The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP
EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK
YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA54482 Bet v 1.0102 160 1041 245.6 4.8e-67
CAA54485 Bet v 1.0105 160 1026 242.2 5.2e-66
CAB02155 Bet v 1.0108 160 1023 241.5 8.3e-66
CAA07323.1 Bet v 1.0117 160 1022 241.3 9.7e-66
CAA54489 Bet v 1.0107 160 1021 241.0 1.1e-65
CAB02157 Bet v 1.0110 160 1016 239.9 2.5e-65
CAB02158 Bet v 1.0111 160 1006 237.6 1.2e-64
CAB02160 Bet v 1.0113 160 1005 237.4 1.4e-64
CAB02156 Bet v 1.0109 160 1003 236.9 2e-64
CAA33887 Bet v 1.0101 160 1002 236.7 2.3e-64
CAB02159 Bet v 1.0112 160 995 235.1 7e-64
CAB02161 Bet v 1.0114 160 991 234.2 1.3e-63
CAA54484 Bet v 1.0104 160 987 233.3 2.5e-63
CAA54487 Bet v 1.0106 160 981 231.9 6.4e-63
CAA04827.1 Bet v 1.0116 159 968 228.9 5e-62
CAA96547 Bet v 1.0115 160 968 228.9 5.1e-62
CAA54483 Bet v 1.0103 160 964 228.0 9.5e-62
CAA07329.1 Bet v 1.0118 160 963 227.8 1.1e-61
ABC41615.1 Bet v 1.0119 150 956 226.2 3.1e-61
P43186 Bet v 1.0204 160 916 217.0 1.9e-58
CAA04828.1 Bet v 1.0206 159 911 215.9 4.2e-58
Q39427 Bet v 1.0205 160 907 215.0 8e-58
CAA54421 Bet v 1.0201 160 905 214.5 1.1e-57
P43184 Bet v 1.0203 160 903 214.1 1.5e-57
CAA54481 Bet v 1.0202 160 894 212.0 6.3e-57
CAA96548 Cor a 1.0201 160 872 207.0 2e-55
AAB24432 Aln g 1 160 854 202.9 3.5e-54
P38948 Aln g 1 159 847 201.3 1.1e-53
ACF75030.1 Bet v 1.0207 150 842 200.2 2.2e-53
CAB02217 Car b 1.0302 161 832 197.8 1.2e-52
CAB02216 Car b 1.0301 161 807 192.1 6.1e-51
CAB02207 Car b 1.0104 160 799 190.3 2.2e-50
P38950 Car b 1 159 798 190.1 2.5e-50
CAB02206 Car b 1.0103 160 798 190.1 2.5e-50
ABZ81040 Car b 1.0109 160 792 188.7 6.5e-50
ABZ81041 Car b 1.0110 160 789 188.0 1e-49
ABZ81043 Car b 1.0112 160 788 187.8 1.2e-49
ABZ81042 Car b 1.0111 160 788 187.8 1.2e-49
ADK39021 Ost c 1.0101 160 787 187.6 1.4e-49
CAB02208 Car b 1.0105 160 786 187.3 1.7e-49
ABZ81044 Car b 1.0113 160 785 187.1 2e-49
CAA50328 Cor a 1.0102 160 781 186.2 3.7e-49
CAA50325 Cor a 1.0103 160 778 185.5 6e-49
CAA47357 Car b 1.0102 159 777 185.3 7e-49
CAB02209 Car b 1.0106 160 776 185.0 8.2e-49
P38949 Car b 1 159 775 184.8 9.6e-49
CAA50327 Cor a 1.0101 160 774 184.6 1.1e-48
Q08407 Cor a 1 159 767 183.0 3.4e-48
CAA54696.1 Bet v 1.0301 160 765 182.5 4.7e-48
CAB02213 Car b 1.0107 160 764 182.3 5.5e-48
CAA50326 Cor a 1.0104 160 757 180.7 1.7e-47
CAB02215 Car b 1.0108 160 754 180.0 2.7e-47
CAA96549 Cor a 1.0301 160 731 174.8 1e-45
AAD48405 Cor a 1.0401 161 716 171.3 1.1e-44
AAG40331 Cor a 1.0404 161 713 170.6 1.8e-44
AAG40329 Cor a 1.0402 161 710 170.0 2.9e-44
AAG40330 Cor a 1.0403 161 707 169.3 4.6e-44
CAD10374 Cas s 1 160 706 169.0 5.4e-44
APD76154 Jug r 5.0101 160 687 164.7 1.1e-42
CAA96535 Mal d 1.0401 160 680 163.1 3.3e-42
ACJ23864 Fag s 1.0101 160 678 162.6 4.6e-42
CAA96536 Mal d 1.0402 160 667 160.1 2.6e-41
CAA96537 Mal d 1.0403 160 663 159.2 4.9e-41
O24248 Pru av 1 160 646 155.3 7.3e-40
CAA96534 Mal d 1.0301 159 634 152.6 4.8e-39
Q2I6V8 Pru p 1.0101 160 631 151.9 7.8e-39
O50001 Pru ar 1 160 622 149.8 3.3e-38
AAO25113 Mal d 1.0304 159 621 149.6 3.8e-38
AAK13027 Mal d 1.0302 159 620 149.4 4.4e-38
ABZ81046 Que a 1.0301 160 615 148.2 9.9e-38
AAK13028 Mal d 1.0303 159 614 148.0 1.1e-37
B6CQS9 Pru du 1.0101 160 601 145.0 9.1e-37
AAD26546 Mal d 1.0103 159 600 144.8 1.1e-36
AUH28179 Que m 1.0101 160 599 144.6 1.2e-36
AAD29671 Mal d 1.0108 159 598 144.4 1.4e-36
QOL10866 Que ac 1.0101 159 598 144.4 1.4e-36
CAA88833 Mal d 1.0102 159 597 144.1 1.7e-36
AAD26552 Mal d 1.0104 159 596 143.9 2e-36
AAD26555 Mal d 1.0107 159 593 143.2 3.2e-36
CAA58646 Mal d 1.0101 159 593 143.2 3.2e-36
AAD26553 Mal d 1.0105 159 592 143.0 3.7e-36
AAD26554 Mal d 1.0106 159 592 143.0 3.7e-36
AAD26545 Mal d 1.0202 159 589 142.3 6e-36
AAB01362 Mal d 1.0201 159 589 142.3 6e-36
O65200 Pyr c 1 159 588 142.1 7.1e-36
QGS84240 Que i 1.0101 159 588 142.1 7.1e-36
AAK13029 Mal d 1.0109 159 587 141.8 8.3e-36
Q256S7 Fra a 1 160 586 141.6 9.8e-36
Q3T923 Fra a 1 160 586 141.6 9.8e-36
AAD26548 Mal d 1.0204 159 585 141.4 1.1e-35
AFN42528 Can s 5.0101 161 585 141.4 1.2e-35
AAD13683 Mal d 1.0206 159 584 141.2 1.3e-35
AAD26547 Mal d 1.0203 159 583 140.9 1.6e-35
AAK13030 Mal d 1.0207 159 583 140.9 1.6e-35
AAD26558 Mal d 1.0205 159 581 140.5 2.1e-35
Q256S2 Fra a 1 160 580 140.2 2.5e-35
Q256S6 Fra a 1 160 577 139.6 4.1e-35
CAD32318 Mal d 1.0208 158 576 139.3 4.7e-35
ABZ81045 Que a 1.0201 159 575 139.1 5.5e-35
ABZ81047 Que a 1.0401 160 574 138.9 6.5e-35
Q256S4 Fra a 1 159 565 136.8 2.7e-34
CAM31909 Act d 8.0101 157 510 124.2 1.6e-30
CAM31908 Act c 8.0101 159 501 122.2 6.8e-30
Q0Z8U9 Rub i 1.0101 137 491 120.0 2.8e-29
AHC08073 Sola l 4.0101 160 485 118.5 8.7e-29
CAA42646 Gly m 4 158 477 116.7 3e-28
NP_001275580 Sola l 4.0201 160 475 116.2 4.2e-28
AAQ91847 Ara h 8.0101 157 454 111.4 1.2e-26
CAA43636 Pha v 1 155 452 111.0 1.6e-26
CAA43637 Pha v 1 156 442 108.7 7.7e-26
CAA75803 Lyc e 4.0101 178 439 108.0 1.5e-25
P25985 Pha v 1 155 435 107.1 2.3e-25
Q2VU97 Vig r 1.0101 155 413 102.1 7.5e-24
CAA67246 Pet c PR10 155 411 101.6 1e-23
EF436550 Ara h 8.0201 153 410 101.4 1.2e-23
P49372 Api g 1 154 406 100.5 2.3e-23
P92918 Api g 1.0201 159 394 97.7 1.6e-22
AAL76932 Dau c 1.0201 154 388 96.4 3.9e-22
AAB92255 Tar o RAP 157 380 94.5 1.4e-21
CAB03716 Dau c 1.0104 154 372 92.7 4.9e-21
CAB06416 Dau c 1.0105 154 369 92.0 8e-21
BAA13604 Dau c 1.0102 154 368 91.8 9.3e-21
AAB01092 Dau c 1.0101 168 366 91.3 1.4e-20
CAB03715 Dau c 1.0103 154 359 89.7 3.9e-20
Q5ULZ4 Fra a 1.0101 100 239 62.5 4.1e-12
P85126 Que a 1.0101 50 214 57.0 8.8e-11
Q9ZWP8 Vig r 6.0101 155 200 53.4 3.4e-09
Q9S8Q4 Cas s 1 24 109 33.3 0.00059
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 245.6 bits 1041,  Expect = 5e-67
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 2. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 242.2 bits 1026,  Expect = 5e-66
 Identities = 157/160 98%, Positives = 159/160 99%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ETTSVIPAARLFKAFIL+GDNL+PKVAPQAISSVENIEGNGGPGTIKKINFP
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 3. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 241.5 bits 1023,  Expect = 8e-66
 Identities = 157/160 98%, Positives = 158/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 4. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 241.3 bits 1022,  Expect = 1e-65
 Identities = 156/160 97%, Positives = 158/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGP+GDTLEKISNEIKIVATPDGGCVLKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 5. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 241.0 bits 1021,  Expect = 1e-65
 Identities = 156/160 97%, Positives = 157/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE E TSVIPAAR+FKAFILDGD LVPKVAPQAISSVENIEGNGGPGTIKKINFP
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 6. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 239.9 bits 1016,  Expect = 3e-65
 Identities = 155/160 96%, Positives = 157/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGP+GD LEKISNEIKIVATPDGGCVLKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 7. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 237.6 bits 1006,  Expect = 1e-64
 Identities = 154/160 96%, Positives = 157/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
             G+PFKYVKDRVDEVDHTNFKYNYSVIEGGP+GDTLEKISNEIKIVATPDGGCVLKISNK
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 8. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 237.4 bits 1005,  Expect = 1e-64
 Identities = 154/160 96%, Positives = 158/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGP+GDTLEKISNEIKIVATPDGG +LKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 9. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 236.9 bits 1003,  Expect = 2e-64
 Identities = 154/160 96%, Positives = 157/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGG +LKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 10. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 236.7 bits 1002,  Expect = 2e-64
 Identities = 153/160 95%, Positives = 157/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGP+GDTLEKISNEIKIVATPDGG +LKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 11. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 235.1 bits 995,  Expect = 7e-64
 Identities = 152/160 95%, Positives = 157/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG+PFKYVKDRVDEVDHTNFKYNYSVIEGGP+GDTLEKISNEIKIVATPDGG +LKISNK
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 12. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 234.2 bits 991,  Expect = 1e-63
 Identities = 152/160 95%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGP+GDTLEKISNEIKIVATPDGG +LKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQVKASKEM ETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 13. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 233.3 bits 987,  Expect = 2e-63
 Identities = 150/160 93%, Positives = 157/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYEIE TSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKY+YSVIEGGPVGDTLEKISNEIKIVATP+GG +LKI+NK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 14. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 231.9 bits 981,  Expect = 6e-63
 Identities = 149/160 93%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE E TSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKY+YSVIEGGPVGDTLEKISNEIKIVATP+GG +LKI+NK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 15. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 228.9 bits 968,  Expect = 5e-62
 Identities = 148/159 93%, Positives = 153/159 96%, Gaps = 0/159 0%
Query  2    GVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFPE 61
            GVFNYE E TSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKI+FPE
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKY 121
            G PFKYVKDRVDEVDH NFKY+YS+IEGGPVGDTLEKISNEIKIVATPDGG +LKISNKY
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            HTKG+HEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 16. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 228.9 bits 968,  Expect = 5e-62
 Identities = 148/160 92%, Positives = 154/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEV H NFKY+YSVIEGGP+GDTLEKISNEIKIVATPDG  +LKISNK
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 17. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 228.0 bits 964,  Expect = 1e-61
 Identities = 147/160 91%, Positives = 154/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE E TSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG PFKYVK RVDEVDHTNFKY+YSVIEGGPVGDTLEKISNEIKIVATP+GG +LKI+NK
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 18. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 227.8 bits 963,  Expect = 1e-61
 Identities = 145/160 90%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ETTSVIPAARLFKAFILDGDNL+PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGP+GDTLEKISNEIK+VATPDGG +L+ISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 19. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 226.2 bits 956,  Expect = 3e-61
 Identities = 146/150 97%, Positives = 148/150 98%, Gaps = 0/150 0%
Query  4    FNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFPEGF 63
            FNYE ETTSVIPAARLFKAFILDGDNL PKVAPQAISSV+NIEGNGGPGTIKKINFPEGF
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKYHT 123
            PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGC+LKISNKYHT
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  124  KGNHEVKAEQVKASKEMGETLLRAVESYLL 153
            KGNHEVKAEQVKASKEMGETLLRAVESYLL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 20. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 217.0 bits 916,  Expect = 2e-58
 Identities = 140/160 87%, Positives = 150/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ETTSVIPAARLFKAFILDGDNL+PKVAPQAISSVENIEGNGGPGTIKKI FP
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIKIVATPDGG +LKISNK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 21. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 215.9 bits 911,  Expect = 4e-58
 Identities = 139/159 87%, Positives = 150/159 94%, Gaps = 0/159 0%
Query  2    GVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFPE 61
            GVFNYE ETTSVIPAARLFKAFILDGDNL+PKVAPQAISSVENIEGNGGPGTIKKI FPE
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKY 121
            G PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIK+VATPDGG +LKISNKY
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            HTKG+HE+KAE++KA KE GETLLRAVESYLLAHSDAYN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 22. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 215.0 bits 907,  Expect = 8e-58
 Identities = 138/160 86%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ETTSVIPAARLFKAFILDGDNL+PKVAPQAISSVENIEGNGGPGTIKKI FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIK+VATPDGG +LKISNK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HE+KAE++KA KE  E LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 23. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 214.5 bits 905,  Expect = 1e-57
 Identities = 138/160 86%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ETTSVIPAARLFKAFIL+GD L+PKVAPQAISSVENIEGNGGPGTIKKI FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIKIVATPDGG +LKISNK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 24. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 214.1 bits 903,  Expect = 2e-57
 Identities = 138/160 86%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ETTSVIPAARLFKAFIL+GD L+PKVAPQAISSVENIEGNGGPGTIKKI FP
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIKIVATPDGG +LKISNK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 25. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 212.0 bits 894,  Expect = 6e-57
 Identities = 137/160 85%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ETTSVIPAARLFKAFIL+GD L+PKVAPQAISSVENIEGNGGPGTIKKI FP
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIKIVATPDGG +LKISNK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG++E+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 26. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 207.0 bits 872,  Expect = 2e-55
 Identities = 130/160 81%, Positives = 146/160 91%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE E+TSVIPAARLFKAFILDG+NL+PKVAPQA+SSVEN+EGNGGPGTIKKI F 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG PFKYVK+RV+EVDHTNFKY+Y+VIEGGPVGD +EKI NEIKIVA PDGG +LKISNK
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEV AE++K  KE  E L+RAVE+YLLAHSDAYN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 27. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 202.9 bits 854,  Expect = 4e-54
 Identities = 128/160 80%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ET SVIPAARLFKAFILDGD L+PKVAP+A+SSVENIEGNGGPGTIKKI FP
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG PFKYVK+RVDEVD  NFKY++SVIEGG VGD LEK+ NEIKIVA PDGG +LKISNK
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +HTKG+HE+ AEQ+K  KE    LL+AVESYLLAHSDAYN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 28. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 201.3 bits 847,  Expect = 1e-53
 Identities = 127/159 79%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  2    GVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFPE 61
            GVFNYE ET SVIPAARLFKAFILDGD L+PKVAP+A+SSVENIEGNGGPGTIKKI FPE
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKY 121
            G PFKYVK+RVDEVD  NFKY++SVIEGG VGD LEK+ NEIKIVA PDGG +LKISNK+
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            HTKG+HE+ AEQ+K  KE    LL+AVESYLLAHSDAYN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 29. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 200.2 bits 842,  Expect = 2e-53
 Identities = 129/150 86%, Positives = 140/150 93%, Gaps = 0/150 0%
Query  4    FNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFPEGF 63
            FNYE ETTSVIPAARLFKAFIL+GDNL+PKVAPQAISSVENIEGNGGPGTIKKI FPEG 
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKYHT 123
            PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIKIVATPDGG +LKISNKYHT
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  124  KGNHEVKAEQVKASKEMGETLLRAVESYLL 153
            KG+HE+KAE++KA KE GE LLRAVESYLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 30. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 197.8 bits 832,  Expect = 1e-52
 Identities = 124/160 77%, Positives = 142/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ETTSVIPAARLFKAFILDG+NL+PKVAPQA+SSVEN+EGNGGPGTIKKI F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG P KYVK+RV+EVDHTNFKY+Y+VIEGGPVGD +EKI NEIKIVA PDGG +LKI++K
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEV AE++K  KE  E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 31. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 192.1 bits 807,  Expect = 6e-51
 Identities = 121/160 75%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ETTSVIPAARLFKAFILDG+ L+PKV+PQA+SSVEN+EGNGGPGTIKKI F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG P KYVK+RV+EVDHTNFKY+Y+VIEGG VGD +EKI NEIKIVA PDGG +LKI++K
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEV AE++K  KE  E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 32. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 190.3 bits 799,  Expect = 2e-50
 Identities = 117/160 73%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L+PKVAPQAISSVEN+ GNGGPGTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 33. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 190.1 bits 798,  Expect = 3e-50
 Identities = 118/159 74%, Positives = 139/159 87%, Gaps = 0/159 0%
Query  2    GVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFPE 61
            GVFNYE ETTSVIPAARLFKAFILDG+ L+PKV+PQA+SSVEN+EGNGGPGTIKKI F E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKY 121
            G P KYVK+RV+E+DHTNFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K+
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            H KG HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 34. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 190.1 bits 798,  Expect = 3e-50
 Identities = 117/160 73%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L+PKVAPQAISSVEN+ GNGGPGTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 35. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 188.7 bits 792,  Expect = 7e-50
 Identities = 117/160 73%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L+PKVAPQAISSVEN+ GNGGPGTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG +LKIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 36. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 188.0 bits 789,  Expect = 1e-49
 Identities = 117/160 73%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L+PKVAPQAISSVEN+ GNGGPGTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG V+KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 37. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 187.8 bits 788,  Expect = 1e-49
 Identities = 116/160 72%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L+PKVAPQAISSVEN+ GNGGPGTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 38. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 187.8 bits 788,  Expect = 1e-49
 Identities = 116/160 72%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L+PKVAPQAISSVEN+ GNGGPGTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 39. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 187.6 bits 787,  Expect = 1e-49
 Identities = 116/160 72%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L+PKVAPQAIS VEN+ GNGGPGTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG +LKIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 40. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 187.3 bits 786,  Expect = 2e-49
 Identities = 116/160 72%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ET SVIPAARLFK+++LD D L+PKVAPQAISSVEN+ GNGGPGTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 41. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 187.1 bits 785,  Expect = 2e-49
 Identities = 115/160 71%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L+PKVAPQAISSVEN+ GNGGPGTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG PFK+VK+RVDEVD+ NFKY+Y+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 42. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 186.2 bits 781,  Expect = 4e-49
 Identities = 114/160 71%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE+ET SVIPAARLFK+++LDGD L+PKVAPQAI+SVEN+EGNGGPGTIK I F 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  +KYVK+RVDEVD+TNFKY+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 43. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 185.5 bits 778,  Expect = 6e-49
 Identities = 114/160 71%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ETTSVIPAARLFK+++LDGD L+PKVAPQAI+SVEN+EGNGGPGTIK I F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 44. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 185.3 bits 777,  Expect = 7e-49
 Identities = 115/159 72%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  2    GVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFPE 61
            GVFNYE ET SVIPAARLFK+++LDGD L+PKVAPQAISSVEN+ GNGGPGTIK I F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKY 121
            G PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K+
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            H KG HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 45. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 185.0 bits 776,  Expect = 8e-49
 Identities = 115/160 71%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ET SVIPAARLFK+++LD D L+PKVAPQAISSVEN+ GNGGPGTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 46. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 184.8 bits 775,  Expect = 1e-48
 Identities = 114/159 71%, Positives = 135/159 84%, Gaps = 0/159 0%
Query  2    GVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFPE 61
            GVFNYE ET SVIPAARLFK+++LDGD L+PKVAPQ ISSVEN+ GNGGPGTIK I F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKY 121
            G PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ++KIS+K+
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            H KG HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 47. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 184.6 bits 774,  Expect = 1e-48
 Identities = 113/160 70%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE+ET SVIPAARLFK+++LDGD L+PKVAPQAI+SVEN+EGNGGPGTIK I F 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 48. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 183.0 bits 767,  Expect = 3e-48
 Identities = 112/159 70%, Positives = 137/159 86%, Gaps = 0/159 0%
Query  2    GVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFPE 61
            GVFNYE+ET SVIPAARLFK+++LDGD L+PKVAPQAI+SVEN+EGNGGPGTIK I F E
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKY 121
            G  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K+
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 49. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 182.5 bits 765,  Expect = 5e-48
 Identities = 113/160 70%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE E TSVI  ARLFK+F+LD DNL+PKVAP+ +SS ENIEGNGGPGTIKKI FP
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  FKY+K RVDE+DH NFKY YS+IEGGP+GDTLEKIS EIKIVA P GG +LKI++K
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+  +  E++KA KE G  L++AVE+YL+AH +AYN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 50. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 182.3 bits 764,  Expect = 6e-48
 Identities = 114/160 71%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ET SVIPAARLFK+++LD D L+PKVAPQAISSVEN+ GNGGPGTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG PFK+VK+RVDEVD+ NFK++Y+VIEG  +GD LEK+S E+KIVA P GG +LKIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 51. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 180.7 bits 757,  Expect = 2e-47
 Identities = 112/160 70%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE+ET SVI AARLFK+++LDGD L+PKVAPQAI+SVEN+ GNGGPGTIK I F 
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  +KYVK+RVDEVD+TNFKY+Y+VIEG  +GD LEK+ +E+KIVA P GG  LKIS+K
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 52. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 180.0 bits 754,  Expect = 3e-47
 Identities = 112/160 70%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ET SV+PAARLFK+++LD D L+PKVAPQAISSVEN+ GNGGPGTIK I F 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG PFK+VK+RVDEVD+ NFK++Y+VIEG  +GD LEK+S E+ IVA P GG +LKIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 53. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 174.8 bits 731,  Expect = 1e-45
 Identities = 110/160 68%, Positives = 129/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ETTSVIP ARLFK F+LD DNL+PKVAP+AI S+E IEGNGGPGTIKKI F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG PF Y+K +V+E+D+ NF Y YSVIEG  + D LEKI+ EIKIVA+P GG +LK  +K
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHT G+HE+K EQ+KA KE    L++AVE YLLAHSDAYN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 54. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 171.3 bits 716,  Expect = 1e-44
 Identities = 107/159 67%, Positives = 128/159 80%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVF YE E TSVIP ARLFK+F+LD DNL+PKVAPQ  +S EN+EGNGGPGTIKKI F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGG-CVLKISN 119
            EG  FKY+K +V+E+DH NFKY YS+IEGGP+G TLEKIS EIK+ A P GG  +LKI++
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159
            KYHTKGN  +  E++KA KE    L++AVE+YLLAH DAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 55. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 170.6 bits 713,  Expect = 2e-44
 Identities = 106/159 66%, Positives = 128/159 80%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVF+YE E TSVIP ARLFK+F+LD DNL+PKVAPQ  +S EN+EGNGGPGTIKKI F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGG-CVLKISN 119
            EG  FKY+K +V+E+DH NFKY YS+IEGGP+G TLEKI  EIK+ A P GG  +LKI++
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159
            KYHTKGN  +  E++KA KE    L++AVE+YLLAH DAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 56. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 170.0 bits 710,  Expect = 3e-44
 Identities = 105/159 66%, Positives = 127/159 79%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVF+YE E TSVIP ARLFK+F+LD DNL+PKVAPQ  +  EN+EGNGGPGTIKKI F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGG-CVLKISN 119
            EG  FKY+K +V+E+DH NFKY YS+IEGGP+G TLEKIS EIK+ A P GG  +LKI++
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159
            KYHTKGN  +  E++KA KE    L++AVE+YLLAH D Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 57. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 169.3 bits 707,  Expect = 5e-44
 Identities = 105/159 66%, Positives = 126/159 79%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVF YE E TSVIP ARLFK+F+LD DNL+PKVAPQ  +  EN+EGNGGPGTIKKI F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGG-CVLKISN 119
            EG  FKY+K +V+E+DH NFKY YS+IEGGP+G TLEKIS EIK+ A P GG  +LKI++
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159
            KYHTKGN  +  E++KA KE    L++AVE+YLLAH D Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 58. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 169.0 bits 706,  Expect = 5e-44
 Identities = 108/160 67%, Positives = 127/160 79%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVF +E E TS IP  RLFKAF+LD DNL+PK+AP+AI S E IEGNGGPGTIKKI F 
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  FKYVK R+DE+D+ NF Y YSVIEG  V + LEKIS EIKIVA+PDGG +LK ++K
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG +E+K E+V A KE    L++AVE+YLLAHSDAYN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 59. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 164.7 bits 687,  Expect = 1e-42
 Identities = 104/160 65%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVF YE E+TSVIP ARLFKAF+LD DNL+PKV PQA+ S E IEGNGGPGTIKKINF 
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  +KYVK R D +D  NF Y YSVIEG  + D +EKIS E KIVA+ +GG +LK  + 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YH+KG+HE+K E VK  KE    L++AVE YLLAH DAYN
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 60. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 163.1 bits 680,  Expect = 3e-42
 Identities = 101/160 63%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE ETTSVIPA RLFKAFILDGDNL+PK+APQAI S E IEG+GG GTIKK+ F 
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK RV+ +D  NF Y+YS+IEG  + D LEKI+ E K++A+PDGG ++K ++ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YH KG+ E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 61. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 162.6 bits 678,  Expect = 5e-42
 Identities = 101/160 63%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVF YE ETT+VI  ARLFKAF+LD DNL+PKVAPQAI S E IEG+GGPGTIKKI F 
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  F YVK R+DE+D+ NF Y  ++IEG  + +TLEKI+ EIK+VA+PDGG +LK ++K
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HE+K +Q+KA KE    +++AVE+YLLA+  AY+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 62. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 160.1 bits 667,  Expect = 3e-41
 Identities = 99/160 61%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE E TSVIPA RLFKAFILDGDNL+PK+APQAI S + IEG+GG GTIKK+ F 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK RV+ +D  NF Y+YS+IEG  + D LEKI+ E K++A+PDGG ++K ++ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YH KG+ E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 63. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 159.2 bits 663,  Expect = 5e-41
 Identities = 99/160 61%, Positives = 124/160 77%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE E TSVIPA RLFKAFILDGDNL+PK+APQAI S E IEG+GG GTIKK+ F 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK RV+ +D  NF Y+YS+IEG  + D LEKI+ E K++A+PDGG ++K ++ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            Y  KG+ E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 64. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 155.3 bits 646,  Expect = 7e-40
 Identities = 95/160 59%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVF YE E TS IP  RLFKAF+LD DNLVPK+APQAI   E +EG+GGPGTIKKI F 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++D +D  N+ Y+Y++IEG  +GDTLEKIS E K+VA+P GG ++K ++ 
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGN E+K E+VKA KE    L++ +E+YL  H DAYN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 65. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 152.6 bits 634,  Expect = 5e-39
 Identities = 98/159 61%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVFNYE E TSVIP ARLF AF+LD DNL+PK+APQA+ S E +EG+GG GTIKKINF 
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA+   G V+K ++ 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTK + E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 66. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 151.9 bits 631,  Expect = 8e-39
 Identities = 93/160 58%, Positives = 118/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVF YE E TS IP  RLFKAF+LD DNLVPK+APQAI   E +EG+GGPGTIKKI F 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++D +D  N  Y+Y++IEG  +GD LEKIS E K+VA+P GG ++K ++ 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +E+YL  H DAYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 67. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 149.8 bits 622,  Expect = 3e-38
 Identities = 92/160 57%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVF YE E TSVIP  +LFKAFILD DNL+PKVAP A+   E +EG+GG GTIKK+ F 
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK RVD +D  N+ Y+Y++IEG  + D +E I+ +IK+VA+PDGG ++K ++ 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K EQVKA KE    L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 68. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 149.6 bits 621,  Expect = 4e-38
 Identities = 96/159 60%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVF YE E TSVIP ARLF AF+LD DNL+PK+APQA+ S E +EG+GG GTIKKINF 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA+   G V+K ++ 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 69. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 149.4 bits 620,  Expect = 4e-38
 Identities = 96/159 60%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVF YE E TSVIP ARLF AF+LD DNL+PK+APQA+ S E +EG+GG GTIKKINF 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA    G V+K ++ 
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 70. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 148.2 bits 615,  Expect = 1e-37
 Identities = 91/159 57%, Positives = 118/159 74%, Gaps = 0/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVF YE E  SVIP ARLFKAF+LD DNL+PKV PQA+ S E IEGNGGPGTIKKI F 
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  +K+ K R+D +D  NF Y++SVIEG  + D LE +S E KIVA+PDGG ++K ++K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159
            Y+TKG+ ++  E ++  KE    +++AVE+YL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 71. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 148.0 bits 614,  Expect = 1e-37
 Identities = 94/159 59%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVF YE E TSVIP ARL+ AF+LD DNL+PK+APQA+ S E +EG+GG GTIKKINF 
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++D VD  NF Y YSVIEG  + +T+EKIS E K+VA+  G  +  IS+ 
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVASGSGSVIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 72. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 145.0 bits 601,  Expect = 9e-37
 Identities = 88/160 55%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MG+F Y  E+TSVIP  RLFKA++L+ D L+PK+APQ++ S E +EG+GG GTIKKI+F 
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++D +D  NF YNYS++EG  + D +EKIS EIK+VA+ DGG V+K ++ 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E VKA KE    L++ +E+YL+A+ DAYN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 73. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 144.8 bits 600,  Expect = 1e-36
 Identities = 91/159 57%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNL+PK+APQAI   E +EGNGGPGTIKKI F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGN E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 74. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 144.6 bits 599,  Expect = 1e-36
 Identities = 89/159 55%, Positives = 116/159 72%, Gaps = 0/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV  YE E  SVIP ARLFKAF+LD DNL+PKV PQA+ S E IEGNGGPGTIKKI F 
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  +K+ K R+D +D  NF +++SVIEG  + D LE +S E KIVA+PDGG ++K + K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159
            Y+TKG+ ++  E ++  KE    +++AVE+YL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 75. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 144.4 bits 598,  Expect = 1e-36
 Identities = 91/159 57%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNL+PK+APQAI   E +EGNGGPGTIKKI F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGN E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 76. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 144.4 bits 598,  Expect = 1e-36
 Identities = 91/159 57%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV+NYE + TSVIP ARLFKAF+LD DNL+ KV P+A+ S E IEGNGGPGTIKK  F 
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            E    KY K R+D +D  N  Y++SVIEG  + D +  IS E+K VA+PDGG ++K + K
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            Y+TKG  ++K EQ++A+ E G  L++AVE+YLLAH D YN
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 77. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 144.1 bits 597,  Expect = 2e-36
 Identities = 90/159 56%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNL+PK+APQAI   E +EGNGGPGTIKKI F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YH KGN E+K E+VK  KE G  L++ +ESYL  H DAYN
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 78. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 143.9 bits 596,  Expect = 2e-36
 Identities = 91/159 57%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL+PK+APQAI   E +EGNGGPGTIKKI F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGN E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 79. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 143.2 bits 593,  Expect = 3e-36
 Identities = 90/159 56%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNL+PK+APQAI   E +EGNGGPGTIKKI F 
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGN E+K E+VKA K     L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 80. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 143.2 bits 593,  Expect = 3e-36
 Identities = 90/159 56%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNL+PK+APQAI   E +EGNGGPGTIKKI F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGN E+K E+VK  KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 81. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 143.0 bits 592,  Expect = 4e-36
 Identities = 91/159 57%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV  +E E TS IP +RLFKAF+LD DNL+PK+APQAI   E +EGNGGPGTIKKI F 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGN E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 82. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 143.0 bits 592,  Expect = 4e-36
 Identities = 90/159 56%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNL+PK+APQAI   E +EGNGGPGTIKKI F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+E IS E K+VA   G  +  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGN E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 83. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 142.3 bits 589,  Expect = 6e-36
 Identities = 89/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL+PK+APQAI   E +EG+GGPGTIKKI F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E K+VA+  G  +  IS+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 84. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 142.3 bits 589,  Expect = 6e-36
 Identities = 89/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL+PK+APQAI   E +EG+GGPGTIKKI F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E K+VA+  G  +  IS+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 85. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 142.1 bits 588,  Expect = 7e-36
 Identities = 90/159 56%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MG++ +E E TS IP  RLFKAF+LD DNL+PK+APQAI   E +EGNGGPGTIKKI F 
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK RVD +D  ++ Y Y++IEG  + DT+EKIS E K+VA+  G  +  IS+ 
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVASGSGSTIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 86. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 142.1 bits 588,  Expect = 7e-36
 Identities = 92/158 58%, Positives = 116/158 73%, Gaps = 1/158 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV  +E + TSVIP ARLFKAF+LD DNL+PKV PQAI S+E IEGNGGPGTIKKI F 
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            E   FKY K R+D +D  N  Y++SVIEG  + D +  +S EIK VA+PDGG + K + K
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159
            Y+TKG+ ++K EQ++A+ E    L +AVE+YLLAH D Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 87. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 141.8 bits 587,  Expect = 8e-36
 Identities = 90/159 56%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV  +E E TS IP +RLFKAF+LD DNL+PK+APQAI   E +EGNGGPGTIKKI F 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGN E+K E+VK  KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 88. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 141.6 bits 586,  Expect = 1e-35
 Identities = 86/160 53%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV+ YE E TS IPA +LFKAF+LD DNL+PK+APQAI   E +EG+GGPGTIKKI F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P GG ++K ++K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 89. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 141.6 bits 586,  Expect = 1e-35
 Identities = 86/160 53%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV+ YE E TS IPA +LFKAF+LD DNL+PK+APQA+   E +EG+GGPGTIKKI F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P GG V+K ++K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 90. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 141.4 bits 585,  Expect = 1e-35
 Identities = 88/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL+PK+APQAI   E +EG+GGPGTIKKI F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E K++A+  G  +  IS+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMASGSGSIIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 91. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 141.4 bits 585,  Expect = 1e-35
 Identities = 88/160 55%, Positives = 120/160 75%, Gaps = 1/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVF YE E TS I  ARLFKAF+LDGDNLVPK+APQA+  VE +EGNGG GTIKKI F 
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPV-GDTLEKISNEIKIVATPDGGCVLKISN 119
            +G PFKYVK +++ +D  ++ Y+YS+IEG  + G+ LEKI++E K+VA+ DGG V+K  +
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  120  KYHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            KY++ G+ +V  E+VK  ++    +L+ VE+YL  H +AYN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 92. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 141.2 bits 584,  Expect = 1e-35
 Identities = 88/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV+ +E E TS IP  RLFK F+LD DNL+PK+APQAI   E +EG+GGPGTIKKI F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E K+VA+  G  +  IS+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 93. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 140.9 bits 583,  Expect = 2e-35
 Identities = 88/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL+PK+APQAI   E +EG+GGPGTIKKI F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E K+VA+  G  +  IS+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +ES+L  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 94. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 140.9 bits 583,  Expect = 2e-35
 Identities = 88/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL+PK+APQAI   E +EG+GGPGT KKI F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E K+VA+  G  +  IS+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 95. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 140.5 bits 581,  Expect = 2e-35
 Identities = 88/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL+PK+APQAI   E +EG+GGPGTIKKI F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E K+VA+  G  +  IS+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISH- 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+V A KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 96. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 140.2 bits 580,  Expect = 3e-35
 Identities = 84/160 52%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV+ YE E TS IPA +LFKAF+LD DNL+PK+APQA+   E +EG+GGPGTIKKI F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + + +EKI  E K+V+ P GG ++K ++K
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 97. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 139.6 bits 577,  Expect = 4e-35
 Identities = 85/160 53%, Positives = 112/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MG + YE E TS IPA +LFKAF+LD DNL+PK+APQAI   E +EG+GGPGTIKKI F 
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P GG ++K ++K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 98. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 139.3 bits 576,  Expect = 5e-35
 Identities = 88/158 55%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  2    GVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFPE 61
            GV+ YE E TS IP  RLFKAF+LD DNL+PK+APQAI   E +EG+GGPGTIKKI F E
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKY 121
            G  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E K+VA+  G  +  IS+ Y
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISH-Y 119
Query  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            HTKG+ E+  E+VKA KE    L++ +ESYL  H DAYN
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 99. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 139.1 bits 575,  Expect = 6e-35
 Identities = 90/158 56%, Positives = 115/158 72%, Gaps = 1/158 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVF +E + TSVI  ARLFKA+ LD DNL+ KV PQAI S E IEGNGGPGTIKKI F 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            E   FKY K R+D +D  N  Y++SVIEG  +   +E +S EIK VA+PDGG ++K + K
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159
            Y+TKG+ ++K EQ++A+ E    LL+AVE+YL+AH D Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 100. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 138.9 bits 574,  Expect = 7e-35
 Identities = 88/159 55%, Positives = 115/159 72%, Gaps = 0/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVF +E + TSVI  ARLFKA+ LD DNL+ KV PQAI S E IEGNGGPGTIKKI F 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  +K+ K R+D +D  NF Y++SVIEG  + D LE +S E KIVA+PDGG + K ++K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159
            Y+TKG+ ++  E ++  KE    +++AVE+YL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 101. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 136.8 bits 565,  Expect = 3e-34
 Identities = 84/159 52%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV+ YE E TS IPA +LFKAF+LD DNL+PK+APQA+   E +EG+GGPGTIKKI F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E K+V+ P G  ++K ++K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E+VKA KE    L++ +E YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 102. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 124.2 bits 510,  Expect = 2e-30
 Identities = 78/156 50%, Positives = 107/156 68%, Gaps = 1/156 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MG   Y++E  S I A ++FKAF+LDGD ++PK  P+AI+ V+ +EG+GG GTIK   F 
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG   K VK R+D +D  NF Y+YS+IEGG + D +E IS  IKIVATPDGGC+ K  + 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSD 157
            Y  K + +V  E++KA KE    +++ VE+YLLA+ D
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPD 156

Sequence Alignment: 103. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 122.2 bits 501,  Expect = 7e-30
 Identities = 77/157 49%, Positives = 108/157 68%, Gaps = 0/157 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV  Y++E  S +P  +L+KAFILDGD LVPKV P+AI  V+ +EG+G  GTIK++ F 
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG   K VK RVD +D  N+ Y+Y++IEG  + + +E IS  IKIVA PDGG + K  + 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSD 157
            Y TKG+ +V  E++K  KE    +++A+E+YLLA+ D
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157

Sequence Alignment: 104. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 120.0 bits 491,  Expect = 3e-29
 Identities = 74/135 54%, Positives = 99/135 73%, Gaps = 1/135 0%
Query  11   TSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFPEGFPFKYVKD 70
            TSVIP  +LFKAF+LD DNL+PK+APQA+ SVE IEG+GG GT+KKI++ EG    YVK 
Sbjct  2    TSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKH 61
Query  71   RVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKYHTKGNHEVK 130
            ++D +D  NF Y+YS+ EG  +GD +EKIS EIK+VA+  G  ++K ++ YH KG  E+K
Sbjct  62   KIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVASGRGS-IIKTTSHYHCKGGAEIK 120
Query  131  AEQVKASKEMGETLLR 146
             EQVK  KE    L++
Sbjct  121  EEQVKDGKERAAGLFK 136

Sequence Alignment: 105. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 118.5 bits 485,  Expect = 9e-29
 Identities = 74/159 46%, Positives = 106/159 66%, Gaps = 0/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV  Y  E+T+ I   RLFKA++LD DNLVPK+  Q + + E IEG+GG G+IK++NF 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG P KY+K ++  +D  N++  YS+IEG  +G+ LE I+ +IK  A  +GGCV K + +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159
            YHTKG+H V  E+    +E    + +AVE+YLLA+   Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 106. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 116.7 bits 477,  Expect = 3e-28
 Identities = 75/158 47%, Positives = 108/158 68%, Gaps = 2/158 1%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVF +E E  S +  A L+KA++ D DN++PK A  +  SVEN+EGNGGPGTIKKI F 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            E    K+V  +++ +D  N+ Y+YSV+ G  + DT EKI+ + K+VA P+GG   K++ K
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160
            Y TKG+ E   +++K  K   + L++A+E+YLLAH D YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPD-YN 158

Sequence Alignment: 107. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 116.2 bits 475,  Expect = 4e-28
 Identities = 71/159 44%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV  +  E+T+ I   RLFK ++LD D+LVPK+  + + S+E +EG+GG G+IK++NF 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG P KY+K ++  +D  N+   YS+IEG  +GD LE I+ ++K  A  DGGCV K + +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159
            YHTKG+H V  E+    K     L++A+E+YLLA+   Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 108. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 111.4 bits 454,  Expect = 1e-26
 Identities = 71/157 45%, Positives = 104/157 66%, Gaps = 2/157 1%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVF +E E TS +P A+L+ A + D D++ PK+    + SVE +EGNGGPGTIKK+   
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            E    K++  +V+ +D  N+ YNYSV+ G  +  T EKI+ E K+V  P+GG + K++ K
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159
            YHTKG+ +   E++K  K  GE L+RA+E Y+LA+   Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 109. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 111.0 bits 452,  Expect = 2e-26
 Identities = 70/154 45%, Positives = 106/154 68%, Gaps = 1/154 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            M VF +E +TTS +  A L+KA++ D D +VPK A  +  SVE +EGNGGPGTIKKI+F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            E    K+V  +++E+D  N+ Y+YS++ G  + DT EKIS + K+   P+GG V+K+S K
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            YH+KG+     +++KA K   + L++ +E+YLLA+
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154

Sequence Alignment: 110. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 108.7 bits 442,  Expect = 8e-26
 Identities = 67/155 43%, Positives = 104/155 67%, Gaps = 0/155 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGVF +E +TTS +  A L+KA   D D + PK  P +  SVE +EGNGGPGTIKKI+F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            E    K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GG ++K+S  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            YH+KG+     +++KA K   ++L++AVE+YLLA+
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155

Sequence Alignment: 111. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 108.0 bits 439,  Expect = 1e-25
 Identities = 66/150 44%, Positives = 96/150 64%, Gaps = 0/150 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV  Y  E+T+ I   RLFKA++LD DNLVPK+  Q + + E IEG+GG G+IK++NF 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG P KY+K ++  +D  N++  YS+IEG  +G+ LE I+ +IK  A  +GGCV K + +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVES 150
            YHTKG+H V  E+    +      ++   S
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQGCRS 150

Sequence Alignment: 112. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 107.1 bits 435,  Expect = 2e-25
 Identities = 66/154 42%, Positives = 103/154 66%, Gaps = 0/154 0%
Query  2    GVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFPE 61
            GVF +E +TTS +  A L+KA   D D + PK  P +  SVE +EGNGGPGTIKKI+F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKY 121
                K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GG ++K+S  Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            H+KG+     +++KA K   ++L++AVE+YLLA+
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154

Sequence Alignment: 113. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 102.1 bits 413,  Expect = 8e-24
 Identities = 66/154 42%, Positives = 101/154 65%, Gaps = 1/154 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            M VF ++ + TS +  A L+ A+  D DN++PK A  +  SVE +EGNGGPGTIKKI+F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            E    K+V  +++ VD  N+ Y+YS++ G  + DT EKI+ + KI    DGG ++K++  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            YH KG+     +++KA K   + L++AVE+YLLA+
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLAN 154

Sequence Alignment: 114. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 101.6 bits 411,  Expect = 1e-23
 Identities = 61/155 39%, Positives = 99/155 63%, Gaps = 0/155 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV   E+  TS +PAA+LFKA+ LD D L+P+V P AI   E +EG+GG GT+K + + 
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            +  P+K +K ++D +D   F ++YS+I+G  +   ++ I+N +  V T DGGC    +  
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            ++TKG+  V  E +K + +    +++AVE+YLLA+
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 115. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 101.4 bits 410,  Expect = 1e-23
 Identities = 63/153 41%, Positives = 100/153 65%, Gaps = 2/153 1%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV  +E E+TS +P A+LFKA ++DGD L PK+ P AI S+E +EGNGGPGT+KK+   
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            E     YV  ++D +D   + Y+Y++  G    + LEK+S + K+ A  DGG  +K+S  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAA-DGGSKIKVSVT 118
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            +HTKG+  +  E  +  K+  + +++A+E Y+L++
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 116. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 100.5 bits 406,  Expect = 2e-23
 Identities = 62/154 40%, Positives = 100/154 64%, Gaps = 1/154 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV  + +E TS + A ++F+ F++D D ++PK AP A  SVE I+G+GGPGT+K I +P
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            +G P   +  R+D V+   + ++YSVI+G  +   +E I N + +V T DGG + K +  
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            +HTKG+  V  E +K + E    L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 117. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 97.7 bits 394,  Expect = 2e-22
 Identities = 60/154 38%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV    +E  S + A ++++ F+LD D + PKV PQ I SVE +EG+GG GT+K +++ 
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            E   +  +K +VD +D   + Y Y+ I G  + D LE + NE  +V T DGGC++K +  
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPT-DGGCIVKNTTI 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            Y+TKG+  +  +++K + E     ++AVE+YLLA+
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 118. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 96.4 bits 388,  Expect = 4e-22
 Identities = 59/154 38%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MGV   E+E  S + A ++++ F+LD D + PKV PQ I SVE +EG+GG GT++ +++ 
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            E   +  +K +VD +D   + Y Y+ I G  + + LE + N+  +V T DGGC++K +  
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQFVVVPT-DGGCIVKNTTI 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            Y+TKG+  +  ++VK + E     ++AVE+YLLA+
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 119. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 94.5 bits 380,  Expect = 1e-21
 Identities = 58/156 37%, Positives = 97/156 62%, Gaps = 2/156 1%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            M V  +EI T+S+ P+  +FKAF++D D + PK  P+   S++ IEG+GG GTIK I + 
Sbjct  1    MAVAEFEI-TSSLSPSN-IFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYS 58
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            +G PF   K +VD +D  NF  +Y++ EG  +   +E  ++ +K + + DGG V K S  
Sbjct  59   DGVPFTSSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMV 118
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDA 158
            +  KG+ ++  E V   KE  +  ++A+E+Y+++H +A
Sbjct  119  FKCKGDAKLTDENVSLMKEGLKKTFKAIETYVISHPEA 156

Sequence Alignment: 120. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 92.7 bits 372,  Expect = 5e-21
 Identities = 56/154 36%, Positives = 94/154 61%, Gaps = 1/154 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MG  ++ +E TS + A ++F   +LD D ++PK AP A  SV+ ++G+GG GT++ I +P
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG P   +  R D V+   + Y+ +VI+G  +   +E I   + +V T DGG + K +  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            +HTKG+  V  E +K + E    L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 92.0 bits 369,  Expect = 8e-21
 Identities = 56/154 36%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MG  ++ +E TS + A ++F   +LD D ++PK AP A  SVE ++G+GG GT++ I +P
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG P   +  R D V+   + Y+ +VI+G  +   +E I   + +V T DGG + K +  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            +HTKG+  V  E +K +      L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 91.8 bits 368,  Expect = 9e-21
 Identities = 55/154 35%, Positives = 94/154 61%, Gaps = 1/154 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MG  ++ +E TS + A ++F   +LD D ++PK AP A  SV+ ++G+GG GT++ I +P
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG P   +  R D V+   + Y+ +VI+G  + + +E I   + +V T DGG + K +  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            +HTKG+  V  E +K +      L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 91.3 bits 366,  Expect = 1e-20
 Identities = 55/154 35%, Positives = 94/154 61%, Gaps = 1/154 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MG  ++ +E TS + A ++F   +LD D ++PK AP A  SV+ ++G+GG GT++ I +P
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 73
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG P   +  R D V+   + Y+ +VI+G  + + +E I   + +V T DGG + K +  
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            +HTKG+  V  E +K +      L++A+E+YL+A+
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 124. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 89.7 bits 359,  Expect = 4e-20
 Identities = 55/154 35%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
            MG  ++ +E TS + A ++F   +LD D ++PK A  A  SVE ++G+GG GT++ I +P
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            EG P   +  R D V+   + Y+ +VI+G  +   +E I   + +V T DGG + K +  
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155
            +HTKG+  V  E +K +      L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 62.5 bits 239,  Expect = 4e-12
 Identities = 51/100 51%, Positives = 68/100 68%, Gaps = 39/100 39%
Query  22   AFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFPEGFPFKYVKDRVDEVDHTNFK 81
            AF+LD DNL+PK                      KI F EG  + YVK            
Sbjct  1    AFVLDADNLIPK----------------------KITFGEGSQYGYVK------------ 26
Query  82   YNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMG 141
                 +EG  + DTLEKI  E K+V+ P    ++K ++KYHTKG+ E+K E+VKA KE  
Sbjct  27   -----VEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 81
Query  142  ETLLRAVESYLLAHSDAYN 160
              L++ +E YL  H   YN
Sbjct  82   AHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 57.0 bits 214,  Expect = 9e-11
 Identities = 34/50 68%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  2    GVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGP 51
            GVF +E + TSVI  ARLFKA+ LD DNL+ KV PQAI S E IEGNGGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 53.4 bits 200,  Expect = 3e-09
 Identities = 48/143 33%, Positives = 71/143 49%, Gaps = 9/143 6%
Query  4    FNYEIETTSVIPA--ARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINF-P 60
            FN + E +  + A  A L K FI     +VPKV P+ +  V+ IEG+GG GTI   NF P
Sbjct  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
            E  P  Y ++ + E D ++ +    VIEGG +   L       K+    +   ++ +   
Sbjct  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
Query  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYL 152
            Y    + E K    K S+      LR +E YL
Sbjct  120  YDHDSDIEEKVTPTKTSQST-LMYLRRLERYL 150

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 33.3 bits 109,  Expect = 0.0006
 Identities = 17/24 70%, Positives = 20/24 83%, Gaps = 0/24 0%
Query  2    GVFNYEIETTSVIPAARLFKAFIL 25
            GVF +E + TSVIP ARLFKAF+L
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.