++ G + G  KVPPGPNIT  Y  KWL A++TWYG+P GAG  DNGGA
Sbjct  5    SSVLLVVALFAVFL-GSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGA 63
Query  66   CGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVYITDMNYEP 124
            CG KNV+  P++GMT CGN PIFKDG+GCGSC+E++C  KPE CSG  VTV ITD N EP
Sbjct  64   CGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCT-KPESCSGEAVTVTITDDNEEP 122
Query  125  IAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNY 184
            IAPYHFDLSG AFGS+AK G    +R  G ++++FRRV+CKYP   K  FH+EK  NPNY
Sbjct  123  IAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNY 182
Query  185  LAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGK 244
            LA+LVKYV  DGD+V ++I++K   +W  +K SWGA+WR+DT   L GPF++R T+E G 
Sbjct  183  LAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGT 242
Query  245  KVIAKDVIPANWRPDAVYTS 264
            K   +DVIP  W+ D  Y++
Sbjct  243  KSEFEDVIPEGWKADTSYSA 262

Sequence Alignment: 24. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 185.3 bits 1088,  Expect = 2e-48
 Identities = 147/257 57%, Positives = 192/257 74%, Gaps = 3/257 1%
Query  6    NNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAPDNGGA 65
            +++++V A++A ++ G + G  KVPPGPNIT  Y  KWL A++TWYG+P GAG  DNGGA
Sbjct  5    SSVLLVVALFAVFL-GSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGA 63
Query  66   CGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVYITDMNYEP 124
            CG KNV+  P++GMT CGN PIFKDG+GCGSC+E++C  KPE CSG  VTV ITD N EP
Sbjct  64   CGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCT-KPESCSGEAVTVTITDDNEEP 122
Query  125  IAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNY 184
            IAPYHFDLSG AFGS+AK G    +R  G ++++FRRV+CKYP   K  FH+EK  NPNY
Sbjct  123  IAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNY 182
Query  185  LAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGK 244
            LA+LVKYV  DGD+V ++I++K   +W  +K SWGA+WR+DT   L GPF++R T+E G 
Sbjct  183  LAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGT 242
Query  245  KVIAKDVIPANWRPDAVYTS 264
            K   +DVIP  W+ D  Y++
Sbjct  243  KSEFEDVIPEGWKADTSYSA 262

Sequence Alignment: 25. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 185.0 bits 1086,  Expect = 2e-48
 Identities = 146/249 58%, Positives = 184/249 73%, Gaps = 2/249 0%
Query  15   LAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAPDNGGACGIKNVNLP 74
            L A+  G + G  KVPPGPNIT  Y  KWL A++TWYG+P GAG  DNGGACG K+V+  
Sbjct  2    LFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKA 61
Query  75   PYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVYITDMNYEPIAPYHFDLS 133
            P++GMT CGN PIFKDG+GCGSC+E++C  KPE CSG  VTV ITD N EPIAPYHFDLS
Sbjct  62   PFNGMTGCGNTPIFKDGRGCGSCFEIKCT-KPESCSGEAVTVTITDDNEEPIAPYHFDLS 120
Query  134  GKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVA 193
            G AFGS+AK G    +R  G ++++FRRV+CKYP   K  FH+EKG NPNYLA+LVKYV 
Sbjct  121  GHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKGSNPNYLAILVKYVD 180
Query  194  DDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDVIP 253
             DGD+V ++I++K   +W  +K SWGA+WR+DT   L GPF++R T+E G K   +DVIP
Sbjct  181  GDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIP 240
Query  254  ANWRPDAVYTS 264
              W+ D  Y++
Sbjct  241  EGWKADTSYSA 251

Sequence Alignment: 26. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 184.8 bits 1085,  Expect = 2e-48
 Identities = 151/238 63%, Positives = 181/238 76%, Gaps = 1/238 0%
Query  31   PGPNITTNYNGKWLTARATWYGQ-PNGAGAPDNGGACGIKNVNLPPYSGMTACGNVPIFK 89
            PGPNIT  Y  KWL A+AT+YG  P GA   D+GGACG K+V+  P+ GMT CGN PIFK
Sbjct  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
Query  90   DGKGCGSCYEVRCKEKPECSGNPVTVYITDMNYEPIAPYHFDLSGKAFGSLAKPGLNDKI 149
            DG  CGSCYE++CKE  ECSG PV + ITD NYE IA YHFDLSGKAFG++AK G  DK+
Sbjct  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
Query  150  RHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSA 209
            R  G + ++FRRV+C+YP+  KI FH+EKG +PNYLA+LVKY A DG+IV ++I+ K S 
Sbjct  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
Query  210  EWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDVIPANWRPDAVYTSNVQF 268
            E+ PMK SWGAIWRMD  K LKGPF+IRLTSESG  V   DVIP +W+PD VY S +QF
Sbjct  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF 244

Sequence Alignment: 27. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 184.0 bits 1080,  Expect = 4e-48
 Identities = 150/238 63%, Positives = 181/238 76%, Gaps = 1/238 0%
Query  31   PGPNITTNYNGKWLTARATWYGQ-PNGAGAPDNGGACGIKNVNLPPYSGMTACGNVPIFK 89
            PGPNIT  Y  KWL A+AT+YG  P GA   D+GGACG K+V+  P+ GMT CGN PIFK
Sbjct  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
Query  90   DGKGCGSCYEVRCKEKPECSGNPVTVYITDMNYEPIAPYHFDLSGKAFGSLAKPGLNDKI 149
            DG  CGSCYE++CKE  ECSG PV + ITD NYE IA YHFDLSGKAFG++AK G  DK+
Sbjct  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
Query  150  RHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSA 209
            R  G + ++FRRV+C+YP+  KI FH+EKG +PNYLA+LVKY A DG+IV ++I+ K S 
Sbjct  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
Query  210  EWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDVIPANWRPDAVYTSNVQF 268
            E+ PMK SWGAIWR+D  K LKGPF+IRLTSESG  V   DVIP +W+PD VY S +QF
Sbjct  186  EFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF 244

Sequence Alignment: 28. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 181.1 bits 1062,  Expect = 4e-47
 Identities = 146/265 55%, Positives = 190/265 71%, Gaps = 4/265 1%
Query  1    MGSLVNNIMVVGAVLAALVAGGSCGP-PKVPPGPNITTNYNGKWLTARATWYGQPNGAGA 59
            M   ++    V A+++ LV     G  P      + T + N  W  ARATWYG P GAG 
Sbjct  1    MAFSISKKAAVAALFSFLVVTCVAGARPGNFSASDFTADPN--WEVARATWYGAPTGAGP 58
Query  60   PDNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITD 119
             D+GGACG KN N  P+S MT+CGN PIFKDGKGCGSCY++RC   P CSGNP TV ITD
Sbjct  59   DDDGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITD 118
Query  120  MNYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKG 179
            MNY P++ YHFDLSG AFG++AKPG ND++RH GI+D++F+RV C +P G K+ FH+E+G
Sbjct  119  MNYYPVSKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFP-GLKVTFHVEEG 177
Query  180  CNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLT 239
             NP Y+AVLV+Y   DGD+V +++ +  S  W PM+ SWG+IWR+D+   L  PFS+R+T
Sbjct  178  SNPVYFAVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRIT 237
Query  240  SESGKKVIAKDVIPANWRPDAVYTSNVQF 268
            +ESGK+++A  VIPANW P AVY S VQ+
Sbjct  238  NESGKQLVASQVIPANWAPMAVYRSFVQY 266

Sequence Alignment: 29. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 177.9 bits 1042,  Expect = 3e-46
 Identities = 152/265 57%, Positives = 196/265 73%, Gaps = 23/265 8%
Query  1    MGSLVNNIMVVGAVLAALVAGGSCGPPKVPP----------GPNITTN----YNGKWLTA 46
            MGSL +  +   AV+ +L+A G C                 G +  ++    Y G W  A
Sbjct  1    MGSLSS--LAAAAVFLSLLAVGHCAAADFNATDADADFAGNGWDFNSSDAAVYWGPWTKA 58
Query  47   RATWYGQPNGAGAPDNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKP 106
            RATWYGQPNGAG  DNGGACG K+ N  P+  MT+CGN P+FKDGKGCGSCY++RC +  
Sbjct  59   RATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSCYKIRCTKDQ 118
Query  107  ECSGNPVTVYITDMNYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKY 166
             CSG   TV ITDMNY P+AP+HFDLSG AFG LAKPGLNDK+RH GI+D+EF RV C++
Sbjct  119  SCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIIDIEFTRVPCEF 178
Query  167  PAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSA------EWKPMKLSWGA 220
            P G KI FH+E+  NP Y+AVLV+Y   DGD+V +++ +  +A      +W PM+ SWG+
Sbjct  179  P-GLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGS 237
Query  221  IWRMDTAKALKGPFSIRLTSESGKKVIAKDVIPANWRPDAVYTSNVQF 268
            IWR+DT   L+ PFSIR+ +ESGK ++A +VIPANWRP+  Y S VQ+
Sbjct  238  IWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQY 285

Sequence Alignment: 30. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 176.1 bits 1031,  Expect = 1e-45
 Identities = 149/257 57%, Positives = 190/257 73%, Gaps = 6/257 2%
Query  6    NNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAPDNGGA 65
            +++++   V+AA+V+    G PKVPPGPNITT+Y  KWL AR     +P      DNGGA
Sbjct  4    SSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDNGGA 63
Query  66   CGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVYITDMNYEP 124
            CG K+V+  P+ GM +CGN PIFKDGKGCGSC+E++C  KPE CS  P  +++TDMN EP
Sbjct  64   CGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCS-KPEACSDKPALIHVTDMNDEP 122
Query  125  IAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNY 184
            IA YHFDLSG A   +AK G ++++R  GI+D +FRRV+CKYPA  KI FHIEK  NPNY
Sbjct  123  IAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNY 179
Query  185  LAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGK 244
            LA+LVKYVA DGD+V +EI++K S EWK +K SWGAIWR+DT K LKGPFS+R+T+E  +
Sbjct  180  LALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGAR 239
Query  245  KVIAKDVIPANWRPDAVYTSNVQ 267
            +  A+D IP   R   V   NVQ
Sbjct  240  RSSAEDAIPDPGRRQRVQV-NVQ 261

Sequence Alignment: 31. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 176.0 bits 1030,  Expect = 1e-45
 Identities = 142/265 53%, Positives = 189/265 71%, Gaps = 10/265 3%
Query  1    MGSLVNNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAP 60
            M  + +N + + A+L+ L          V     +  +Y   WL A+ATWYG PNGAG  
Sbjct  1    MAGVSSNAIALVALLSMLFTSVRSA---VNYDTAVARSYTSGWLPAKATWYGAPNGAGPD 57
Query  61   DNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCK--EKPECSGNPVTVYIT 118
            DNGGACG KNVN  P S M ACGN PIF  G+GCG CYE++C+    P CSG P  + IT
Sbjct  58   DNGGACGFKNVNQYPISSMGACGNEPIFAGGEGCGMCYEIKCEYSNNPSCSGQPRRIVIT 117
Query  119  DMNYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEK 178
            DMNY P+A YH+DLSG AFGS+AK GLND++RH GI+D++FRRV C +P G K+ FH+++
Sbjct  118  DMNYYPVARYHLDLSGTAFGSMAKYGLNDRLRHAGIIDMQFRRVPCNFP-GMKVTFHVQR 176
Query  179  GCNPNYLAVLVKYVADDGDIVLMEIQDKLSAE----WKPMKLSWGAIWRMDTAKALKGPF 234
            G NPNYLAVLV+YV  DG +V ME+   ++      W+ M+ SWG++WRMDT + ++GPF
Sbjct  177  GSNPNYLAVLVEYVNVDGTVVRMELMQTMNGRPTGYWQDMRRSWGSVWRMDTNRPVQGPF 236
Query  235  SIRLTSESGKKVIAKDVIPANWRPDAVYTSNVQFY 269
            SIR+TS++GK ++A + IPA W+ D  Y SN+QFY
Sbjct  237  SIRITSDTGKTLVANNAIPAYWQQDHAYWSNLQFY 271

Sequence Alignment: 32. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 175.5 bits 1027,  Expect = 2e-45
 Identities = 136/229 59%, Positives = 171/229 74%, Gaps = 6/229 2%
Query  39   YNGKWLTARATWYGQPNGAGAPDNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCY 98
            Y   WL A+ATWYGQPNGAG  DNGGACG KN N  P+  MT+CGN P+F+DGKGCG+CY
Sbjct  27   YTNDWLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACY 86
Query  99   EVRCKEKPECSGNPVTVYITDMNYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVE 158
            ++RC   P CSG P TV ITDMNY P+A YHFDLSG AFG++A+PGLND++RH GI+D++
Sbjct  87   QIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQ 146
Query  159  FRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSAE-----WKP 213
            FRRV C Y  G  + FH+E G NP YLAVLV++   DG +V +++ + L +      W P
Sbjct  147  FRRVPC-YHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTP 205
Query  214  MKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDVIPANWRPDAVYTSNVQF 268
            M+ SWG+IWR+D    L+GP S+R+ SESG+ VIA  VIPANWR +  Y S VQF
Sbjct  206  MRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQF 260

Sequence Alignment: 33. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 171.2 bits 1000,  Expect = 3e-44
 Identities = 138/236 58%, Positives = 177/236 75%, Gaps = 5/236 2%
Query  26   PPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAPDNGGACGIKNVNLPPYSGMTACGNV 85
            PPKV  G NIT  Y   WL  +ATWYG+P GAG  DNGGACG K+VN  P++ M ACGN+
Sbjct  1    PPKVAKGKNITETYGSDWLERKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNL 60
Query  86   PIFKDGKGCGSCYEVRC-KEKP-ECSGNPVTVYITDMNYEPIAPYHFDLSGKAFGSLAKP 143
            PIFKDG  CGSC+E++C K KP ECSG  V V+ITDMNYE IA YHFDL+G AFG++AK 
Sbjct  61   PIFKDGL-CGSCFEIKCDKPKPAECSGEAVVVHITDMNYEQIAAYHFDLAGHAFGAMAKK 119
Query  144  GLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEI 203
            G  +K+   GI+D++FRRV+CKY  G+K+ FH+EKG NPNYLA+LVKYV  DGDIV ++I
Sbjct  120  GQEEKLAKAGIIDMKFRRVKCKY--GEKVTFHVEKGSNPNYLALLVKYVDGDGDIVGVDI 177
Query  204  QDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDVIPANWRPDAVYT 263
            ++K    ++P+K SWGAIWR D+   +K P ++++T+E G K    DVIP  W+ D  YT
Sbjct  178  KEKGGDAYQPLKHSWGAIWRKDSPDPIKFPVTVQITTEGGTKTAYDDVIPEGWKADTTYT 237
Query  264  S 264
            +
Sbjct  238  A 238

Sequence Alignment: 34. Allergen Name: Ory s 1 Sequence ID: AAF72989

 Score = 169.6 bits 990,  Expect = 1e-43
 Identities = 141/259 54%, Positives = 180/259 69%, Gaps = 9/259 3%
Query  9    MVVGAVLAALVAGGSCGPPKVPPGP----NITTNYNGK--WLTARATWYGQPNGAGAPDN 62
            +VV  +L  LV    C       G     N +    G   W  A+ATWYGQPNGAGA DN
Sbjct  3    VVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATWYGQPNGAGAADN 62
Query  63   GGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDMNY 122
            GGACG K VN  P+ GMT+CGN P++K GKGCGSCY VRC   P CSGN  TV ITDMNY
Sbjct  63   GGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRCNRNPACSGNAQTVAITDMNY 122
Query  123  EPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNP 182
             P++ YHFDLSG AFG LAKPG  D +R  GI+DV+F RV C++P G K+ FH+E+G +P
Sbjct  123  FPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARVPCEFP-GLKVGFHVEEGSSP 181
Query  183  NYLAVLVKYVADDGDIVLMEIQDKLSA--EWKPMKLSWGAIWRMDTAKALKGPFSIRLTS 240
             YLAVLV+Y   DGD+  +++++  +    W PM+ SWG++WR+D+   L+ PFSIR+ S
Sbjct  182  VYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRS 241
Query  241  ESGKKVIAKDVIPANWRPDAVYTSNVQF 268
            +SGK ++A DVIP NW P+  Y S VQ+
Sbjct  242  DSGKTLVAPDVIPLNWTPNTFYRSFVQY 269

Sequence Alignment: 35. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 142.3 bits 820,  Expect = 2e-35
 Identities = 148/242 61%, Positives = 186/242 76%, Gaps = 15/242 6%
Query  26   PPKVPPGPNITTNYNGK----WLTARATWYGQPNGAGAPDNGGACGIKNVNLPPYSGMTA 81
            PP   PG   +   +G     WL ARATWYG PNGAG  DNGGACG KNVNLPP+S MT+
Sbjct  71   PPIPSPGTGSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTS 130
Query  82   CGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDMNYEPIAPYHFDLSGKAFGSLA 141
            CGN P+FKDGKGCGSCY++RC   P CSG P TV ITDMNY P++ YHFDLSG AFG++A
Sbjct  131  CGNEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMA 190
Query  142  KPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIV-- 199
            K   ND++RH GI+D++FRRV C+YP G  + FH+E+G NP Y+A+LV+Y   DGD+V  
Sbjct  191  KDNRNDELRHAGIIDIQFRRVPCQYP-GLTVTFHVEQGSNPVYMAILVEYENGDGDVVQV 249
Query  200  -LME-------IQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDV 251
             LME       +    +  W PM+ SWG+IWR+DT   L+GPFS+R+T+ESGK +IA  V
Sbjct  250  DLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQV 309
Query  252  IPANWRPDAVYTSNVQF 268
            IPA+W+P+ VY+S VQF
Sbjct  310  IPADWQPNTVYSSIVQF 326

Sequence Alignment: 36. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 135.0 bits 775,  Expect = 3e-33
 Identities = 116/261 44%, Positives = 164/261 62%, Gaps = 9/261 3%
Query  5    VNNIMVVGAVLAA-LVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAPDNG 63
            ++ ++ + A+L+  LV    C  PK     +  +  +  W  A ATWYG  NG G+   G
Sbjct  9    LSELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSDWSPAVATWYGPANGDGS--EG 66
Query  64   GACGIKN-VNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITD--M 120
            GACG  N V  PP+S + + G+  I+  GKGCGSCYEV+C     CSGNPV V ITD   
Sbjct  67   GACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECA 126
Query  121  NYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGC 180
                 A YHFDLSG AFG++A  G ++ +R+ G ++++ RR+ C YP G+ I FH++ G 
Sbjct  127  GCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYP-GRSIAFHVDSGS 185
Query  181  NPNYLAVLVKYVADDGDIVLMEIQDKL-SAEWKPMKLSWGAIWRMDTAKALKGPFSIRLT 239
            N  Y+A LV+Y   DGD+  +E+++ L S  W  M+ SWGA+W+ D    L+ PFSI+LT
Sbjct  186  NQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLT 245
Query  240  S-ESGKKVIAKDVIPANWRPDAVYTSNVQF 268
            + ESG+ ++A +VIPA W P   Y S V F
Sbjct  246  TLESGQTIVANNVIPAGWTPGQTYRSIVNF 275

Sequence Alignment: 37. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 125.2 bits 714,  Expect = 2e-30
 Identities = 109/260 41%, Positives = 161/260 61%, Gaps = 16/260 6%
Query  2    GSLVNNIMVVGAVLAALVAGGSCGPPKVPPG--PNITTNYNGKWLTARATWYGQPNGAGA 59
            G++V  ++V   +L+  V+G          G    ++      W +  ATWYG P G G+
Sbjct  5    GTFVFAVLVALPILSLPVSGY---EQNYTAGRRSTMSLGRGYGWSSGGATWYGGPQGDGS 61
Query  60   PDNGGACGIKN-VNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYIT 118
               GGACG ++ V   P+S M A G   +FK+GKGCGSCY+++C     CSG PVTV IT
Sbjct  62   --EGGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVTVVIT 119
Query  119  DMNYEPIA---PYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFH 175
            D     +      HFD+SG AFG++A  G+ D++R  G++ ++++RV C++     + F 
Sbjct  120  DSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQYKRVPCRF--AMNVAFK 177
Query  176  IEKGCNPNYLAVLVKYVADDGDIVLMEI-QDKLSAEWKPMKLSWGAIWRMD--TAKALKG 232
            ++ G NP YLA+LV+Y   DGD+  + I + +    WK M+ SWGA WR++  T K L  
Sbjct  178  VDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGKPLSP 237
Query  233  PFSIRLTSESGKKVIAKDVIPANWRPDAVYTSNVQF 268
            PFSIRLTS SGK ++A +VIP+ W+    Y S V +
Sbjct  238  PFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNY 273

Sequence Alignment: 38. Allergen Name: Ara t expansin Sequence ID: CAB37496

 Score = 79.0 bits 426,  Expect = 2e-16
 Identities = 74/201 36%, Positives = 112/201 55%, Gaps = 11/201 5%
Query  62   NGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDMN 121
            + GAC   ++    ++G  A     I+KDG GCG+C++VRCK    CS    TV +TD+N
Sbjct  41   SSGACAYGSMATGFFAGHIAAALPSIYKDGSGCGACFQVRCKNPTLCSSKGTTVIVTDLN 100
Query  122  YEPIAPYHFDLSGKAFGSLAKP--GLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKG 179
                    + LS +AF ++AKP  G +  +   GI+D+E+RRV C Y   +K+   +E+ 
Sbjct  101  --KTNQTDLVLSSRAFRAMAKPVVGADRDLLKQGIVDIEYRRVPCDY-GNKKMNVRVEES 157
Query  180  C-NPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRL 238
              NPNYLA+ + Y     ++V + I    S+ W  M  S GA+W  D  K   G +  R+
Sbjct  158  SKNPNYLAIKLLYQGGQTEVVAIYIAQVGSSHWSYMTRSHGAVWVTD--KVPNGALQFRF 215
Query  239  TSESG---KKVIAKDVIPANWRPDAVYTSNVQ 267
               +G   K V ++ V+PANW     Y + VQ
Sbjct  216  VVTAGYDGKMVWSQRVLPANWEAGKSYDAGVQ 247

Sequence Alignment: 39. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 73.2 bits 390,  Expect = 1e-14
 Identities = 70/201 34%, Positives = 109/201 54%, Gaps = 12/201 5%
Query  62   NGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDMN 121
            N G+CG  ++      G  A  +  +F+ G GCG+C++VRCK+   CS     V +TD  
Sbjct  50   NAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTD-- 107
Query  122  YEPIAPYHFDL--SGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIE-K 178
             E  +    DL  S  A+ ++A+PG+  ++R    +DVE++RV C+Y AG+ +   +E K
Sbjct  108  -EARSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEK 166
Query  179  GCNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRL 238
               P  L++   Y     DIV +++    S+ WK M   +G  W   TA+A  GP+  R+
Sbjct  167  SRPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFRV 224
Query  239  T---SESGKKVIAK-DVIPANWRPDAVYTSNVQ 267
                   GK V A  +V+P  W    VY + VQ
Sbjct  225  VVTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257

Sequence Alignment: 40. Allergen Name: Ory s 1 Sequence ID: BAA85432

 Score = 71.3 bits 378,  Expect = 4e-14
 Identities = 81/226 35%, Positives = 121/226 53%, Gaps = 33/226 14%
Query  31   PGPNITTNYN-GKWLTARATWYGQPNGAGAPDNGGACG-IKNVNLPPYSGMTACGNVPIF 88
            P P   T Y    W    AT+YG P+G G  D GGACG + N  +  YS  TA  + P+F
Sbjct  39   PAPGAVTPYKTSDWHDGSATFYGDPSGMG-DDFGGACGYVSNDIVSLYSTKTAALSTPLF 97
Query  89   KDGKGCGSCYEVRCKEKPECS-GNPVTVYITDMNYEPIAPY--------------HFDLS 133
             DG GCG CYE+RC + P C+ G+P +V IT  N  P   Y              HFD++
Sbjct  98   ADGNGCGQCYELRCVKSPWCNPGSP-SVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMA 156
Query  134  GKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVA 193
              +F  LA+       R  GI+ V++RRV C+   G +  +   +G N  +L + V  V 
Sbjct  157  PPSFLKLAQ-------RVAGIVPVQYRRVPCQRTGGVRFCL---QG-NHYWLLLYVMNVG 205
Query  194  DDGDIVLMEIQDKLSA-EWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKK--VIAKD 250
              GD+  + ++       W     +WG  +++  A      ++++LT+ S  +  +I  D
Sbjct  206  GAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTTYSTPQQTIIVSD 265
Query  251  VIPANWRPDAVYTSNVQFY 269
             I   W     Y  +  FY
Sbjct  266  AISPWWITGLCYQGSNNFY 284

Sequence Alignment: 41. Allergen Name: Cyn d 2 Sequence ID: CAA10346

 Score = 48.5 bits 236,  Expect = 1e-07
 Identities = 36/90 40%, Positives = 53/90 58%, Gaps = 2/90 2%
Query  171  KIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKAL 230
            K+ F +EKG N  +LAVLVKY  D   +  +E+++  S EW  M    G +W  D+ + L
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYEGDT--MAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  231  KGPFSIRLTSESGKKVIAKDVIPANWRPDAVY 262
            KGPF+ R+ +E G K +  DV+P  +   A Y
Sbjct  87   KGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 42. Allergen Name: Dac g 2 Sequence ID: CAA10345

 Score = 47.8 bits 232,  Expect = 2e-07
 Identities = 35/90 38%, Positives = 53/90 58%, Gaps = 2/90 2%
Query  171  KIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKAL 230
            K+ F +EKG N  +LAVLVKY  D   +  +E+++  S EW  M    G +W  D+ + L
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYEGDT--MAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  231  KGPFSIRLTSESGKKVIAKDVIPANWRPDAVY 262
            +GPF+ R+ +E G K +  DV+P  +   A Y
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 43. Allergen Name: Poa p 2 Sequence ID: CAA10348

 Score = 47.8 bits 232,  Expect = 2e-07
 Identities = 35/90 38%, Positives = 53/90 58%, Gaps = 2/90 2%
Query  171  KIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKAL 230
            K+ F +EKG N  +LAVLVKY  D   +  +E+++  S EW  M    G +W  D+ + L
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYEGDT--MAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  231  KGPFSIRLTSESGKKVIAKDVIPANWRPDAVY 262
            +GPF+ R+ +E G K +  DV+P  +   A Y
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 44. Allergen Name: Phl p 2 Sequence ID: P43214

 Score = 47.8 bits 232,  Expect = 2e-07
 Identities = 35/90 38%, Positives = 53/90 58%, Gaps = 2/90 2%
Query  171  KIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKAL 230
            K+ F +EKG N  +LAVLVKY  D   +  +E+++  S EW  M    G +W  D+ + L
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYEGDT--MAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  231  KGPFSIRLTSESGKKVIAKDVIPANWRPDAVY 262
            +GPF+ R+ +E G K +  DV+P  +   A Y
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 45. Allergen Name: Lol p 2 Sequence ID: P14947

 Score = 44.8 bits 213,  Expect = 1e-06
 Identities = 29/91 31%, Positives = 53/91 58%, Gaps = 0/91 0%
Query  172  IVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALK 231
            + F +EKG +   LA+ +KY  +   +  +E+++  S EW  +K +   +W + + K LK
Sbjct  4    VEFTVEKGSDEKNLALSIKYNKEGDSMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLK 63
Query  232  GPFSIRLTSESGKKVIAKDVIPANWRPDAVY 262
            GPF+ R+ SE G + +  DV+PA+++    Y
Sbjct  64   GPFNFRFVSEKGMRNVFDDVVPADFKVGTTY 94

Sequence Alignment: 46. Allergen Name: Dac g 3 Sequence ID: P93124

 Score = 44.1 bits 209,  Expect = 2e-06
 Identities = 29/92 31%, Positives = 52/92 56%, Gaps = 1/92 1%
Query  171  KIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKAL 230
            K+ F +EKG +P  L + +KY      +  +E++   S EW+P+    G +W + ++K L
Sbjct  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLT-KKGNLWEVKSSKPL 60
Query  231  KGPFSIRLTSESGKKVIAKDVIPANWRPDAVYT 263
             GPF+ R+ S+ G + +  +VIP  ++    YT
Sbjct  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYT 93

Sequence Alignment: 47. Allergen Name: Lol p 2 Sequence ID: CAA51775

 Score = 42.9 bits 201,  Expect = 5e-06
 Identities = 28/84 33%, Positives = 50/84 59%, Gaps = 0/84 0%
Query  174  FHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGP 233
            F +EKG +   LA+ +KY  +   +  +E+++  S EW  +K +   +W + + K LKGP
Sbjct  2    FTVEKGSDEKNLALSIKYSKEGDAMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLKGP 61
Query  234  FSIRLTSESGKKVIAKDVIPANWR 257
            F+ R+ SE G   +  DV+PA+++
Sbjct  62   FNFRFVSEKGMWNVFDDVVPADFK 85

Sequence Alignment: 48. Allergen Name: Dac g 1.0101 Sequence ID: Q7M1X8

 Score = 40.5 bits 186,  Expect = 1e-05
 Identities = 23/32 71%, Positives = 26/32 81%, Gaps = 0/32 0%
Query  27   PKVPPGPNITTNYNGKWLTARATWYGQPNGAG 58
            PKVPPGPNIT  Y  KWL A++TWYG+P GAG
Sbjct  2    PKVPPGPNITATYGDKWLDAKSTWYGKPTGAG 33

Sequence Alignment: 49. Allergen Name: Phl p 3.0101 Sequence ID: 2JNZ_A

 Score = 41.1 bits 190,  Expect = 2e-05
 Identities = 26/91 28%, Positives = 50/91 54%, Gaps = 1/91 1%
Query  171  KIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKAL 230
            ++ F ++KG +P  L + +KY      +  +E++   S EW+P+    G +W + ++K L
Sbjct  14   QVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLT-KKGNVWEVKSSKPL 72
Query  231  KGPFSIRLTSESGKKVIAKDVIPANWRPDAVY 262
             GPF+ R+ S+ G + +  +VIP  +     Y
Sbjct  73   VGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTY 104

Sequence Alignment: 50. Allergen Name: Lol p 3 Sequence ID: P14948

 Score = 40.0 bits 183,  Expect = 4e-05
 Identities = 29/92 31%, Positives = 49/92 53%, Gaps = 1/92 1%
Query  171  KIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKAL 230
            K+ + +EKG +   L + +KY      +  +E++   S EW+PM    G +W + +AK L
Sbjct  2    KVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMT-KKGNLWEVKSAKPL 60
Query  231  KGPFSIRLTSESGKKVIAKDVIPANWRPDAVYT 263
             GP + R+ S+ G K +  +VIP  +     YT
Sbjct  61   TGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYT 93

Sequence Alignment: 51. Allergen Name: Cyn d 15 Sequence ID: AAP80171

 Score = 40.0 bits 183,  Expect = 5e-05
 Identities = 33/90 36%, Positives = 56/90 62%, Gaps = 7/90 7%
Query  172  IVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALK 231
            I+FH+E+  +P + A+ +K  A +  I  +++++  +    PM  S G  W +D  K LK
Sbjct  22   IIFHVEES-SPKF-ALSIKDSAKE--ITQVDVREHGADNMDPMTKS-GDSWTID--KPLK 74
Query  232  GPFSIRLTSESGKKVIAKDVIPANWRPDAVYTSNVQF 268
            GP++IRL +E G   +  DVIP NW+    Y + ++F
Sbjct  75   GPLNIRLRAEGGGSRVQDDVIPENWKAGTDYPTKLHF 111

Sequence Alignment: 52. Allergen Name: Ant o 1.0101 Sequence ID: Q7M1X6

 Score = 37.6 bits 168,  Expect = 7e-05
 Identities = 21/30 70%, Positives = 24/30 80%, Gaps = 0/30 0%
Query  28   KVPPGPNITTNYNGKWLTARATWYGQPNGA 57
            KVPPGPNIT  Y  KWL A++TWYG+P GA
Sbjct  3    KVPPGPNITATYGDKWLDAKSTWYGKPTGA 32

Sequence Alignment: 53. Allergen Name: Tri a 3 Sequence ID: CAA90746

 Score = 36.9 bits 164,  Expect = 0.0004
 Identities = 24/91 26%, Positives = 50/91 54%, Gaps = 1/91 1%
Query  171  KIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKAL 230
            K+ + ++KG +   LA+ + Y   +  +  +E++   S EW+P+    G +W +  +K L
Sbjct  24   KVKLTVQKGSDKKKLALKIDYTRPNDSLSEVELRQYGSEEWQPLT-KKGDVWEVSCSKPL 82
Query  231  KGPFSIRLTSESGKKVIAKDVIPANWRPDAVY 262
             GPF+ R+ S++G K +  +V   +++    Y
Sbjct  83   VGPFNFRFLSKNGMKKVFDEVFSTDFKIGKTY 114

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.