The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA
EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK
FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN
Sequence Info Allergen Name Length Opt Bits Score E Value
CAB02206 Car b 1.0103 160 1027 219.4 3.7e-59
ABZ81042 Car b 1.0111 160 1017 217.4 1.5e-58
CAB02207 Car b 1.0104 160 1016 217.2 1.8e-58
CAB02208 Car b 1.0105 160 1015 217.0 2e-58
ABZ81043 Car b 1.0112 160 1012 216.3 3.1e-58
ABZ81041 Car b 1.0110 160 1011 216.1 3.6e-58
ABZ81040 Car b 1.0109 160 1008 215.5 5.5e-58
ADK39021 Ost c 1.0101 160 1003 214.5 1.1e-57
CAB02209 Car b 1.0106 160 1000 213.9 1.7e-57
ABZ81044 Car b 1.0113 160 998 213.5 2.3e-57
CAA47357 Car b 1.0102 159 994 212.7 4e-57
P38949 Car b 1 159 986 211.0 1.2e-56
CAB02213 Car b 1.0107 160 968 207.3 1.6e-55
CAB02215 Car b 1.0108 160 958 205.3 6.7e-55
CAA50327 Cor a 1.0101 160 932 199.9 2.7e-53
CAA50328 Cor a 1.0102 160 928 199.1 4.8e-53
Q08407 Cor a 1 159 925 198.5 7.3e-53
CAA50326 Cor a 1.0104 160 922 197.9 1.1e-52
CAA50325 Cor a 1.0103 160 921 197.7 1.3e-52
P38950 Car b 1 159 910 195.4 6.2e-52
AAB24432 Aln g 1 160 821 177.2 2e-46
Q39427 Bet v 1.0205 160 817 176.3 3.5e-46
CAB02160 Bet v 1.0113 160 816 176.1 4e-46
P43186 Bet v 1.0204 160 816 176.1 4e-46
P38948 Aln g 1 159 814 175.7 5.3e-46
CAB02159 Bet v 1.0112 160 811 175.1 8.1e-46
CAA33887 Bet v 1.0101 160 811 175.1 8.1e-46
CAB02156 Bet v 1.0109 160 810 174.9 9.4e-46
CAB02161 Bet v 1.0114 160 809 174.7 1.1e-45
P43184 Bet v 1.0203 160 809 174.7 1.1e-45
CAA54421 Bet v 1.0201 160 808 174.5 1.2e-45
CAA04828.1 Bet v 1.0206 159 806 174.1 1.6e-45
CAA96548 Cor a 1.0201 160 806 174.1 1.7e-45
CAA54481 Bet v 1.0202 160 800 172.8 3.9e-45
CAB02216 Car b 1.0301 161 800 172.8 3.9e-45
CAA07323.1 Bet v 1.0117 160 798 172.4 5.2e-45
CAA54489 Bet v 1.0107 160 798 172.4 5.2e-45
CAA54482 Bet v 1.0102 160 798 172.4 5.2e-45
CAA54487 Bet v 1.0106 160 797 172.2 6e-45
CAA07329.1 Bet v 1.0118 160 797 172.2 6e-45
CAB02155 Bet v 1.0108 160 797 172.2 6e-45
CAA54484 Bet v 1.0104 160 796 172.0 6.9e-45
CAB02157 Bet v 1.0110 160 796 172.0 6.9e-45
CAB02217 Car b 1.0302 161 796 172.0 6.9e-45
CAA54485 Bet v 1.0105 160 795 171.8 7.9e-45
CAA04827.1 Bet v 1.0116 159 793 171.4 1e-44
CAA54483 Bet v 1.0103 160 792 171.2 1.2e-44
CAB02158 Bet v 1.0111 160 789 170.6 1.9e-44
CAA96547 Bet v 1.0115 160 784 169.6 3.8e-44
ACF75030.1 Bet v 1.0207 150 751 162.8 3.8e-42
ABC41615.1 Bet v 1.0119 150 733 159.1 4.9e-41
CAA54696.1 Bet v 1.0301 160 711 154.6 1.2e-39
CAA96549 Cor a 1.0301 160 710 154.4 1.4e-39
AAD48405 Cor a 1.0401 161 678 147.8 1.3e-37
AAG40331 Cor a 1.0404 161 675 147.2 2.1e-37
AAG40329 Cor a 1.0402 161 674 147.0 2.4e-37
CAD10374 Cas s 1 160 672 146.6 3.1e-37
AAG40330 Cor a 1.0403 161 671 146.4 3.7e-37
APD76154 Jug r 5.0101 160 670 146.2 4.2e-37
CAA96535 Mal d 1.0401 160 667 145.5 6.4e-37
CAA96536 Mal d 1.0402 160 654 142.9 4.1e-36
CAA96537 Mal d 1.0403 160 650 142.1 7.2e-36
ACJ23864 Fag s 1.0101 160 650 142.1 7.2e-36
ABZ81046 Que a 1.0301 160 633 138.6 8.1e-35
Q2I6V8 Pru p 1.0101 160 622 136.3 3.9e-34
O24248 Pru av 1 160 620 135.9 5.1e-34
AUH28179 Que m 1.0101 160 610 133.9 2.1e-33
CAA96534 Mal d 1.0301 159 600 131.8 8.7e-33
AAK13027 Mal d 1.0302 159 596 131.0 1.5e-32
AAO25113 Mal d 1.0304 159 593 130.4 2.4e-32
O50001 Pru ar 1 160 592 130.2 2.7e-32
Q256S7 Fra a 1 160 588 129.3 4.9e-32
AAB01362 Mal d 1.0201 159 587 129.1 5.6e-32
AAD26545 Mal d 1.0202 159 587 129.1 5.6e-32
AAD13683 Mal d 1.0206 159 586 128.9 6.4e-32
Q3T923 Fra a 1 160 586 128.9 6.5e-32
B6CQS9 Pru du 1.0101 160 584 128.5 8.6e-32
AAD26548 Mal d 1.0204 159 583 128.3 9.8e-32
ABZ81047 Que a 1.0401 160 583 128.3 9.9e-32
AFN42528 Can s 5.0101 161 583 128.3 1e-31
Q256S2 Fra a 1 160 582 128.1 1.1e-31
AAK13030 Mal d 1.0207 159 581 127.9 1.3e-31
AAD26547 Mal d 1.0203 159 581 127.9 1.3e-31
CAD32318 Mal d 1.0208 158 580 127.7 1.5e-31
AAD26558 Mal d 1.0205 159 579 127.5 1.7e-31
AAD26546 Mal d 1.0103 159 579 127.5 1.7e-31
Q256S6 Fra a 1 160 579 127.5 1.7e-31
AAD29671 Mal d 1.0108 159 577 127.1 2.3e-31
O65200 Pyr c 1 159 576 126.9 2.7e-31
AAD26552 Mal d 1.0104 159 575 126.7 3.1e-31
AAK13028 Mal d 1.0303 159 574 126.5 3.5e-31
CAA58646 Mal d 1.0101 159 573 126.3 4.1e-31
AAD26555 Mal d 1.0107 159 572 126.1 4.7e-31
AAD26553 Mal d 1.0105 159 571 125.8 5.4e-31
AAD26554 Mal d 1.0106 159 571 125.8 5.4e-31
AAK13029 Mal d 1.0109 159 567 125.0 9.6e-31
Q256S4 Fra a 1 159 567 125.0 9.6e-31
CAA88833 Mal d 1.0102 159 565 124.6 1.3e-30
QGS84240 Que i 1.0101 159 554 122.4 6.1e-30
ABZ81045 Que a 1.0201 159 544 120.3 2.5e-29
QOL10866 Que ac 1.0101 159 544 120.3 2.5e-29
CAM31908 Act c 8.0101 159 538 119.1 5.9e-29
CAM31909 Act d 8.0101 157 483 107.8 1.5e-25
Q0Z8U9 Rub i 1.0101 137 481 107.5 1.6e-25
CAA42646 Gly m 4 158 482 107.6 1.7e-25
NP_001275580 Sola l 4.0201 160 465 104.1 1.9e-24
AHC08073 Sola l 4.0101 160 457 102.5 6e-24
AAQ91847 Ara h 8.0101 157 452 101.4 1.2e-23
CAA43636 Pha v 1 155 450 101.0 1.6e-23
CAA43637 Pha v 1 156 449 100.8 1.8e-23
P25985 Pha v 1 155 442 99.4 4.9e-23
EF436550 Ara h 8.0201 153 426 96.1 4.7e-22
CAA75803 Lyc e 4.0101 178 415 93.8 2.7e-21
Q2VU97 Vig r 1.0101 155 405 91.8 9.4e-21
AAB92255 Tar o RAP 157 399 90.6 2.2e-20
P49372 Api g 1 154 392 89.1 5.9e-20
CAA67246 Pet c PR10 155 392 89.1 6e-20
P92918 Api g 1.0201 159 391 88.9 7.1e-20
AAL76932 Dau c 1.0201 154 386 87.9 1.4e-19
CAB03716 Dau c 1.0104 154 382 87.1 2.5e-19
CAB06416 Dau c 1.0105 154 379 86.5 3.8e-19
BAA13604 Dau c 1.0102 154 376 85.8 5.8e-19
AAB01092 Dau c 1.0101 168 374 85.4 8.6e-19
CAB03715 Dau c 1.0103 154 368 84.2 1.8e-18
Q5ULZ4 Fra a 1.0101 100 262 62.7 3.6e-12
P85126 Que a 1.0101 50 189 48.0 4.6e-08
Q9ZWP8 Vig r 6.0101 155 162 41.9 9.7e-06
Q9S8Q4 Cas s 1 24 100 30.1 0.0054
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 219.4 bits 1027,  Expect = 4e-59
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 2. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 217.4 bits 1017,  Expect = 2e-58
 Identities = 159/160 99%, Positives = 159/160 99%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHT EYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 3. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 217.2 bits 1016,  Expect = 2e-58
 Identities = 158/160 98%, Positives = 159/160 99%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGD LEKVSHELKIVAAPGGGSIVKISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            FHAKGDHEVNAE+MKGAKEMAEKLLRAVESYLLAHTDEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 4. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 217.0 bits 1015,  Expect = 2e-58
 Identities = 159/160 99%, Positives = 159/160 99%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSVIPAARLFKSYVLD DKLIPKVAPQAISSVENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 5. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 216.3 bits 1012,  Expect = 3e-58
 Identities = 158/160 98%, Positives = 159/160 99%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            FHAKGDHEVNAE+MKGAKEMAEKLLRAVESYLLAHT EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 6. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 216.1 bits 1011,  Expect = 4e-58
 Identities = 157/160 98%, Positives = 159/160 99%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGS+VKISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            FHAKGDHEVNAE+MKGAKEMAEKLLRAVESYLLAHT EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 7. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 215.5 bits 1008,  Expect = 5e-58
 Identities = 157/160 98%, Positives = 159/160 99%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSI+KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            FHAKGDHEVNAE+MKGAKEMAEKLLRAVESYLLAHT EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 8. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 214.5 bits 1003,  Expect = 1e-57
 Identities = 156/160 97%, Positives = 158/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAIS VENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSI+KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            FHAKGDHEVNAE+MKGAKEMAEKLLRAVESYLLAHT EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 9. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 213.9 bits 1000,  Expect = 2e-57
 Identities = 157/160 98%, Positives = 158/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSVIPAARLFKSYVLD DKLIPKVAPQAISSVENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            FHAKGDHEVNAE+MKGAKEMAEKLLRAVESYLLAHT EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 10. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 213.5 bits 998,  Expect = 2e-57
 Identities = 156/160 97%, Positives = 158/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EG PFKFVKERVDEVDNANFKY+YTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            FHAKGDHEVNAE+MKGAKEMAEKLLRAVESYLLAHT EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 11. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 212.7 bits 994,  Expect = 4e-57
 Identities = 156/159 98%, Positives = 157/159 98%, Gaps = 0/159 0%
Query  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
            GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 121
            GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            HAKG HEVNAE+MKGAKEMAEKLLRAVESYLLAHT EYN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 12. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 211.0 bits 986,  Expect = 1e-56
 Identities = 155/159 97%, Positives = 155/159 97%, Gaps = 0/159 0%
Query  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
            GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQ ISSVENVGGNGGPGTIKNITFAE
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 121
            G PFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            HAKG HEVNAEKMKGAKEMAEKLLRAVESYLLAHT EYN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 13. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 207.3 bits 968,  Expect = 2e-55
 Identities = 152/160 95%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSVIPAARLFKSYVLD DKLIPKVAPQAISSVENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSPFKFVKERVDEVDNANFK++YTVIEGDVLGDKLEKVS ELKIVAAPGGGSI+KIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            FHAKGDHEVNAE+MKGAKEMAEKLLRAVESYLLAHT EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 14. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 205.3 bits 958,  Expect = 7e-55
 Identities = 150/160 93%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSV+PAARLFKSYVLD DKLIPKVAPQAISSVENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSPFKFVKERVDEVDNANFK++YTVIEGDVLGDKLEKVS EL IVAAPGGGSI+KIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            FHAKGDHEVNAE+MKGAKEMAEKLLRAVESYLLAHT EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 15. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 199.9 bits 932,  Expect = 3e-53
 Identities = 143/160 89%, Positives = 152/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSK
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            FHAKGDHE+NAE+MKGAKEMAEKLLRAVE+YLLAH+ EYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 16. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 199.1 bits 928,  Expect = 5e-53
 Identities = 143/160 89%, Positives = 152/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS +K+VKERVDEVDN NFKY+YTVIEGDVLGDKLEKV  ELKIVAAPGGGSI+KISSK
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            FHAKGDHE+NAE+MKGAKEMAEKLLRAVE+YLLAH+ EYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 17. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 198.5 bits 925,  Expect = 7e-53
 Identities = 142/159 89%, Positives = 151/159 94%, Gaps = 0/159 0%
Query  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
            GVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF E
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 121
            GS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSKF
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  122  HAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            HAKGDHE+NAE+MKGAKEMAEKLLRAVE+YLLAH+ EYN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 18. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 197.9 bits 922,  Expect = 1e-52
 Identities = 142/160 88%, Positives = 151/160 94%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ETPSVI AARLFKSYVLDGDKLIPKVAPQAI+SVENVGGNGGPGTIKNITF 
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS +K+VKERVDEVDN NFKY+YTVIEGDVLGDKLEKV  ELKIVAAPGGGS +KISSK
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            FHAKGDHE+NAE+MKGAKEMAEKLLRAVE+YLLAH+ EYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 19. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 197.7 bits 921,  Expect = 1e-52
 Identities = 142/160 88%, Positives = 152/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAET SVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSK
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            FHAKGDHE+NAE++KGAKEMAEKLLRAVE+YLLAH+ EYN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 20. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 195.4 bits 910,  Expect = 6e-52
 Identities = 140/159 88%, Positives = 152/159 95%, Gaps = 0/159 0%
Query  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
            GVFNYEAET SVIPAARLFK+++LDG+KLIPKV+PQA+SSVENV GNGGPGTIK ITF+E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 121
            GSP K+VKERV+E+D+ NFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            HAKG HEVNAE+MKGAKEMAEKLLRAVESYLLAHT EYN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 21. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 177.2 bits 821,  Expect = 2e-46
 Identities = 122/160 76%, Positives = 143/160 89%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSVIPAARLFK+++LDGDKL+PKVAP+A+SSVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSPFK+VKERVDEVD  NFKY+++VIEG  +GD LEKV +E+KIVAAP GGSI+KIS+K
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            FH KGDHE+NAE++K  KE A  LL+AVESYLLAH+D YN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 22. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 176.3 bits 817,  Expect = 3e-46
 Identities = 122/160 76%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD LIPKVAPQAISSVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSPFK+VKERVDEVD+ANFKY+Y++IEG  LGD LEK+ +E+K+VA P GGSI+KIS+K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGDHE+ AE MK  KE AE LLRAVESYLLAH+D YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 23. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 176.1 bits 816,  Expect = 4e-46
 Identities = 120/160 75%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD L+PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GGSI+KIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 24. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 176.1 bits 816,  Expect = 4e-46
 Identities = 122/160 76%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE+ET SVIPAARLFK+++LDGD LIPKVAPQAISSVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSPFK+VKERVDEVD+ANFKY+Y++IEG  LGD LEK+ +E+KIVA P GGSI+KIS+K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGDHE+ AE MK  KE  E LLRAVESYLLAH+D YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 25. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 175.7 bits 814,  Expect = 5e-46
 Identities = 121/159 76%, Positives = 142/159 89%, Gaps = 0/159 0%
Query  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
            GVFNYEAETPSVIPAARLFK+++LDGDKL+PKVAP+A+SSVEN+ GNGGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 121
            GSPFK+VKERVDEVD  NFKY+++VIEG  +GD LEKV +E+KIVAAP GGSI+KIS+KF
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  122  HAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            H KGDHE+NAE++K  KE A  LL+AVESYLLAH+D YN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 26. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 175.1 bits 811,  Expect = 8e-46
 Identities = 120/160 75%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GGSI+KIS+K
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 27. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 175.1 bits 811,  Expect = 8e-46
 Identities = 120/160 75%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GGSI+KIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 28. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 174.9 bits 810,  Expect = 9e-46
 Identities = 120/160 75%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GGSI+KIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 29. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 174.7 bits 809,  Expect = 1e-45
 Identities = 120/160 75%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GGSI+KIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 30. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 174.7 bits 809,  Expect = 1e-45
 Identities = 121/160 75%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE+ET SVIPAARLFK+++L+GD LIPKVAPQAISSVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSPFK+VKERVDEVD+ANFKY+Y++IEG  LGD LEK+ +E+KIVA P GGSI+KIS+K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGDHE+ AE MK  KE  E LLRAVESYLLAH+D YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 31. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 174.5 bits 808,  Expect = 1e-45
 Identities = 121/160 75%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++L+GD LIPKVAPQAISSVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSPFK+VKERVDEVD+ANFKY+Y++IEG  LGD LEK+ +E+KIVA P GGSI+KIS+K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGDHE+ AE MK  KE  E LLRAVESYLLAH+D YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 32. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 174.1 bits 806,  Expect = 2e-45
 Identities = 120/159 75%, Positives = 139/159 87%, Gaps = 0/159 0%
Query  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
            GVFNYE+ET SVIPAARLFK+++LDGD LIPKVAPQAISSVEN+ GNGGPGTIK ITF E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 121
            GSPFK+VKERVDEVD+ANFKY+Y++IEG  LGD LEK+ +E+K+VA P GGSI+KIS+K+
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  122  HAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            H KGDHE+ AE MK  KE  E LLRAVESYLLAH+D YN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 33. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 174.1 bits 806,  Expect = 2e-45
 Identities = 119/160 74%, Positives = 143/160 89%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE E+ SVIPAARLFK+++LDG+ LIPKVAPQA+SSVENV GNGGPGTIK ITF+
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSPFK+VKERV+EVD+ NFKY+YTVIEG  +GDK+EK+ +E+KIVAAP GGSI+KIS+K
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGDHEV+AE +KG KE  E L+RAVE+YLLAH+D YN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 34. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 172.8 bits 800,  Expect = 4e-45
 Identities = 120/160 75%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE+ET SVIPAARLFK+++L+GD LIPKVAPQAISSVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSPFK+VKERVDEVD+ANFKY+Y++IEG  LGD LEK+ +E+KIVA P GGSI+KIS+K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGD+E+ AE MK  KE  E LLRAVESYLLAH+D YN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 35. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 172.8 bits 800,  Expect = 4e-45
 Identities = 120/160 75%, Positives = 142/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAET SVIPAARLFK+++LDG+KLIPKV+PQA+SSVENV GNGGPGTIK ITF+
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSP K+VKERV+EVD+ NFKY+YTVIEG  +GDK+EK+ +E+KIVAAP GGSI+KI+SK
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGDHEV AE +KG KE  E LL+ VE+YLLAHT EYN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 36. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 172.4 bits 798,  Expect = 5e-45
 Identities = 117/160 73%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 37. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 172.4 bits 798,  Expect = 5e-45
 Identities = 116/160 72%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE E  SVIPAAR+FK+++LDGDKL+PKVAPQAISSVEN+ GNGGPGTIK I F 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 38. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 172.4 bits 798,  Expect = 5e-45
 Identities = 117/160 73%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD L+PKVAPQAISSVEN+ GNGGPGTIK I F 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 39. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 172.2 bits 797,  Expect = 6e-45
 Identities = 117/160 73%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EG PFK+VK+RVDEVD+ NFKY+Y+VIEG  +GD LEK+S+E+KIVA P GGSI+KI++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 40. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 172.2 bits 797,  Expect = 6e-45
 Identities = 118/160 73%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD LIPKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+K+VA P GGSI++IS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGDHE+ AE MK  KE  E LLRAVESYLLAH+D YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 41. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 172.2 bits 797,  Expect = 6e-45
 Identities = 117/160 73%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 42. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 172.0 bits 796,  Expect = 7e-45
 Identities = 117/160 73%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EG PFK+VK+RVDEVD+ NFKY+Y+VIEG  +GD LEK+S+E+KIVA P GGSI+KI++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 43. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 172.0 bits 796,  Expect = 7e-45
 Identities = 117/160 73%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 44. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 172.0 bits 796,  Expect = 7e-45
 Identities = 120/160 75%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAET SVIPAARLFK+++LDG+ LIPKVAPQA+SSVENV GNGGPGTIK ITF+
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSP K+VKERV+EVD+ NFKY+YTVIEG  +GDK+EK+ +E+KIVAAP GGSI+KI+SK
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGDHEV AE +KG KE  E LL+ VE+YLLAHT EYN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 45. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 171.8 bits 795,  Expect = 8e-45
 Identities = 117/160 73%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE+ET SVIPAARLFK+++L+GD LIPKVAPQAISSVEN+ GNGGPGTIK I F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 46. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 171.4 bits 793,  Expect = 1e-44
 Identities = 117/159 73%, Positives = 139/159 87%, Gaps = 0/159 0%
Query  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
            GVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 121
            G PFK+VK+RVDEVD+ANFKY+Y++IEG  +GD LEK+S+E+KIVA P GGSI+KIS+K+
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  122  HAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            H KGDHEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 47. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 171.2 bits 792,  Expect = 1e-44
 Identities = 117/160 73%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EG PFK+VK RVDEVD+ NFKY+Y+VIEG  +GD LEK+S+E+KIVA P GGSI+KI++K
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 48. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 170.6 bits 789,  Expect = 2e-44
 Identities = 116/160 72%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
             G PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 49. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 169.6 bits 784,  Expect = 4e-44
 Identities = 117/160 73%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EG PFK+VK+RVDEV + NFKY+Y+VIEG  +GD LEK+S+E+KIVA P G SI+KIS+K
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 50. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 162.8 bits 751,  Expect = 4e-42
 Identities = 113/150 75%, Positives = 131/150 87%, Gaps = 0/150 0%
Query  4    FNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAEGS 63
            FNYE+ET SVIPAARLFK+++L+GD LIPKVAPQAISSVEN+ GNGGPGTIK ITF EGS
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   PFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHA 123
            PFK+VKERVDEVD+ANFKY+Y++IEG  LGD LEK+ +E+KIVA P GGSI+KIS+K+H 
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  124  KGDHEVNAEKMKGAKEMAEKLLRAVESYLL 153
            KGDHE+ AE MK  KE  E LLRAVESYLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 51. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 159.1 bits 733,  Expect = 5e-41
 Identities = 109/150 72%, Positives = 129/150 86%, Gaps = 0/150 0%
Query  4    FNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAEGS 63
            FNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSV+N+ GNGGPGTIK I F EG 
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   PFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHA 123
            PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG I+KIS+K+H 
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  124  KGDHEVNAEKMKGAKEMAEKLLRAVESYLL 153
            KG+HEV AE++K +KEM E LLRAVESYLL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 52. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 154.6 bits 711,  Expect = 1e-39
 Identities = 106/160 66%, Positives = 130/160 81%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE E  SVI  ARLFKS+VLD D LIPKVAP+ +SS EN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS FK++K RVDE+D+ANFKY Y++IEG  LGD LEK+S+E+KIVAAPGGGSI+KI+SK
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGD  +N E++K  KE    L++AVE+YL+AH + YN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 53. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 154.4 bits 710,  Expect = 1e-39
 Identities = 104/160 65%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIP ARLFK +VLD D LIPKVAP+AI S+E + GNGGPGTIK I F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSPF ++K++V+E+D ANF Y Y+VIEGD L DKLEK+++E+KIVA+P GGSI+K  SK
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H  GDHE+  E++K  KE A  L++AVE YLLAH+D YN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 54. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 147.8 bits 678,  Expect = 1e-37
 Identities = 102/159 64%, Positives = 128/159 80%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF YE E  SVIP ARLFKS+VLD D LIPKVAPQ  +S EN+ GNGGPGTIK ITFA
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAP-GGGSIVKISS 119
            EG+ FK++K +V+E+D+ANFKY Y++IEG  LG  LEK+S+E+K+ AAP GGGSI+KI+S
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KFHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEY 159
            K+H KG+  +N E++K  KE A  L++AVE+YLLAH D Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 55. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 147.2 bits 675,  Expect = 2e-37
 Identities = 101/159 63%, Positives = 128/159 80%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF+YE E  SVIP ARLFKS+VLD D LIPKVAPQ  +S EN+ GNGGPGTIK ITFA
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAP-GGGSIVKISS 119
            EG+ FK++K +V+E+D+ANFKY Y++IEG  LG  LEK+ +E+K+ AAP GGGSI+KI+S
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  120  KFHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEY 159
            K+H KG+  +N E++K  KE A  L++AVE+YLLAH D Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 56. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 147.0 bits 674,  Expect = 2e-37
 Identities = 101/159 63%, Positives = 128/159 80%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF+YE E  SVIP ARLFKS+VLD D LIPKVAPQ  +  EN+ GNGGPGTIK ITFA
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAP-GGGSIVKISS 119
            EGS FK++K +V+E+D+ANFKY Y++IEG  LG  LEK+S+E+K+ AAP GGGSI+KI+S
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KFHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEY 159
            K+H KG+  ++ E++K  KE A  L++AVE+YLLAH D Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 57. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 146.6 bits 672,  Expect = 3e-37
 Identities = 99/160 61%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF +E E  S IP  RLFK++VLD D LIPK+AP+AI S E + GNGGPGTIK ITF 
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS FK+VK R+DE+D ANF Y Y+VIEGDV+ + LEK+S+E+KIVA+P GGSI+K +SK
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KG++E+  EK+   KE A  L++AVE+YLLAH+D YN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 58. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 146.4 bits 671,  Expect = 4e-37
 Identities = 101/159 63%, Positives = 127/159 79%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF YE E  SVIP ARLFKS+VLD D LIPKVAPQ  +  EN+ GNGGPGTIK ITFA
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAP-GGGSIVKISS 119
            EGS FK++K +V+E+D+ANFKY Y++IEG  LG  LEK+S+E+K+ AAP GGGSI+KI+S
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KFHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEY 159
            K+H KG+  ++ E++K  KE A  L++AVE+YLLAH D Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 59. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 146.2 bits 670,  Expect = 4e-37
 Identities = 100/160 62%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF YE E+ SVIP ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK I F 
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS +K+VK R D +D ANF Y Y+VIEGD L DK+EK+S+E KIVA+  GGSI+K  S 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H+KGDHE+  E +K  KE A  L++AVE YLLAH D YN
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 60. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 145.5 bits 667,  Expect = 6e-37
 Identities = 95/160 59%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPA RLFK+++LDGD LIPK+APQAI S E + G+GG GTIK +TF 
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK+RV+ +D  NF Y+Y++IEGD L DKLEK+++E K++A+P GGSI+K +S 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +HAKGD E+  E +K  KE A  L++ +E+YLLAH+D YN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 61. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 142.9 bits 654,  Expect = 4e-36
 Identities = 93/160 58%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE E  SVIPA RLFK+++LDGD LIPK+APQAI S + + G+GG GTIK +TF 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK+RV+ +D  NF Y+Y++IEGD L DKLEK+++E K++A+P GGSI+K +S 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +HAKGD E+  E +K  KE A  L++ +E+YLLAH+D YN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 62. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 142.1 bits 650,  Expect = 7e-36
 Identities = 93/160 58%, Positives = 124/160 77%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE E  SVIPA RLFK+++LDGD LIPK+APQAI S E + G+GG GTIK +TF 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK+RV+ +D  NF Y+Y++IEGD L DKLEK+++E K++A+P GGSI+K +S 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            + AKGD E+  E +K  KE A  L++ +E+YLLAH+D YN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 63. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 142.1 bits 650,  Expect = 7e-36
 Identities = 95/160 59%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF YE+ET +VI  ARLFK++VLD D LIPKVAPQAI S E + G+GGPGTIK ITF 
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS F +VK R+DE+DNANF Y  T+IEGD + + LEK+++E+K+VA+P GGSI+K +SK
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGDHE+  +++K  KE A  +++AVE+YLLA+   Y+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 64. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 138.6 bits 633,  Expect = 8e-35
 Identities = 96/159 60%, Positives = 121/159 76%, Gaps = 0/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF YE+E  SVIP ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK ITF 
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS +K  K R+D +D  NF Y+++VIEGD L DKLE VS E KIVA+P GGSIVK +SK
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEY 159
            ++ KGD ++  E ++G KE A ++++AVE+YL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 65. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 136.3 bits 622,  Expect = 4e-34
 Identities = 89/160 55%, Positives = 116/160 72%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF YE+E  S IP  RLFK++VLD D L+PK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK ++D +D  N  Y+YT+IEGD LGD LEK+S+E K+VA+P GGSI+K +S 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGD E+  E +K  KE A  L++ +E+YL  H D YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 66. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 135.9 bits 620,  Expect = 5e-34
 Identities = 88/160 55%, Positives = 117/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF YE+E  S IP  RLFK++VLD D L+PK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK ++D +D  N+ Y+YT+IEGD LGD LEK+S+E K+VA+P GGSI+K +S 
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KG+ E+  E +K  KE A  L++ +E+YL  H D YN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 67. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 133.9 bits 610,  Expect = 2e-33
 Identities = 93/159 58%, Positives = 118/159 74%, Gaps = 0/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV  YE+E  SVIP ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK ITF 
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS +K  K R+D +D  NF ++++VIEGD L DKLE VS E KIVA+P GGSIVK + K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEY 159
            ++ KGD ++  E ++G KE A  +++AVE+YL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 68. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 131.8 bits 600,  Expect = 9e-33
 Identities = 88/159 55%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H K D E+  E +K  KE A  L++ +E+YLLAH+D YN
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 69. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 131.0 bits 596,  Expect = 2e-32
 Identities = 88/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VAA G GS++K +S 
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGD E+  E +K  KE A  L++ +E+YLL H D YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 70. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 130.4 bits 593,  Expect = 2e-32
 Identities = 87/159 54%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGD E+  E +K  KE A  L++ +E+YLL H D YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 71. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 130.2 bits 592,  Expect = 3e-32
 Identities = 86/160 53%, Positives = 117/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF YE E  SVIP  +LFK+++LD D LIPKVAP A+   E + G+GG GTIK +TF 
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK RVD +D  N+ Y+YT+IEGD L D +E +++++K+VA+P GGSIVK +S 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGD E+  E++K  KE A  L++ VE+YLLA+ D YN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 72. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 129.3 bits 588,  Expect = 5e-32
 Identities = 84/160 52%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP GG+I+K +SK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H  EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 73. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 129.1 bits 587,  Expect = 6e-32
 Identities = 89/159 55%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGD E+  E +K  KE A  L++ +ESYL  H D YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 74. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 129.1 bits 587,  Expect = 6e-32
 Identities = 89/159 55%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGD E+  E +K  KE A  L++ +ESYL  H D YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 75. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 128.9 bits 586,  Expect = 6e-32
 Identities = 89/159 55%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP  RLFK +VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGD E+  E +K  KE A  L++ +ESYL  H D YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 76. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 128.9 bits 586,  Expect = 6e-32
 Identities = 82/160 51%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP GG+++K +SK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H  EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 77. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 128.5 bits 584,  Expect = 9e-32
 Identities = 83/160 51%, Positives = 118/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MG+F Y  E+ SVIP  RLFK+ VL+ D LIPK+APQ++ S E V G+GG GTIK I+F 
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK ++D +D  NF YNY+++EGD L DK+EK+S+E+K+VA+  GGS++K +S 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGD E+  E +K  KE A  L++ +E+YL+A+ D YN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 78. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 128.3 bits 583,  Expect = 1e-31
 Identities = 88/159 55%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K++A+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMAS-GSGSIIKSISH 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGD E+  E +K  KE A  L++ +ESYL  H D YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 79. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 128.3 bits 583,  Expect = 1e-31
 Identities = 91/159 57%, Positives = 115/159 72%, Gaps = 0/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF +E++  SVI  ARLFK+  LD D LI KV PQAI S E + GNGGPGTIK ITF 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS +K  K R+D +D  NF Y+++VIEGD L DKLE VS E KIVA+P GGSI K +SK
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEY 159
            ++ KGD ++  E ++G KE A  +++AVE+YL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 80. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 128.3 bits 583,  Expect = 1e-31
 Identities = 83/160 51%, Positives = 122/160 76%, Gaps = 1/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF YE+E  S I  ARLFK++VLDGD L+PK+APQA+  VE + GNGG GTIK ITF 
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVL-GDKLEKVSHELKIVAAPGGGSIVKISS 119
            +G PFK+VK +++ +D  ++ Y+Y++IEGD L G++LEK++HE K+VA+  GG+++K  S
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  120  KFHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            K+++ GD +VN EK+K  ++ A ++L+ VE+YL  H + YN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 81. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 128.1 bits 582,  Expect = 1e-31
 Identities = 82/160 51%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK ++  +D  N  Y+Y++IEGD L + +EK+ +E K+V+AP GG+I+K +SK
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H  EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 82. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 127.9 bits 581,  Expect = 1e-31
 Identities = 88/159 55%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGT K ITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGD E+  E +K  KE A  L++ +ESYL  H D YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 83. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 127.9 bits 581,  Expect = 1e-31
 Identities = 88/159 55%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGD E+  E +K  KE A  L++ +ES+L  H D YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 84. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 127.7 bits 580,  Expect = 1e-31
 Identities = 89/158 56%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
            GV+ YE E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF E
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 121
            GS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S +
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 119
Query  122  HAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            H KGD E+  E +K  KE A  L++ +ESYL  H D YN
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 85. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 127.5 bits 579,  Expect = 2e-31
 Identities = 88/159 55%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGD E+  E +   KE A  L++ +ESYL  H D YN
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 86. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 127.5 bits 579,  Expect = 2e-31
 Identities = 86/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KG+ E+  E +K  KE A  L++ +ESYL  H D YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 87. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 127.5 bits 579,  Expect = 2e-31
 Identities = 83/160 51%, Positives = 112/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MG + YE E  S IPA +LFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP GG+I+K +SK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H  EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 88. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 127.1 bits 577,  Expect = 2e-31
 Identities = 86/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KG+ E+  E +K  KE A  L++ +ESYL  H D YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 89. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 126.9 bits 576,  Expect = 3e-31
 Identities = 87/159 54%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MG++ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK RVD +D A++ Y YT+IEGD L D +EK+S+E K+VA+ G GS +K  S 
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVAS-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGD E+  E +K  KE A  L++ +ESYL  H D YN
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 90. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 126.7 bits 575,  Expect = 3e-31
 Identities = 86/159 54%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KG+ E+  E +K  KE A  L++ +ESYL  H D YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 91. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 126.5 bits 574,  Expect = 4e-31
 Identities = 85/159 53%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF YE E  SVIP ARL+ ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK ++D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K  S 
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSISH 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGD E+  E +K  KE A  L++ +E+YLL H D YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 92. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 126.3 bits 573,  Expect = 4e-31
 Identities = 86/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KG+ E+  E +K  KE A  L++ +ESYL  H D YN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 93. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 126.1 bits 572,  Expect = 5e-31
 Identities = 85/159 53%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KG+ E+  E +K  K  A  L++ +ESYL  H D YN
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 94. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 125.8 bits 571,  Expect = 5e-31
 Identities = 86/159 54%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV  +E E  S IP +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KG+ E+  E +K  KE A  L++ +ESYL  H D YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 95. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 125.8 bits 571,  Expect = 5e-31
 Identities = 85/159 53%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +E +S+E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KG+ E+  E +K  KE A  L++ +ESYL  H D YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 96. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 125.0 bits 567,  Expect = 1e-30
 Identities = 86/159 54%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV  +E E  S IP +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KG+ E+  E +K  KE A  L++ +ESYL  H D YN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 97. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 125.0 bits 567,  Expect = 1e-30
 Identities = 82/159 51%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP G +I+K +SK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H  EYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 98. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 124.6 bits 565,  Expect = 1e-30
 Identities = 84/159 52%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G G+ +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGATIKSISH 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +H KG+ E+  E +K  KE    L++ +ESYL  H D YN
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 99. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 122.4 bits 554,  Expect = 6e-30
 Identities = 86/158 54%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV  +E++  SVIP ARLFK++VLD D LIPKV PQAI S+E + GNGGPGTIK ITF 
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            E S FK+ K R+D +D  N  Y+++VIEGD L D +  VS E+K VA+P GGSI K ++K
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEY 159
            ++ KGD ++  E+++   E    L +AVE+YLLAH D Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 100. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 120.3 bits 544,  Expect = 3e-29
 Identities = 86/158 54%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF +E++  SVI  ARLFK+  LD D LI KV PQAI S E + GNGGPGTIK ITF 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            E S FK+ K R+D +D  N  Y+++VIEGD L   +E VS E+K VA+P GGSI+K ++K
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEY 159
            ++ KGD ++  E+++ A E A  LL+AVE+YL+AH D Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 101. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 120.3 bits 544,  Expect = 3e-29
 Identities = 82/159 51%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+NYE++  SVIP ARLFK++VLD D LI KV P+A+ S E + GNGGPGTIK  TF 
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            E S  K+ K R+D +D  N  Y+++VIEG+ L D +  +S E+K VA+P GGSI+K ++K
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            ++ KG  ++  E+++ A E    L++AVE+YLLAH D YN
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 102. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 119.1 bits 538,  Expect = 6e-29
 Identities = 80/157 50%, Positives = 115/157 73%, Gaps = 0/157 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV  Y+ E PS +P  +L+K+++LDGD L+PKV P+AI  V+ + G+G  GTIK +TF 
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS  K VK+RVD +D  N+ Y+YT+IEGDVL +K+E +S+ +KIVA P GGSI K  S 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTD 157
            +  KGD +V+ E++K  KE A ++++A+E+YLLA+ D
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157

Sequence Alignment: 103. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 107.8 bits 483,  Expect = 1e-25
 Identities = 76/156 48%, Positives = 106/156 67%, Gaps = 1/156 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MG   Y+ E PS I A ++FK++VLDGD +IPK  P+AI+ V+ + G+GG GTIK  TF 
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGS  K VK R+D +D  NF Y+Y++IEG  L D +E +S+ +KIVA P GG I K  S 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTD 157
            +  K D +V+ E++K  KE A  +++ VE+YLLA+ D
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPD 156

Sequence Alignment: 104. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 107.5 bits 481,  Expect = 2e-25
 Identities = 69/134 51%, Positives = 100/134 74%, Gaps = 1/134 0%
Query  12   SVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAEGSPFKFVKER 71
            SVIP  +LFK++VLD D LIPK+APQA+ SVE + G+GG GT+K I + EG+   +VK +
Sbjct  3    SVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKHK 62
Query  72   VDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGDHEVNA 131
            +D +D  NF Y+Y++ EGD LGDK+EK+S+E+K+VA+ G GSI+K +S +H KG  E+  
Sbjct  63   IDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVAS-GRGSIIKTTSHYHCKGGAEIKE 121
Query  132  EKMKGAKEMAEKLLR 146
            E++K  KE A  L++
Sbjct  122  EQVKDGKERAAGLFK 136

Sequence Alignment: 105. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 107.6 bits 482,  Expect = 2e-25
 Identities = 77/158 48%, Positives = 106/158 67%, Gaps = 2/158 1%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF +E E  S +  A L+K+ V D D +IPK A  +  SVENV GNGGPGTIK ITF 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            E    KFV  +++ +D AN+ Y+Y+V+ G  L D  EK++ + K+VA P GGS  K++ K
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160
            +  KGD E N +++K  K  A+ L++A+E+YLLAH D YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPD-YN 158

Sequence Alignment: 106. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 104.1 bits 465,  Expect = 2e-24
 Identities = 68/159 42%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV  +  E+ + I   RLFK  VLD D L+PK+  + + S+E V G+GG G+IK + F 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EG P K++K ++  +D+ N+   Y++IEGDVLGDKLE +++++K  AA  GG + K +++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEY 159
            +H KGDH V+ E+    K  A  L++A+E+YLLA+   Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 107. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 102.5 bits 457,  Expect = 6e-24
 Identities = 64/159 40%, Positives = 104/159 65%, Gaps = 0/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV  Y  E+ + I   RLFK+ VLD D L+PK+  Q + + E + G+GG G+IK + F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EG P K++K ++  +D+ N++  Y++IEGD+LG+KLE +++++K  A   GG + K +++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEY 159
            +H KGDH V+ E+    +E    + +AVE+YLLA+   Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 108. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 101.4 bits 452,  Expect = 1e-23
 Identities = 69/157 43%, Positives = 101/157 64%, Gaps = 2/157 1%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF +E E  S +P A+L+ + + D D + PK+    + SVE V GNGGPGTIK +T  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            E    KF+  +V+ +D AN+ YNY+V+ G  L    EK++ E K+V  P GGSI K++ K
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEY 159
            +H KGD + + E++K  K   E L+RA+E Y+LA+  +Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 109. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 101.0 bits 450,  Expect = 2e-23
 Identities = 68/154 44%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            M VF +E +T S +  A L+K+ V D D ++PK A  +  SVE V GNGGPGTIK I+F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            E    KFV  +++E+D AN+ Y+Y+++ G  L D  EK+S + K+   P GGS+VK+S K
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155
            +H+KGD   N +++K  K  ++ L++ +E+YLLA+
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154

Sequence Alignment: 110. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 100.8 bits 449,  Expect = 2e-23
 Identities = 65/155 41%, Positives = 101/155 65%, Gaps = 0/155 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            E    KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155
            +H+KGD   N +++K  K  ++ L++AVE+YLLA+
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155

Sequence Alignment: 111. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 99.4 bits 442,  Expect = 5e-23
 Identities = 64/154 41%, Positives = 100/154 64%, Gaps = 0/154 0%
Query  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
            GVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 121
                KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  +
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  122  HAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155
            H+KGD   N +++K  K  ++ L++AVE+YLLA+
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154

Sequence Alignment: 112. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 96.1 bits 426,  Expect = 5e-22
 Identities = 66/153 43%, Positives = 102/153 66%, Gaps = 2/153 1%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV  +E E+ S +P A+LFK+ V+DGD+L PK+ P AI S+E V GNGGPGT+K +T  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            E     +V  ++D +D A + Y+YT+  G  + + LEKVS + K+ AA GG S +K+S  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAADGG-SKIKVSVT 118
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155
            FH KGD  +  E  +  K+ ++ +++A+E Y+L++
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 113. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 93.8 bits 415,  Expect = 3e-21
 Identities = 58/142 40%, Positives = 94/142 66%, Gaps = 1/142 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV  Y  E+ + I   RLFK+ VLD D L+PK+  Q + + E + G+GG G+IK + F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EG P K++K ++  +D+ N++  Y++IEGD+LG+KLE +++++K  A   GG + K +++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  FHAKGDHEVNAEKMK-GAKEMAE 142
            +H KGDH V+ E+   G +E  E
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHE 143

Sequence Alignment: 114. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 91.8 bits 405,  Expect = 9e-21
 Identities = 63/154 40%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            M VF ++ +  S +  A L+ +   D D +IPK A  +  SVE V GNGGPGTIK I+F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            E    KFV  +++ VD AN+ Y+Y+++ G  L D  EK++ + KI     GGS++K++  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155
            +H KGD   N +++K  K  ++ L++AVE+YLLA+
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLAN 154

Sequence Alignment: 115. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 90.6 bits 399,  Expect = 2e-20
 Identities = 61/155 39%, Positives = 100/155 64%, Gaps = 2/155 1%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            M V  +E  T S+ P+  +FK++V+D D + PK  P+   S++ + G+GG GTIK+IT++
Sbjct  1    MAVAEFEI-TSSLSPSN-IFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYS 58
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            +G PF   K +VD +D+ NF  +YT+ EGDVL   +E  +H LK + +  GGS+ K S  
Sbjct  59   DGVPFTSSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMV 118
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTD 157
            F  KGD ++  E +   KE  +K ++A+E+Y+++H +
Sbjct  119  FKCKGDAKLTDENVSLMKEGLKKTFKAIETYVISHPE 155

Sequence Alignment: 116. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 89.1 bits 392,  Expect = 6e-20
 Identities = 61/154 39%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV  +  E  S + A ++F+ +V+D D ++PK AP A  SVE + G+GGPGT+K IT+ 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            +G P   +  R+D V+   + ++Y+VI+GD+L   +E + + + +V    GGSI K ++ 
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155
            FH KGD  V  E +K A E    L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 117. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 89.1 bits 392,  Expect = 6e-20
 Identities = 59/155 38%, Positives = 97/155 62%, Gaps = 0/155 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV   E    S +PAA+LFK+  LD D L+P+V P AI   E + G+GG GT+K +T+ 
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            + SP+K +K+++D +D   F ++Y++I+GD+L   ++ +++ L  V    GG     ++ 
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155
            F+ KGD  V  E +K A +    +++AVE+YLLA+
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 118. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 88.9 bits 391,  Expect = 7e-20
 Identities = 63/154 40%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV     E PS + A ++++ ++LD D + PKV PQ I SVE + G+GG GT+K + + 
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            E + +  +K++VD +D A + Y YT I GD+L D LE V +E+ +V    GG IVK ++ 
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEF-VVVPTDGGCIVKNTTI 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155
            ++ KGD  +  +K+K A E +   ++AVE+YLLA+
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 119. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 87.9 bits 386,  Expect = 1e-19
 Identities = 61/154 39%, Positives = 100/154 64%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV   E E PS + A ++++ ++LD D + PKV PQ I SVE + G+GG GT++ + + 
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            E + +  +K++VD +D A + Y YT I GD+L + LE V +++ +V    GG IVK ++ 
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQF-VVVPTDGGCIVKNTTI 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155
            ++ KGD  +  +K+K A E +   ++AVE+YLLA+
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 120. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 87.1 bits 382,  Expect = 2e-19
 Identities = 64/154 41%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MG  ++  E  S + A ++F   VLD D +IPK AP A  SV+ V G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSP   +  R D V+   + Y+ TVI+GD+L   +E +   L +V    GGSI K ++ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155
            FH KGD  V  E +K A E    L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 86.5 bits 379,  Expect = 4e-19
 Identities = 64/154 41%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MG  ++  E  S + A ++F   VLD D +IPK AP A  SVE V G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSP   +  R D V+   + Y+ TVI+GD+L   +E +   L +V    GGSI K ++ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 85.8 bits 376,  Expect = 6e-19
 Identities = 62/154 40%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MG  ++  E  S + A ++F   VLD D +IPK AP A  SV+ V G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSP   +  R D V+   + Y+ TVI+GD+L + +E +   + +V    GGSI K ++ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 85.4 bits 374,  Expect = 9e-19
 Identities = 62/154 40%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MG  ++  E  S + A ++F   VLD D +IPK AP A  SV+ V G+GG GT++ IT+ 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 73
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSP   +  R D V+   + Y+ TVI+GD+L + +E +   + +V    GGSI K ++ 
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 124. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 84.2 bits 368,  Expect = 2e-18
 Identities = 62/154 40%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MG  ++  E  S + A ++F   VLD D +IPK A  A  SVE V G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            EGSP   +  R D V+   + Y+ TVI+GD+L   +E +   + +V    GGSI K ++ 
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 62.7 bits 262,  Expect = 4e-12
 Identities = 37/80 46%, Positives = 52/80 65%, Gaps = 0/80 0%
Query  81   KYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGDHEVNAEKMKGAKEM 140
            +Y Y  +EGD L D LEK+ +E K+V+AP   +I+K +SK+H KGD E+  E +K  KE 
Sbjct  21   QYGYVKVEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEK 80
Query  141  AEKLLRAVESYLLAHTDEYN 160
            A  L++ +E YL  H  EYN
Sbjct  81   AAHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 48.0 bits 189,  Expect = 5e-08
 Identities = 30/50 60%, Positives = 35/50 70%, Gaps = 0/50 0%
Query  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGP 51
            GVF +E++  SVI  ARLFK+  LD D LI KV PQAI S E + GNGGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 41.9 bits 162,  Expect = 1e-05
 Identities = 44/141 31%, Positives = 69/141 48%, Gaps = 13/141 9%
Query  4    FNYEAETPSVIPA--ARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITF-A 60
            FN + E    + A  A L K ++     ++PKV P+ +  V+ + G+GG GTI    F  
Sbjct  5    FNTQTELSVRLEALWAVLSKDFIT----VVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
            E SP  + +E + E D ++ +    VIEG  L   L      +K+       ++V +   
Sbjct  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
Query  121  FHAKGDHEVNAEKMKGAKEMAEKL--LRAVESYL 152
            +    D E   EK+   K     L  LR +E YL
Sbjct  120  YDHDSDIE---EKVTPTKTSQSTLMYLRRLERYL 150

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 30.1 bits 100,  Expect = 0.005
 Identities = 15/24 62%, Positives = 20/24 83%, Gaps = 0/24 0%
Query  2    GVFNYEAETPSVIPAARLFKSYVL 25
            GVF +E++  SVIP ARLFK++VL
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.