The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG
EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK
FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA50325 Cor a 1.0103 160 1020 256.4 2.7e-70
CAA50327 Cor a 1.0101 160 1006 253.0 2.9e-69
Q08407 Cor a 1 159 999 251.3 9.4e-69
CAA50328 Cor a 1.0102 160 989 248.8 5.2e-68
CAA50326 Cor a 1.0104 160 963 242.5 4.2e-66
ABZ81040 Car b 1.0109 160 937 236.1 3.4e-64
ABZ81043 Car b 1.0112 160 933 235.2 6.8e-64
ABZ81041 Car b 1.0110 160 932 234.9 8e-64
ADK39021 Ost c 1.0101 160 932 234.9 8e-64
ABZ81044 Car b 1.0113 160 929 234.2 1.3e-63
ABZ81042 Car b 1.0111 160 928 233.9 1.6e-63
CAB02206 Car b 1.0103 160 921 232.2 5.2e-63
CAB02209 Car b 1.0106 160 921 232.2 5.2e-63
CAB02207 Car b 1.0104 160 920 232.0 6.1e-63
CAA47357 Car b 1.0102 159 915 230.8 1.4e-62
CAB02208 Car b 1.0105 160 909 229.3 3.9e-62
CAB02213 Car b 1.0107 160 907 228.8 5.5e-62
P38949 Car b 1 159 897 226.4 3e-61
CAB02215 Car b 1.0108 160 897 226.4 3e-61
P38950 Car b 1 159 894 225.6 4.9e-61
CAB02216 Car b 1.0301 161 827 209.3 4.2e-56
CAB02217 Car b 1.0302 161 823 208.3 8.3e-56
CAA96548 Cor a 1.0201 160 818 207.1 1.9e-55
Q39427 Bet v 1.0205 160 811 205.4 6.3e-55
AAB24432 Aln g 1 160 811 205.4 6.3e-55
P43186 Bet v 1.0204 160 810 205.1 7.4e-55
P38948 Aln g 1 159 804 203.7 2e-54
P43184 Bet v 1.0203 160 803 203.4 2.4e-54
CAA54421 Bet v 1.0201 160 802 203.2 2.9e-54
CAA04828.1 Bet v 1.0206 159 800 202.7 4e-54
CAB02160 Bet v 1.0113 160 796 201.7 7.9e-54
CAA54481 Bet v 1.0202 160 794 201.2 1.1e-53
CAB02159 Bet v 1.0112 160 791 200.5 1.8e-53
CAA33887 Bet v 1.0101 160 791 200.5 1.8e-53
CAB02156 Bet v 1.0109 160 790 200.2 2.2e-53
CAB02161 Bet v 1.0114 160 789 200.0 2.6e-53
CAA54487 Bet v 1.0106 160 787 199.5 3.6e-53
CAA54484 Bet v 1.0104 160 786 199.3 4.3e-53
CAA54483 Bet v 1.0103 160 782 198.3 8.5e-53
CAA54489 Bet v 1.0107 160 778 197.3 1.7e-52
CAA07323.1 Bet v 1.0117 160 778 197.3 1.7e-52
CAA54482 Bet v 1.0102 160 778 197.3 1.7e-52
CAB02155 Bet v 1.0108 160 777 197.1 2e-52
CAB02157 Bet v 1.0110 160 776 196.8 2.3e-52
CAA54485 Bet v 1.0105 160 775 196.6 2.8e-52
CAA04827.1 Bet v 1.0116 159 773 196.1 3.8e-52
CAA07329.1 Bet v 1.0118 160 771 195.6 5.4e-52
CAB02158 Bet v 1.0111 160 769 195.1 7.6e-52
CAA96547 Bet v 1.0115 160 769 195.1 7.6e-52
ACF75030.1 Bet v 1.0207 150 752 191.0 1.2e-50
ABC41615.1 Bet v 1.0119 150 720 183.2 2.8e-48
CAA54696.1 Bet v 1.0301 160 716 182.2 6e-48
CAA96549 Cor a 1.0301 160 705 179.5 3.9e-47
CAA96535 Mal d 1.0401 160 701 178.5 7.6e-47
APD76154 Jug r 5.0101 160 698 177.8 1.3e-46
ACJ23864 Fag s 1.0101 160 689 175.6 5.8e-46
CAA96536 Mal d 1.0402 160 688 175.3 6.9e-46
CAD10374 Cas s 1 160 687 175.1 8.1e-46
CAA96537 Mal d 1.0403 160 684 174.4 1.4e-45
AAD48405 Cor a 1.0401 161 677 172.7 4.5e-45
AAG40331 Cor a 1.0404 161 677 172.7 4.5e-45
AAG40329 Cor a 1.0402 161 673 171.7 8.8e-45
AAG40330 Cor a 1.0403 161 670 170.9 1.5e-44
Q2I6V8 Pru p 1.0101 160 649 165.8 5e-43
O24248 Pru av 1 160 647 165.3 7.1e-43
ABZ81046 Que a 1.0301 160 646 165.1 8.4e-43
Q256S7 Fra a 1 160 627 160.4 2.1e-41
Q3T923 Fra a 1 160 625 160.0 2.9e-41
AUH28179 Que m 1.0101 160 623 159.5 4.1e-41
CAA96534 Mal d 1.0301 159 621 159.0 5.7e-41
Q256S2 Fra a 1 160 621 159.0 5.8e-41
Q256S6 Fra a 1 160 618 158.3 9.6e-41
O50001 Pru ar 1 160 618 158.3 9.6e-41
AAK13027 Mal d 1.0302 159 616 157.8 1.3e-40
AAO25113 Mal d 1.0304 159 611 156.5 3.1e-40
Q256S4 Fra a 1 159 606 155.3 7.2e-40
ABZ81047 Que a 1.0401 160 603 154.6 1.2e-39
B6CQS9 Pru du 1.0101 160 602 154.3 1.4e-39
AAB01362 Mal d 1.0201 159 601 154.1 1.7e-39
AAD26545 Mal d 1.0202 159 601 154.1 1.7e-39
AAD13683 Mal d 1.0206 159 600 153.9 2e-39
AAD26548 Mal d 1.0204 159 597 153.1 3.3e-39
AAD26546 Mal d 1.0103 159 595 152.6 4.7e-39
AAD26547 Mal d 1.0203 159 595 152.6 4.7e-39
AAK13030 Mal d 1.0207 159 595 152.6 4.7e-39
CAD32318 Mal d 1.0208 158 594 152.4 5.5e-39
AAK13028 Mal d 1.0303 159 594 152.4 5.5e-39
AAD29671 Mal d 1.0108 159 593 152.2 6.5e-39
AAD26558 Mal d 1.0205 159 593 152.2 6.5e-39
AAD26552 Mal d 1.0104 159 591 151.7 9.2e-39
AFN42528 Can s 5.0101 161 591 151.7 9.3e-39
O65200 Pyr c 1 159 590 151.4 1.1e-38
CAA58646 Mal d 1.0101 159 589 151.2 1.3e-38
AAD26555 Mal d 1.0107 159 588 150.9 1.5e-38
AAD26553 Mal d 1.0105 159 587 150.7 1.8e-38
AAD26554 Mal d 1.0106 159 587 150.7 1.8e-38
AAK13029 Mal d 1.0109 159 583 149.7 3.5e-38
CAA88833 Mal d 1.0102 159 581 149.2 5e-38
QGS84240 Que i 1.0101 159 577 148.2 9.8e-38
ABZ81045 Que a 1.0201 159 569 146.3 3.8e-37
QOL10866 Que ac 1.0101 159 569 146.3 3.8e-37
CAM31908 Act c 8.0101 159 550 141.7 9.4e-36
Q0Z8U9 Rub i 1.0101 137 513 132.7 4e-33
CAM31909 Act d 8.0101 157 498 129.0 6.1e-32
CAA42646 Gly m 4 158 480 124.6 1.3e-30
NP_001275580 Sola l 4.0201 160 466 121.1 1.4e-29
CAA43637 Pha v 1 156 453 118.0 1.2e-28
AHC08073 Sola l 4.0101 160 453 118.0 1.3e-28
CAA43636 Pha v 1 155 449 117.0 2.4e-28
AAQ91847 Ara h 8.0101 157 449 117.0 2.5e-28
P25985 Pha v 1 155 446 116.3 4e-28
EF436550 Ara h 8.0201 153 432 112.9 4.2e-27
CAA67246 Pet c PR10 155 411 107.7 1.5e-25
CAA75803 Lyc e 4.0101 178 411 107.6 1.8e-25
Q2VU97 Vig r 1.0101 155 409 107.2 2.1e-25
AAB92255 Tar o RAP 157 405 106.3 4.2e-25
P92918 Api g 1.0201 159 394 103.6 2.8e-24
AAL76932 Dau c 1.0201 154 388 102.1 7.3e-24
P49372 Api g 1 154 387 101.9 8.6e-24
CAB03716 Dau c 1.0104 154 378 99.7 3.9e-23
CAB06416 Dau c 1.0105 154 375 98.9 6.6e-23
BAA13604 Dau c 1.0102 154 372 98.2 1.1e-22
AAB01092 Dau c 1.0101 168 370 97.7 1.7e-22
CAB03715 Dau c 1.0103 154 359 95.0 9.8e-22
Q5ULZ4 Fra a 1.0101 100 257 70.4 1.6e-14
P85126 Que a 1.0101 50 203 57.7 5.6e-11
Q9ZWP8 Vig r 6.0101 155 168 48.4 1.1e-07
Q9S8Q4 Cas s 1 24 106 34.5 0.00026
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 256.4 bits 1020,  Expect = 3e-70
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 2. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 253.0 bits 1006,  Expect = 3e-69
 Identities = 157/160 98%, Positives = 158/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ET SVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHEINAEE+KGAKEMAEKLLRAVETYLLAHSAEYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 3. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 251.3 bits 999,  Expect = 9e-69
 Identities = 156/159 98%, Positives = 157/159 98%, Gaps = 0/159 0%
Query  2    GVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
            GVFNYE ET SVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
            GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  122  HAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            HAKGDHEINAEE+KGAKEMAEKLLRAVETYLLAHSAEYN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 4. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 248.8 bits 989,  Expect = 5e-68
 Identities = 155/160 96%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ET SVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGSRYKYVKERVDEVDNTNF YSYTVIEGDVLGDKLEKVC ELKIVAAPGGGSILKISSK
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHEINAEE+KGAKEMAEKLLRAVETYLLAHSAEYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 5. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 242.5 bits 963,  Expect = 4e-66
 Identities = 152/160 95%, Positives = 153/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ET SVI AARLFKSYVLDGDKLIPKVAPQAITSVENV GNGGPGTIKNITFG
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGSRYKYVKERVDEVDNTNF YSYTVIEGDVLGDKLEKVC ELKIVAAPGGGS LKISSK
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHEINAEE+KGAKEMAEKLLRAVETYLLAHSAEYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 6. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 236.1 bits 937,  Expect = 3e-64
 Identities = 145/160 90%, Positives = 153/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYEAET SVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSILKISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEE+KGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 7. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 235.2 bits 933,  Expect = 7e-64
 Identities = 144/160 90%, Positives = 153/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYEAET SVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEE+KGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 8. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 234.9 bits 932,  Expect = 8e-64
 Identities = 143/160 89%, Positives = 153/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYEAET SVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGS++KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEE+KGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 9. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 234.9 bits 932,  Expect = 8e-64
 Identities = 144/160 90%, Positives = 152/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYEAET SVIPAARLFKSYVLDGDKLIPKVAPQAI+ VENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSILKISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEE+KGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 10. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 234.2 bits 929,  Expect = 1e-63
 Identities = 144/160 90%, Positives = 152/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYEAET SVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +K+VKERVDEVDN NF YSYTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSK
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEE+KGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 11. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 233.9 bits 928,  Expect = 2e-63
 Identities = 143/160 89%, Positives = 153/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYEAET SVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAE++KGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 12. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 232.2 bits 921,  Expect = 5e-63
 Identities = 142/160 88%, Positives = 152/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYEAET SVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAE++KGAKEMAEKLLRAVE+YLLAH+ EYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 13. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 232.2 bits 921,  Expect = 5e-63
 Identities = 143/160 89%, Positives = 152/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYEAET SVIPAARLFKSYVLD DKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEE+KGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 14. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 232.0 bits 920,  Expect = 6e-63
 Identities = 142/160 88%, Positives = 151/160 94%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYEAET SVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NF Y+YTVIEGDVLGD LEKV HELKIVAAPGGGSI+KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEE+KGAKEMAEKLLRAVE+YLLAH+ EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 15. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 230.8 bits 915,  Expect = 1e-62
 Identities = 142/159 89%, Positives = 151/159 94%, Gaps = 0/159 0%
Query  2    GVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
            GVFNYEAET SVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
            GS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSKF
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            HAKG HE+NAEE+KGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 16. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 229.3 bits 909,  Expect = 4e-62
 Identities = 141/160 88%, Positives = 151/160 94%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYEAET SVIPAARLFKSYVLD DKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAE++KGAKEMAEKLLRAVE+YLLAH+ EYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 17. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 228.8 bits 907,  Expect = 6e-62
 Identities = 142/160 88%, Positives = 150/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYEAET SVIPAARLFKSYVLD DKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NF +SYTVIEGDVLGDKLEKV  ELKIVAAPGGGSILKIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEE+KGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 18. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 226.4 bits 897,  Expect = 3e-61
 Identities = 139/159 87%, Positives = 149/159 93%, Gaps = 0/159 0%
Query  2    GVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
            GVFNYEAET SVIPAARLFKSYVLDGDKLIPKVAPQ I+SVENV GNGGPGTIKNITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
            G  +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSKF
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            HAKG HE+NAE++KGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 19. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 226.4 bits 897,  Expect = 3e-61
 Identities = 140/160 87%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYEAET SV+PAARLFKSYVLD DKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NF +SYTVIEGDVLGDKLEKV  EL IVAAPGGGSILKIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEE+KGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 20. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 225.6 bits 894,  Expect = 5e-61
 Identities = 136/159 85%, Positives = 152/159 95%, Gaps = 0/159 0%
Query  2    GVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
            GVFNYEAETTSVIPAARLFK+++LDG+KLIPKV+PQA++SVENVEGNGGPGTIK ITF E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
            GS  KYVKERV+E+D+TNF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSKF
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            HAKG HE+NAEE+KGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 21. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 209.3 bits 827,  Expect = 4e-56
 Identities = 124/160 77%, Positives = 143/160 89%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYEAETTSVIPAARLFK+++LDG+KLIPKV+PQA++SVENVEGNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS  KYVKERV+EVD+TNF YSYTVIEG  +GDK+EK+C+E+KIVAAP GGSILKI+SK
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE IKG KE  E LL+ VE YLLAH+AEYN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 22. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 208.3 bits 823,  Expect = 8e-56
 Identities = 124/160 77%, Positives = 142/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYEAETTSVIPAARLFK+++LDG+ LIPKVAPQA++SVENVEGNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS  KYVKERV+EVD+TNF YSYTVIEG  +GDK+EK+C+E+KIVAAP GGSILKI+SK
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE IKG KE  E LL+ VE YLLAH+AEYN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 23. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 207.1 bits 818,  Expect = 2e-55
 Identities = 122/160 76%, Positives = 142/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE E+TSVIPAARLFK+++LDG+ LIPKVAPQA++SVENVEGNGGPGTIK ITF 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +KYVKERV+EVD+TNF YSYTVIEG  +GDK+EK+C+E+KIVAAP GGSILKIS+K
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE++AE IKG KE  E L+RAVE YLLAHS  YN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 24. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 205.4 bits 811,  Expect = 6e-55
 Identities = 121/160 75%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETTSVIPAARLFK+++LDGD LIPKVAPQAI+SVEN+EGNGGPGTIK ITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +KYVKERVDEVD+ NF YSY++IEG  LGD LEK+C+E+K+VA P GGSILKIS+K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE +K  KE AE LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 25. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 205.4 bits 811,  Expect = 6e-55
 Identities = 123/160 76%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYEAET SVIPAARLFK+++LDGDKL+PKVAP+A++SVEN+EGNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +KYVKERVDEVD  NF YS++VIEG  +GD LEKVC+E+KIVAAP GGSILKIS+K
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FH KGDHEINAE+IK  KE A  LL+AVE+YLLAHS  YN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 26. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 205.1 bits 810,  Expect = 7e-55
 Identities = 121/160 75%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE+ETTSVIPAARLFK+++LDGD LIPKVAPQAI+SVEN+EGNGGPGTIK ITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +KYVKERVDEVD+ NF YSY++IEG  LGD LEK+C+E+KIVA P GGSILKIS+K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE +K  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 27. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 203.7 bits 804,  Expect = 2e-54
 Identities = 122/159 76%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  2    GVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
            GVFNYEAET SVIPAARLFK+++LDGDKL+PKVAP+A++SVEN+EGNGGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
            GS +KYVKERVDEVD  NF YS++VIEG  +GD LEKVC+E+KIVAAP GGSILKIS+KF
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  122  HAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            H KGDHEINAE+IK  KE A  LL+AVE+YLLAHS  YN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 28. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 203.4 bits 803,  Expect = 2e-54
 Identities = 120/160 75%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE+ETTSVIPAARLFK+++L+GD LIPKVAPQAI+SVEN+EGNGGPGTIK ITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +KYVKERVDEVD+ NF YSY++IEG  LGD LEK+C+E+KIVA P GGSILKIS+K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE +K  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 29. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 203.2 bits 802,  Expect = 3e-54
 Identities = 120/160 75%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETTSVIPAARLFK+++L+GD LIPKVAPQAI+SVEN+EGNGGPGTIK ITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +KYVKERVDEVD+ NF YSY++IEG  LGD LEK+C+E+KIVA P GGSILKIS+K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE +K  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 30. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 202.7 bits 800,  Expect = 4e-54
 Identities = 119/159 74%, Positives = 138/159 86%, Gaps = 0/159 0%
Query  2    GVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
            GVFNYE+ETTSVIPAARLFK+++LDGD LIPKVAPQAI+SVEN+EGNGGPGTIK ITF E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
            GS +KYVKERVDEVD+ NF YSY++IEG  LGD LEK+C+E+K+VA P GGSILKIS+K+
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  122  HAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            H KGDHE+ AE +K  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 31. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 201.7 bits 796,  Expect = 8e-54
 Identities = 117/160 73%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETTSVIPAARLFK+++LDGD L+PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GGSILKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 32. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 201.2 bits 794,  Expect = 1e-53
 Identities = 119/160 74%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE+ETTSVIPAARLFK+++L+GD LIPKVAPQAI+SVEN+EGNGGPGTIK ITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +KYVKERVDEVD+ NF YSY++IEG  LGD LEK+C+E+KIVA P GGSILKIS+K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD+E+ AE +K  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 33. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 200.5 bits 791,  Expect = 2e-53
 Identities = 117/160 73%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETTSVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GGSILKIS+K
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 34. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 200.5 bits 791,  Expect = 2e-53
 Identities = 117/160 73%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETTSVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GGSILKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 35. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 200.2 bits 790,  Expect = 2e-53
 Identities = 117/160 73%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETTSVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GGSILKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 36. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 200.0 bits 789,  Expect = 3e-53
 Identities = 117/160 73%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETTSVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GGSILKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 37. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 199.5 bits 787,  Expect = 4e-53
 Identities = 117/160 73%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE E TSVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF YSY+VIEG  +GD LEK+ +E+KIVA P GGSILKI++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE+IK +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 38. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 199.3 bits 786,  Expect = 4e-53
 Identities = 117/160 73%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE E TSVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF YSY+VIEG  +GD LEK+ +E+KIVA P GGSILKI++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE+IK +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 39. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 198.3 bits 782,  Expect = 8e-53
 Identities = 117/160 73%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE E TSVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK RVDEVD+TNF YSY+VIEG  +GD LEK+ +E+KIVA P GGSILKI++K
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE+IK +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 40. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 197.3 bits 778,  Expect = 2e-52
 Identities = 113/160 70%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE E TSVIPAAR+FK+++LDGDKL+PKVAPQAI+SVEN+EGNGGPGTIK I F 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 41. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 197.3 bits 778,  Expect = 2e-52
 Identities = 114/160 71%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETTSVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 42. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 197.3 bits 778,  Expect = 2e-52
 Identities = 114/160 71%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETTSVIPAARLFK+++LDGD L+PKVAPQAI+SVEN+EGNGGPGTIK I F 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 43. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 197.1 bits 777,  Expect = 2e-52
 Identities = 114/160 71%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETTSVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 44. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 196.8 bits 776,  Expect = 2e-52
 Identities = 114/160 71%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETTSVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 45. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 196.6 bits 775,  Expect = 3e-52
 Identities = 114/160 71%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE+ETTSVIPAARLFK+++L+GD LIPKVAPQAI+SVEN+EGNGGPGTIK I F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 46. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 196.1 bits 773,  Expect = 4e-52
 Identities = 114/159 71%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  2    GVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
            GVFNYE E TSVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
            G  +KYVK+RVDEVD+ NF YSY++IEG  +GD LEK+ +E+KIVA P GGSILKIS+K+
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  122  HAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 47. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 195.6 bits 771,  Expect = 5e-52
 Identities = 115/160 71%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETTSVIPAARLFK+++LDGD LIPKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+K+VA P GGSIL+IS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE +K  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 48. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 195.1 bits 769,  Expect = 8e-52
 Identities = 113/160 70%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETTSVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
             G  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 49. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 195.1 bits 769,  Expect = 8e-52
 Identities = 116/160 72%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETTSVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEV + NF YSY+VIEG  +GD LEK+ +E+KIVA P G SILKIS+K
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE+IK +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 50. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 191.0 bits 752,  Expect = 1e-50
 Identities = 112/150 74%, Positives = 131/150 87%, Gaps = 0/150 0%
Query  4    FNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEGS 63
            FNYE+ETTSVIPAARLFK+++L+GD LIPKVAPQAI+SVEN+EGNGGPGTIK ITF EGS
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   RYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHA 123
             +KYVKERVDEVD+ NF YSY++IEG  LGD LEK+C+E+KIVA P GGSILKIS+K+H 
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  124  KGDHEINAEEIKGAKEMAEKLLRAVETYLL 153
            KGDHE+ AE +K  KE  E LLRAVE+YLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 51. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 183.2 bits 720,  Expect = 3e-48
 Identities = 106/150 70%, Positives = 129/150 86%, Gaps = 0/150 0%
Query  4    FNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEGS 63
            FNYE ETTSVIPAARLFK+++LDGD L PKVAPQAI+SV+N+EGNGGPGTIK I F EG 
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   RYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHA 123
             +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG ILKIS+K+H 
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  124  KGDHEINAEEIKGAKEMAEKLLRAVETYLL 153
            KG+HE+ AE++K +KEM E LLRAVE+YLL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 52. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 182.2 bits 716,  Expect = 6e-48
 Identities = 107/160 66%, Positives = 127/160 79%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE E TSVI  ARLFKS+VLD D LIPKVAP+ ++S EN+EGNGGPGTIK ITF 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +KY+K RVDE+D+ NF Y Y++IEG  LGD LEK+ +E+KIVAAPGGGSILKI+SK
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD  +N EEIK  KE    L++AVE YL+AH   YN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 53. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 179.5 bits 705,  Expect = 4e-47
 Identities = 106/160 66%, Positives = 127/160 79%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETTSVIP ARLFK +VLD D LIPKVAP+AI S+E +EGNGGPGTIK I F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS + Y+K++V+E+D  NF+Y Y+VIEGD L DKLEK+ +E+KIVA+P GGSILK  SK
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H  GDHE+  E+IK  KE A  L++AVE YLLAHS  YN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 54. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 178.5 bits 701,  Expect = 8e-47
 Identities = 103/160 64%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETTSVIPA RLFK+++LDGD LIPK+APQAI S E +EG+GG GTIK +TFG
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK+RV+ +D  NFTYSY++IEGD L DKLEK+ +E K++A+P GGSI+K +S 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +HAKGD EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 55. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 177.8 bits 698,  Expect = 1e-46
 Identities = 105/160 65%, Positives = 124/160 77%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF YE E+TSVIP ARLFK++VLD D LIPKV PQA+ S E +EGNGGPGTIK I FG
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+YKYVK R D +D  NFTY+Y+VIEGD L DK+EK+ +E KIVA+  GGSILK  S 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H+KGDHEI  E++K  KE A  L++AVE YLLAH   YN
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 56. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 175.6 bits 689,  Expect = 6e-46
 Identities = 102/160 63%, Positives = 130/160 81%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF YE+ETT+VI  ARLFK++VLD D LIPKVAPQAI S E +EG+GGPGTIK ITFG
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS++ YVK R+DE+DN NFTY+ T+IEGD + + LEK+ +E+K+VA+P GGSILK +SK
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHEI  ++IK  KE A  +++AVE YLLA+ A Y+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 57. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 175.3 bits 688,  Expect = 7e-46
 Identities = 101/160 63%, Positives = 127/160 79%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE E TSVIPA RLFK+++LDGD LIPK+APQAI S + +EG+GG GTIK +TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK+RV+ +D  NFTYSY++IEGD L DKLEK+ +E K++A+P GGSI+K +S 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +HAKGD EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 58. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 175.1 bits 687,  Expect = 8e-46
 Identities = 102/160 63%, Positives = 127/160 79%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF +E E TS IP  RLFK++VLD D LIPK+AP+AI S E +EGNGGPGTIK ITFG
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS++KYVK R+DE+D  NFTY Y+VIEGDV+ + LEK+ +E+KIVA+P GGSILK +SK
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG++EI  E++   KE A  L++AVE YLLAHS  YN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 59. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 174.4 bits 684,  Expect = 1e-45
 Identities = 101/160 63%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE E TSVIPA RLFK+++LDGD LIPK+APQAI S E +EG+GG GTIK +TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK+RV+ +D  NFTYSY++IEGD L DKLEK+ +E K++A+P GGSI+K +S 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            + AKGD EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 60. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 172.7 bits 677,  Expect = 4e-45
 Identities = 104/159 65%, Positives = 124/159 77%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF YE E TSVIP ARLFKS+VLD D LIPKVAPQ  TS EN+EGNGGPGTIK ITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAP-GGGSILKISS 119
            EG+ +KY+K +V+E+D+ NF Y Y++IEG  LG  LEK+ +E+K+ AAP GGGSILKI+S
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KFHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEY 159
            K+H KG+  IN EEIK  KE A  L++AVE YLLAH   Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 61. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 172.7 bits 677,  Expect = 4e-45
 Identities = 104/159 65%, Positives = 125/159 78%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF+YE E TSVIP ARLFKS+VLD D LIPKVAPQ  TS EN+EGNGGPGTIK ITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAP-GGGSILKISS 119
            EG+ +KY+K +V+E+D+ NF Y Y++IEG  LG  LEK+ +E+K+ AAP GGGSILKI+S
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  120  KFHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEY 159
            K+H KG+  IN EEIK  KE A  L++AVE YLLAH   Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 62. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 171.7 bits 673,  Expect = 9e-45
 Identities = 103/159 64%, Positives = 124/159 77%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF+YE E TSVIP ARLFKS+VLD D LIPKVAPQ  T  EN+EGNGGPGTIK ITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAP-GGGSILKISS 119
            EGS +KY+K +V+E+D+ NF Y Y++IEG  LG  LEK+ +E+K+ AAP GGGSILKI+S
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KFHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEY 159
            K+H KG+  I+ EEIK  KE A  L++AVE YLLAH   Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 63. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 170.9 bits 670,  Expect = 1e-44
 Identities = 103/159 64%, Positives = 123/159 77%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF YE E TSVIP ARLFKS+VLD D LIPKVAPQ  T  EN+EGNGGPGTIK ITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAP-GGGSILKISS 119
            EGS +KY+K +V+E+D+ NF Y Y++IEG  LG  LEK+ +E+K+ AAP GGGSILKI+S
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KFHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEY 159
            K+H KG+  I+ EEIK  KE A  L++AVE YLLAH   Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 64. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 165.8 bits 649,  Expect = 5e-43
 Identities = 95/160 59%, Positives = 119/160 74%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF YE+E TS IP  RLFK++VLD D L+PK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK ++D +D  N +YSYT+IEGD LGD LEK+ +E K+VA+P GGSI+K +S 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +ETYL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 65. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 165.3 bits 647,  Expect = 7e-43
 Identities = 94/160 58%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF YE+E TS IP  RLFK++VLD D L+PK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK ++D +D  N++YSYT+IEGD LGD LEK+ +E K+VA+P GGSI+K +S 
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE A  L++ +ETYL  H   YN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 66. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 165.1 bits 646,  Expect = 8e-43
 Identities = 98/159 61%, Positives = 121/159 76%, Gaps = 0/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF YE+E  SVIP ARLFK++VLD D LIPKV PQA+ S E +EGNGGPGTIK ITFG
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS  K+ K R+D +D  NFTYS++VIEGD L DKLE V  E KIVA+P GGSI+K +SK
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEY 159
            ++ KGD ++  E I+G KE A ++++AVE YL+AH   Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 67. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 160.4 bits 627,  Expect = 2e-41
 Identities = 92/160 57%, Positives = 118/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ YE E TS IPA +LFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS Y YVK ++  +D  N TYSY++IEGD L D +EK+ +E K+V+AP GG+I+K +SK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 68. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 160.0 bits 625,  Expect = 3e-41
 Identities = 90/160 56%, Positives = 118/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ YE E TS IPA +LFK++VLD D LIPK+APQA+   E +EG+GGPGTIK ITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS Y YVK ++  +D  N TYSY++IEGD L D +EK+ +E K+V+AP GG+++K +SK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 69. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 159.5 bits 623,  Expect = 4e-41
 Identities = 95/159 59%, Positives = 118/159 74%, Gaps = 0/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV  YE+E  SVIP ARLFK++VLD D LIPKV PQA+ S E +EGNGGPGTIK ITFG
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS  K+ K R+D +D  NFT+S++VIEGD L DKLE V  E KIVA+P GGSI+K + K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEY 159
            ++ KGD ++  E I+G KE A  +++AVE YL+AH   Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 70. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 159.0 bits 621,  Expect = 6e-41
 Identities = 93/159 58%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE E TSVIP ARLF ++VLD D LIPK+APQA+ S E +EG+GG GTIK I FG
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+ +E K+VA+ G GS++K +S 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H K D EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 71. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 159.0 bits 621,  Expect = 6e-41
 Identities = 90/160 56%, Positives = 118/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ YE E TS IPA +LFK++VLD D LIPK+APQA+   E +EG+GGPGTIK ITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS Y YVK ++  +D  N TYSY++IEGD L + +EK+ +E K+V+AP GG+I+K +SK
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 72. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 158.3 bits 618,  Expect = 1e-40
 Identities = 91/160 56%, Positives = 117/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MG + YE E TS IPA +LFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS Y YVK ++  +D  N TYSY++IEGD L D +EK+ +E K+V+AP GG+I+K +SK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 73. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 158.3 bits 618,  Expect = 1e-40
 Identities = 91/160 56%, Positives = 119/160 74%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF YE E TSVIP  +LFK+++LD D LIPKVAP A+   E +EG+GG GTIK +TFG
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK RVD +D  N++YSYT+IEGD L D +E + +++K+VA+P GGSI+K +S 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E++K  KE A  L++ VE YLLA+   YN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 74. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 157.8 bits 616,  Expect = 1e-40
 Identities = 92/159 57%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF YE+E TSVIP ARLF ++VLD D LIPK+APQA+ S E +EG+GG GTIK I FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+ +E K+VAA G GS++K +S 
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E YLL H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 75. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 156.5 bits 611,  Expect = 3e-40
 Identities = 91/159 57%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF YE+E TSVIP ARLF ++VLD D LIPK+APQA+ S E +EG+GG GTIK I FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+ +E K+VA+ G GS++K +S 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E YLL H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 76. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 155.3 bits 606,  Expect = 7e-40
 Identities = 90/159 56%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ YE E TS IPA +LFK++VLD D LIPK+APQA+   E +EG+GGPGTIK ITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS Y YVK ++  +D  N TYSY++IEGD L D +EK+ +E K+V+AP G +I+K +SK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 77. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 154.6 bits 603,  Expect = 1e-39
 Identities = 95/159 59%, Positives = 116/159 72%, Gaps = 0/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF +E++ TSVI  ARLFK+  LD D LI KV PQAI S E +EGNGGPGTIK ITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS  K+ K R+D +D  NFTYS++VIEGD L DKLE V  E KIVA+P GGSI K +SK
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEY 159
            ++ KGD ++  E I+G KE A  +++AVE YL+AH   Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 78. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 154.3 bits 602,  Expect = 1e-39
 Identities = 86/160 53%, Positives = 119/160 74%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MG+F Y  E+TSVIP  RLFK+ VL+ D LIPK+APQ++ S E VEG+GG GTIK I+FG
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS Y YVK ++D +D  NF Y+Y+++EGD L DK+EK+ +E+K+VA+  GGS++K +S 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E++K  KE A  L++ +E YL+A+   YN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 79. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 154.1 bits 601,  Expect = 2e-39
 Identities = 91/159 57%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E TS IP  RLFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K+VA+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 80. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 154.1 bits 601,  Expect = 2e-39
 Identities = 91/159 57%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E TS IP  RLFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K+VA+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 81. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 153.9 bits 600,  Expect = 2e-39
 Identities = 91/159 57%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E TS IP  RLFK +VLD D LIPK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K+VA+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 82. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 153.1 bits 597,  Expect = 3e-39
 Identities = 90/159 56%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E TS IP  RLFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K++A+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMAS-GSGSIIKSISH 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 83. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 152.6 bits 595,  Expect = 5e-39
 Identities = 89/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E TS IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 84. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 152.6 bits 595,  Expect = 5e-39
 Identities = 90/159 56%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E TS IP  RLFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K+VA+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E++L  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 85. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 152.6 bits 595,  Expect = 5e-39
 Identities = 90/159 56%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E TS IP  RLFK++VLD D LIPK+APQAI   E +EG+GGPGT K ITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K+VA+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 86. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 152.4 bits 594,  Expect = 5e-39
 Identities = 91/158 57%, Positives = 115/158 72%, Gaps = 1/158 0%
Query  2    GVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
            GV+ YE E TS IP  RLFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFGE
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
            GS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K+VA+ G GSI+K  S +
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 119
Query  122  HAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 87. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 152.4 bits 594,  Expect = 6e-39
 Identities = 89/159 55%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF YE E TSVIP ARL+ ++VLD D LIPK+APQA+ S E +EG+GG GTIK I FG
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS Y YVK ++D VD  NF Y Y+VIEGD + + +EK+ +E K+VA+ G GS++K  S 
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSISH 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E YLL H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 88. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 152.2 bits 593,  Expect = 7e-39
 Identities = 89/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E TS IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 89. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 152.2 bits 593,  Expect = 7e-39
 Identities = 90/159 56%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E TS IP  RLFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K+VA+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +   KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 90. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 151.7 bits 591,  Expect = 9e-39
 Identities = 89/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E TS IP  RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 91. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 151.7 bits 591,  Expect = 9e-39
 Identities = 85/160 53%, Positives = 122/160 76%, Gaps = 1/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF YE+E TS I  ARLFK++VLDGD L+PK+APQA+  VE +EGNGG GTIK ITFG
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVL-GDKLEKVCHELKIVAAPGGGSILKISS 119
            +G  +KYVK +++ +D  ++TYSY++IEGD L G++LEK+ HE K+VA+  GG+++K  S
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  120  KFHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            K+++ GD ++N E++K  ++ A ++L+ VE YL  H   YN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 92. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 151.4 bits 590,  Expect = 1e-38
 Identities = 89/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MG++ +E E TS IP  RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK RVD +D  +++Y+YT+IEGD L D +EK+ +E K+VA+ G GS +K  S 
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVAS-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 93. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 151.2 bits 589,  Expect = 1e-38
 Identities = 89/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E TS IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 94. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 150.9 bits 588,  Expect = 2e-38
 Identities = 88/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E TS IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  K  A  L++ +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 95. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 150.7 bits 587,  Expect = 2e-38
 Identities = 89/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV  +E E TS IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 96. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 150.7 bits 587,  Expect = 2e-38
 Identities = 88/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E TS IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK R+D +D  +++YSYT+IEGD L D +E + +E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 97. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 149.7 bits 583,  Expect = 4e-38
 Identities = 89/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV  +E E TS IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 98. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 149.2 bits 581,  Expect = 5e-38
 Identities = 87/159 54%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E TS IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G G+ +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGATIKSISH 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE    L++ +E+YL  H   YN
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 99. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 148.2 bits 577,  Expect = 1e-37
 Identities = 90/158 56%, Positives = 115/158 72%, Gaps = 1/158 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV  +E++ TSVIP ARLFK++VLD D LIPKV PQAI S+E +EGNGGPGTIK ITFG
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            E S++KY K R+D +D  N TYS++VIEGD L D +  V  E+K VA+P GGSI K ++K
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEY 159
            ++ KGD ++  E+I+   E    L +AVE YLLAH   Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 100. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 146.3 bits 569,  Expect = 4e-37
 Identities = 90/158 56%, Positives = 115/158 72%, Gaps = 1/158 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF +E++ TSVI  ARLFK+  LD D LI KV PQAI S E +EGNGGPGTIK ITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            E S++KY K R+D +D  N TYS++VIEGD L   +E V  E+K VA+P GGSI+K ++K
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEY 159
            ++ KGD ++  E+I+ A E A  LL+AVE YL+AH   Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 101. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 146.3 bits 569,  Expect = 4e-37
 Identities = 86/159 54%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+NYE++ TSVIP ARLFK++VLD D LI KV P+A+ S E +EGNGGPGTIK  TFG
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            E S+ KY K R+D +D  N +YS++VIEG+ L D +  +  E+K VA+P GGSI+K ++K
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            ++ KG  ++  E+I+ A E    L++AVE YLLAH   YN
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 102. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 141.7 bits 550,  Expect = 9e-36
 Identities = 82/155 52%, Positives = 115/155 74%, Gaps = 0/155 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV  Y+ E  S +P  +L+K+++LDGD L+PKV P+AI  V+ +EG+G  GTIK +TFG
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K VK+RVD +D  N+TYSYT+IEGDVL +K+E + + +KIVA P GGSI K  S 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAH 155
            +  KGD +++ EEIK  KE A ++++A+E YLLA+
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155

Sequence Alignment: 103. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 132.7 bits 513,  Expect = 4e-33
 Identities = 74/135 54%, Positives = 103/135 76%, Gaps = 1/135 0%
Query  11   TSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEGSRYKYVKE 70
            TSVIP  +LFK++VLD D LIPK+APQA+ SVE +EG+GG GT+K I +GEG+ + YVK 
Sbjct  2    TSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKH 61
Query  71   RVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHAKGDHEIN 130
            ++D +D  NF YSY++ EGD LGDK+EK+ +E+K+VA+ G GSI+K +S +H KG  EI 
Sbjct  62   KIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVAS-GRGSIIKTTSHYHCKGGAEIK 120
Query  131  AEEIKGAKEMAEKLLR 146
             E++K  KE A  L++
Sbjct  121  EEQVKDGKERAAGLFK 136

Sequence Alignment: 104. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 129.0 bits 498,  Expect = 6e-32
 Identities = 79/154 51%, Positives = 106/154 68%, Gaps = 1/154 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MG   Y+ E  S I A ++FK++VLDGD +IPK  P+AIT V+ +EG+GG GTIK  TFG
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K VK R+D +D  NFTYSY++IEG  L D +E + + +KIVA P GG I K  S 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAH 155
            +  K D +++ EEIK  KE A  +++ VE YLLA+
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLAN 154

Sequence Alignment: 105. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 124.6 bits 480,  Expect = 1e-30
 Identities = 77/158 48%, Positives = 104/158 65%, Gaps = 2/158 1%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF +E E  S +  A L+K+ V D D +IPK A  +  SVENVEGNGGPGTIK ITF 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            E    K+V  +++ +D  N+ YSY+V+ G  L D  EK+  + K+VA P GGS  K++ K
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +  KGD E N +E+K  K  A+ L++A+E YLLAH  +YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHP-DYN 158

Sequence Alignment: 106. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 121.1 bits 466,  Expect = 1e-29
 Identities = 70/159 44%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV  +  E+T+ I   RLFK  VLD D L+PK+  + + S+E VEG+GG G+IK + F 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG   KY+K ++  +D+ N+   Y++IEGDVLGDKLE + +++K  AA  GG + K +++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEY 159
            +H KGDH ++ EE    K  A  L++A+E YLLA+ + Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 107. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 118.0 bits 453,  Expect = 1e-28
 Identities = 67/155 43%, Positives = 100/155 64%, Gaps = 0/155 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF +E +TTS +  A L+K+   D D + PK  P +  SVE VEGNGGPGTIK I+F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            E    K+V  +++ +D  N+ YSY+++ G  L +  EK+  + K+   P GGS++K+S  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAH 155
            +H+KGD   N +E+K  K  ++ L++AVE YLLA+
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155

Sequence Alignment: 108. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 118.0 bits 453,  Expect = 1e-28
 Identities = 66/159 41%, Positives = 103/159 64%, Gaps = 0/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV  Y  E+T+ I   RLFK+ VLD D L+PK+  Q + + E +EG+GG G+IK + F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG   KY+K ++  +D+ N+   Y++IEGD+LG+KLE + +++K  A   GG + K +++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEY 159
            +H KGDH ++ EE    +E    + +AVE YLLA+ + Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 109. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 117.0 bits 449,  Expect = 2e-28
 Identities = 68/154 44%, Positives = 102/154 66%, Gaps = 1/154 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            M VF +E +TTS +  A L+K+ V D D ++PK A  +  SVE VEGNGGPGTIK I+F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            E    K+V  +++E+D  N+ YSY+++ G  L D  EK+  + K+   P GGS++K+S K
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAH 155
            +H+KGD   N +E+K  K  ++ L++ +E YLLA+
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154

Sequence Alignment: 110. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 117.0 bits 449,  Expect = 2e-28
 Identities = 69/157 43%, Positives = 101/157 64%, Gaps = 2/157 1%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF +E E TS +P A+L+ + + D D + PK+    + SVE VEGNGGPGTIK +T  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            E    K++  +V+ +D  N+ Y+Y+V+ G  L    EK+  E K+V  P GGSI K++ K
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEY 159
            +H KGD + + EE+K  K   E L+RA+E Y+LA+  +Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 111. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 116.3 bits 446,  Expect = 4e-28
 Identities = 66/154 42%, Positives = 99/154 64%, Gaps = 0/154 0%
Query  2    GVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
            GVF +E +TTS +  A L+K+   D D + PK  P +  SVE VEGNGGPGTIK I+F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
                K+V  +++ +D  N+ YSY+++ G  L +  EK+  + K+   P GGS++K+S  +
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  122  HAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAH 155
            H+KGD   N +E+K  K  ++ L++AVE YLLA+
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154

Sequence Alignment: 112. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 112.9 bits 432,  Expect = 4e-27
 Identities = 68/153 44%, Positives = 102/153 66%, Gaps = 2/153 1%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV  +E E+TS +P A+LFK+ V+DGD+L PK+ P AI S+E VEGNGGPGT+K +T  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            E  +  YV  ++D +D   +TY YT+  G  + + LEKV  + K+ AA GG  I K+S  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAADGGSKI-KVSVT 118
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAH 155
            FH KGD  +  E  +  K+ ++ +++A+E Y+L++
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 113. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 107.7 bits 411,  Expect = 1e-25
 Identities = 64/155 41%, Positives = 98/155 63%, Gaps = 0/155 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV   E   TS +PAA+LFK+  LD D L+P+V P AI   E +EG+GG GT+K +T+G
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            + S YK +K+++D +D   FT+SY++I+GD+L   ++ + + L  V    GG     ++ 
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAH 155
            F+ KGD  +  E IK A +    +++AVE YLLA+
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 114. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 107.6 bits 411,  Expect = 2e-25
 Identities = 60/142 42%, Positives = 93/142 65%, Gaps = 1/142 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV  Y  E+T+ I   RLFK+ VLD D L+PK+  Q + + E +EG+GG G+IK + F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG   KY+K ++  +D+ N+   Y++IEGD+LG+KLE + +++K  A   GG + K +++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  FHAKGDHEINAEEIK-GAKEMAE 142
            +H KGDH ++ EE   G +E  E
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHE 143

Sequence Alignment: 115. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 107.2 bits 409,  Expect = 2e-25
 Identities = 65/154 42%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            M VF ++ + TS +  A L+ +   D D +IPK A  +  SVE VEGNGGPGTIK I+F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            E    K+V  +++ VD  N+ YSY+++ G  L D  EK+  + KI     GGS++K++  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAH 155
            +H KGD   N +E+K  K  ++ L++AVE YLLA+
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLAN 154

Sequence Alignment: 116. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 106.3 bits 405,  Expect = 4e-25
 Identities = 60/149 40%, Positives = 95/149 63%, Gaps = 0/149 0%
Query  7    EAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEGSRYK 66
            E E TS +  + +FK++V+D D + PK  P+   S++ +EG+GG GTIK+IT+ +G  + 
Sbjct  5    EFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFT 64
Query  67   YVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHAKGD 126
              K +VD +D+ NF+ SYT+ EGDVL   +E   H LK + +  GGS+ K S  F  KGD
Sbjct  65   SSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGD 124
Query  127  HEINAEEIKGAKEMAEKLLRAVETYLLAH 155
             ++  E +   KE  +K ++A+ETY+++H
Sbjct  125  AKLTDENVSLMKEGLKKTFKAIETYVISH 153

Sequence Alignment: 117. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 103.6 bits 394,  Expect = 3e-24
 Identities = 63/154 40%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV     E  S + A ++++ ++LD D + PKV PQ I SVE +EG+GG GT+K + +G
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            E + Y  +K++VD +D   + Y+YT I GD+L D LE V +E+ +V    GG I+K ++ 
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEF-VVVPTDGGCIVKNTTI 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAH 155
            ++ KGD  +  ++IK A E +   ++AVE YLLA+
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 118. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 102.1 bits 388,  Expect = 7e-24
 Identities = 60/154 38%, Positives = 100/154 64%, Gaps = 1/154 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV   E E  S + A ++++ ++LD D + PKV PQ I SVE +EG+GG GT++ + +G
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            E + Y  +K++VD +D   + Y+YT I GD+L + LE V +++ +V    GG I+K ++ 
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQF-VVVPTDGGCIVKNTTI 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAH 155
            ++ KGD  +  +++K A E +   ++AVE YLLA+
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 119. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 101.9 bits 387,  Expect = 9e-24
 Identities = 62/154 40%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV  +  E TS + A ++F+ +V+D D ++PK AP A  SVE ++G+GGPGT+K IT+ 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            +G     +  R+D V+   +T+ Y+VI+GD+L   +E + + + +V    GGSI K ++ 
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAH 155
            FH KGD  +  E IK A E    L++A+E YL+A+
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 120. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 99.7 bits 378,  Expect = 4e-23
 Identities = 65/154 42%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MG  ++  E TS + A ++F   VLD D +IPK AP A  SV+ V+G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS    +  R D V+   +TY  TVI+GD+L   +E +   L +V    GGSI K ++ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAH 155
            FH KGD  +  E IK A E    L++A+E YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 98.9 bits 375,  Expect = 7e-23
 Identities = 65/154 42%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MG  ++  E TS + A ++F   VLD D +IPK AP A  SVE V+G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS    +  R D V+   +TY  TVI+GD+L   +E +   L +V    GGSI K ++ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAH 155
            FH KGD  +  E IK A      L++A+E YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 98.2 bits 372,  Expect = 1e-22
 Identities = 63/154 40%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MG  ++  E TS + A ++F   VLD D +IPK AP A  SV+ V+G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS    +  R D V+   +TY  TVI+GD+L + +E +   + +V    GGSI K ++ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAH 155
            FH KGD  +  E IK A      L++A+E YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 97.7 bits 370,  Expect = 2e-22
 Identities = 63/154 40%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MG  ++  E TS + A ++F   VLD D +IPK AP A  SV+ V+G+GG GT++ IT+ 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 73
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS    +  R D V+   +TY  TVI+GD+L + +E +   + +V    GGSI K ++ 
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAH 155
            FH KGD  +  E IK A      L++A+E YL+A+
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 124. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 95.0 bits 359,  Expect = 1e-21
 Identities = 62/154 40%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MG  ++  E TS + A ++F   VLD D +IPK A  A  SVE V+G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS    +  R D V+   ++Y  TVI+GD+L   +E +   + +V    GGSI K ++ 
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAH 155
            FH KGD  +  E IK A      L++A+E YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 70.4 bits 257,  Expect = 2e-14
 Identities = 48/89 53%, Positives = 63/89 70%, Gaps = 17/89 19%
Query  55   KNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSI 114
            K ITFGEGS+Y YVK                 +EGD L D LEK+ +E K+V+AP   +I
Sbjct  12   KKITFGEGSQYGYVK-----------------VEGDALSDTLEKIDYETKLVSAPSSSTI 54
Query  115  LKISSKFHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +K +SK+H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  55   IKTTSKYHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 57.7 bits 203,  Expect = 6e-11
 Identities = 32/50 64%, Positives = 37/50 74%, Gaps = 0/50 0%
Query  2    GVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGP 51
            GVF +E++ TSVI  ARLFK+  LD D LI KV PQAI S E +EGNGGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 48.4 bits 168,  Expect = 1e-07
 Identities = 44/146 30%, Positives = 71/146 48%, Gaps = 13/146 8%
Query  4    FNYEAETTSVIPA--ARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
            FN + E +  + A  A L K ++     ++PKV P+ +  V+ +EG+GG GTI    F  
Sbjct  5    FNTQTELSVRLEALWAVLSKDFIT----VVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
Query  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
                 Y +E + E D ++      VIEG  L   L      +K+       +++ +   +
Sbjct  61   EVSPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISY 120
Query  122  HAKGDHEINAEE-IKGAKEMAEKL--LRAVETYLLAHSA 157
                DH+ + EE +   K     L  LR +E YL   SA
Sbjct  121  ----DHDSDIEEKVTPTKTSQSTLMYLRRLERYLSNGSA 155

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 34.5 bits 106,  Expect = 0.0003
 Identities = 16/24 66%, Positives = 21/24 87%, Gaps = 0/24 0%
Query  2    GVFNYEAETTSVIPAARLFKSYVL 25
            GVF +E++ TSVIP ARLFK++VL
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.