The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP
EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK
YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA54481 Bet v 1.0202 160 1029 266.8 2e-73
P43184 Bet v 1.0203 160 1023 265.3 5.8e-73
CAA54421 Bet v 1.0201 160 1020 264.5 9.8e-73
P43186 Bet v 1.0204 160 1014 263.0 2.8e-72
Q39427 Bet v 1.0205 160 1000 259.5 3.3e-71
CAA04828.1 Bet v 1.0206 159 999 259.2 3.8e-71
ACF75030.1 Bet v 1.0207 150 950 246.9 1.9e-67
CAA07329.1 Bet v 1.0118 160 950 246.8 2.1e-67
CAB02160 Bet v 1.0113 160 916 238.3 7.9e-65
CAA33887 Bet v 1.0101 160 911 237.0 1.9e-64
CAB02159 Bet v 1.0112 160 911 237.0 1.9e-64
CAB02156 Bet v 1.0109 160 910 236.7 2.3e-64
CAA04827.1 Bet v 1.0116 159 909 236.5 2.7e-64
CAA54485 Bet v 1.0105 160 907 236.0 3.8e-64
CAB02161 Bet v 1.0114 160 900 234.2 1.3e-63
CAA54487 Bet v 1.0106 160 900 234.2 1.3e-63
CAA07323.1 Bet v 1.0117 160 898 233.7 1.8e-63
CAB02155 Bet v 1.0108 160 897 233.5 2.2e-63
CAA54483 Bet v 1.0103 160 895 233.0 3.1e-63
CAA54484 Bet v 1.0104 160 895 233.0 3.1e-63
CAA96547 Bet v 1.0115 160 894 232.7 3.7e-63
CAA54482 Bet v 1.0102 160 894 232.7 3.7e-63
CAB02157 Bet v 1.0110 160 892 232.2 5.3e-63
CAA54489 Bet v 1.0107 160 891 231.9 6.3e-63
CAB02158 Bet v 1.0111 160 889 231.4 8.9e-63
CAA96548 Cor a 1.0201 160 887 230.9 1.3e-62
AAB24432 Aln g 1 160 884 230.2 2.1e-62
P38948 Aln g 1 159 877 228.4 7.2e-62
CAB02217 Car b 1.0302 161 843 219.8 2.8e-59
CAB02216 Car b 1.0301 161 836 218.1 9.6e-59
ABC41615.1 Bet v 1.0119 150 824 215.1 7e-58
CAB02207 Car b 1.0104 160 801 209.2 4.3e-56
CAB02206 Car b 1.0103 160 800 209.0 5.2e-56
CAA50328 Cor a 1.0102 160 797 208.2 8.7e-56
ABZ81040 Car b 1.0109 160 794 207.5 1.5e-55
CAA50325 Cor a 1.0103 160 794 207.5 1.5e-55
CAA50327 Cor a 1.0101 160 790 206.4 3e-55
ABZ81043 Car b 1.0112 160 790 206.4 3e-55
ABZ81042 Car b 1.0111 160 790 206.4 3e-55
ADK39021 Ost c 1.0101 160 789 206.2 3.5e-55
ABZ81041 Car b 1.0110 160 789 206.2 3.5e-55
CAB02208 Car b 1.0105 160 788 205.9 4.2e-55
ABZ81044 Car b 1.0113 160 786 205.4 6e-55
Q08407 Cor a 1 159 783 204.7 1e-54
P38950 Car b 1 159 783 204.7 1e-54
CAA54696.1 Bet v 1.0301 160 780 203.9 1.7e-54
CAB02209 Car b 1.0106 160 778 203.4 2.4e-54
CAB02213 Car b 1.0107 160 776 202.9 3.4e-54
CAA47357 Car b 1.0102 159 772 201.9 6.9e-54
CAA50326 Cor a 1.0104 160 771 201.7 8.3e-54
CAB02215 Car b 1.0108 160 766 200.4 2e-53
P38949 Car b 1 159 759 198.6 6.7e-53
CAA96549 Cor a 1.0301 160 745 195.1 7.8e-52
CAD10374 Cas s 1 160 720 188.8 6.2e-50
CAA96535 Mal d 1.0401 160 720 188.8 6.2e-50
AAD48405 Cor a 1.0401 161 713 187.0 2.1e-49
AAG40331 Cor a 1.0404 161 713 187.0 2.1e-49
AAG40329 Cor a 1.0402 161 710 186.2 3.6e-49
CAA96536 Mal d 1.0402 160 707 185.5 6e-49
AAG40330 Cor a 1.0403 161 707 185.5 6.1e-49
CAA96537 Mal d 1.0403 160 703 184.5 1.2e-48
ACJ23864 Fag s 1.0101 160 694 182.2 5.9e-48
APD76154 Jug r 5.0101 160 690 181.2 1.2e-47
O24248 Pru av 1 160 673 176.9 2.3e-46
Q2I6V8 Pru p 1.0101 160 669 175.9 4.7e-46
O50001 Pru ar 1 160 648 170.6 1.8e-44
ABZ81046 Que a 1.0301 160 642 169.1 5.3e-44
CAA96534 Mal d 1.0301 159 640 168.6 7.4e-44
B6CQS9 Pru du 1.0101 160 635 167.3 1.8e-43
AAO25113 Mal d 1.0304 159 632 166.6 3e-43
AAD26546 Mal d 1.0103 159 630 166.1 4.3e-43
AAK13027 Mal d 1.0302 159 630 166.1 4.3e-43
AAB01362 Mal d 1.0201 159 628 165.6 6e-43
AAD26545 Mal d 1.0202 159 628 165.6 6e-43
AAD29671 Mal d 1.0108 159 628 165.6 6e-43
AUH28179 Que m 1.0101 160 628 165.5 6.1e-43
O65200 Pyr c 1 159 627 165.3 7.2e-43
CAA88833 Mal d 1.0102 159 627 165.3 7.2e-43
AAD26552 Mal d 1.0104 159 626 165.0 8.6e-43
AAD26548 Mal d 1.0204 159 624 164.5 1.2e-42
AAD26555 Mal d 1.0107 159 623 164.3 1.4e-42
AAD13683 Mal d 1.0206 159 623 164.3 1.4e-42
CAA58646 Mal d 1.0101 159 623 164.3 1.4e-42
AAK13030 Mal d 1.0207 159 622 164.0 1.7e-42
AAD26547 Mal d 1.0203 159 622 164.0 1.7e-42
AAD26554 Mal d 1.0106 159 622 164.0 1.7e-42
AAD26553 Mal d 1.0105 159 622 164.0 1.7e-42
Q256S7 Fra a 1 160 622 164.0 1.7e-42
AAD26558 Mal d 1.0205 159 620 163.5 2.4e-42
Q3T923 Fra a 1 160 620 163.5 2.5e-42
QOL10866 Que ac 1.0101 159 617 162.8 4.1e-42
AAK13029 Mal d 1.0109 159 617 162.8 4.1e-42
Q256S2 Fra a 1 160 616 162.5 5e-42
CAD32318 Mal d 1.0208 158 615 162.3 5.8e-42
QGS84240 Que i 1.0101 159 613 161.8 8.3e-42
Q256S6 Fra a 1 160 613 161.8 8.4e-42
AAK13028 Mal d 1.0303 159 610 161.0 1.4e-41
ABZ81047 Que a 1.0401 160 603 159.2 4.8e-41
ABZ81045 Que a 1.0201 159 601 158.7 6.8e-41
Q256S4 Fra a 1 159 601 158.7 6.8e-41
AFN42528 Can s 5.0101 161 590 155.9 4.8e-40
CAM31908 Act c 8.0101 159 521 138.5 8.2e-35
CAM31909 Act d 8.0101 157 515 137.0 2.3e-34
CAA42646 Gly m 4 158 512 136.3 3.9e-34
CAA43636 Pha v 1 155 492 131.2 1.3e-32
Q0Z8U9 Rub i 1.0101 137 484 129.3 4.2e-32
AAQ91847 Ara h 8.0101 157 484 129.2 5.2e-32
CAA43637 Pha v 1 156 483 129.0 6.1e-32
P25985 Pha v 1 155 476 127.2 2.1e-31
NP_001275580 Sola l 4.0201 160 459 122.9 4.3e-30
AHC08073 Sola l 4.0101 160 452 121.1 1.4e-29
Q2VU97 Vig r 1.0101 155 448 120.1 2.8e-29
EF436550 Ara h 8.0201 153 447 119.9 3.2e-29
P49372 Api g 1 154 423 113.8 2.2e-27
CAA67246 Pet c PR10 155 411 110.8 1.8e-26
CAA75803 Lyc e 4.0101 178 405 109.2 6.4e-26
P92918 Api g 1.0201 159 401 108.2 1.1e-25
AAB92255 Tar o RAP 157 400 108.0 1.3e-25
AAL76932 Dau c 1.0201 154 393 106.2 4.2e-25
CAB03716 Dau c 1.0104 154 393 106.2 4.2e-25
CAB06416 Dau c 1.0105 154 390 105.5 7e-25
BAA13604 Dau c 1.0102 154 389 105.2 8.4e-25
AAB01092 Dau c 1.0101 168 387 104.7 1.4e-24
CAB03715 Dau c 1.0103 154 380 103.0 4e-24
Q5ULZ4 Fra a 1.0101 100 264 74.0 1.3e-15
P85126 Que a 1.0101 50 210 61.0 5.7e-12
Q9ZWP8 Vig r 6.0101 155 214 61.1 1.7e-11
Q9S8Q4 Cas s 1 24 117 38.1 2.1e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 266.8 bits 1029,  Expect = 2e-73
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 2. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 265.3 bits 1023,  Expect = 6e-73
 Identities = 159/160 99%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD+EMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 3. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 264.5 bits 1020,  Expect = 1e-72
 Identities = 158/160 98%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD+EMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 4. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 263.0 bits 1014,  Expect = 3e-72
 Identities = 157/160 98%, Positives = 159/160 99%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYESETTSVIPAARLFKAFIL+GD LIPKVAPQAISSVENIEGNGGPGTIKKITFP
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD+EMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 5. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 259.5 bits 1000,  Expect = 3e-71
 Identities = 154/160 96%, Positives = 158/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ETTSVIPAARLFKAFIL+GD LIPKVAPQAISSVENIEGNGGPGTIKKITFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIK+VATPDGGSILKISNK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD+EMKAEHMKAIKEK EALLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 6. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 259.2 bits 999,  Expect = 4e-71
 Identities = 154/159 96%, Positives = 157/159 98%, Gaps = 0/159 0%
Query  2    GVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 61
            GVFNYESETTSVIPAARLFKAFIL+GD LIPKVAPQAISSVENIEGNGGPGTIKKITFPE
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKY 121
            GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIK+VATPDGGSILKISNKY
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  122  HTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            HTKGD+EMKAEHMKAIKEKGE LLRAVESYLLAHSDAYN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 7. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 246.9 bits 950,  Expect = 2e-67
 Identities = 148/150 98%, Positives = 149/150 99%, Gaps = 0/150 0%
Query  4    FNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 63
            FNYESETTSVIPAARLFKAFILEGD LIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 123
            PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  124  KGDQEMKAEHMKAIKEKGEALLRAVESYLL 153
            KGD+EMKAEHMKAIKEKGEALLRAVESYLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 8. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 246.8 bits 950,  Expect = 2e-67
 Identities = 145/160 90%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ETTSVIPAARLFKAFIL+GD LIPKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIK+VATPDGGSIL+ISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD+EMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 9. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 238.3 bits 916,  Expect = 8e-65
 Identities = 140/160 87%, Positives = 152/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ETTSVIPAARLFKAFIL+GD L+PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIKIVATPDGGSILKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD+E+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 10. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 237.0 bits 911,  Expect = 2e-64
 Identities = 140/160 87%, Positives = 151/160 94%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ETTSVIPAARLFKAFIL+GD L PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIKIVATPDGGSILKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD+E+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 11. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 237.0 bits 911,  Expect = 2e-64
 Identities = 140/160 87%, Positives = 151/160 94%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ETTSVIPAARLFKAFIL+GD L PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIKIVATPDGGSILKISNK
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD+E+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 12. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 236.7 bits 910,  Expect = 2e-64
 Identities = 140/160 87%, Positives = 151/160 94%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ETTSVIPAARLFKAFIL+GD L PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIKIVATPDGGSILKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD+E+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 13. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 236.5 bits 909,  Expect = 3e-64
 Identities = 140/159 88%, Positives = 150/159 94%, Gaps = 0/159 0%
Query  2    GVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 61
            GVFNYE+E TSVIPAARLFKAFIL+GD L PKVAPQAISSVENIEGNGGPGTIKKI+FPE
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKY 121
            G PFKYVK+RVDEVDHANFKYSYS+IEGG +GDTLEKI NEIKIVATPDGGSILKISNKY
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  122  HTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            HTKGD+E+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 14. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 236.0 bits 907,  Expect = 4e-64
 Identities = 140/160 87%, Positives = 150/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYESETTSVIPAARLFKAFILEGD LIPKVAPQAISSVENIEGNGGPGTIKKI FP
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIKIVATPDGG +LKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG++E+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 15. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 234.2 bits 900,  Expect = 1e-63
 Identities = 139/160 86%, Positives = 150/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ETTSVIPAARLFKAFIL+GD L PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIKIVATPDGGSILKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD+E+KAE++KA KE  E LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 16. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 234.2 bits 900,  Expect = 1e-63
 Identities = 138/160 86%, Positives = 150/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+E TSVIPAARLFKAFIL+GD L PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EG PFKYVK+RVDEVDH NFKYSYS+IEGG +GDTLEKI NEIKIVATP+GGSILKI+NK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD+E+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 17. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 233.7 bits 898,  Expect = 2e-63
 Identities = 137/160 85%, Positives = 150/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ETTSVIPAARLFKAFIL+GD L PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIKIVATPDGG +LKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG++E+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 18. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 233.5 bits 897,  Expect = 2e-63
 Identities = 137/160 85%, Positives = 150/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ETTSVIPAARLFKAFIL+GD L PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIKIVATPDGG +LKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG++E+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 19. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 233.0 bits 895,  Expect = 3e-63
 Identities = 138/160 86%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+E TSVIPAARLFKAFIL+GD L PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EG PFKYVK RVDEVDH NFKYSYS+IEGG +GDTLEKI NEIKIVATP+GGSILKI+NK
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD+E+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 20. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 233.0 bits 895,  Expect = 3e-63
 Identities = 138/160 86%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE E TSVIPAARLFKAFIL+GD L PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EG PFKYVK+RVDEVDH NFKYSYS+IEGG +GDTLEKI NEIKIVATP+GGSILKI+NK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD+E+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 21. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 232.7 bits 894,  Expect = 4e-63
 Identities = 139/160 86%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ETTSVIPAARLFKAFIL+GD L PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EG PFKYVK+RVDEV H NFKYSYS+IEGG +GDTLEKI NEIKIVATPDG SILKISNK
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD+E+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 22. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 232.7 bits 894,  Expect = 4e-63
 Identities = 137/160 85%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE ETTSVIPAARLFKAFIL+GD L+PKVAPQAISSVENIEGNGGPGTIKKI FP
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIKIVATPDGG +LKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG++E+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 23. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 232.2 bits 892,  Expect = 5e-63
 Identities = 136/160 85%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ETTSVIPAARLFKAFIL+GD L PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GD LEKI NEIKIVATPDGG +LKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG++E+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 24. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 231.9 bits 891,  Expect = 6e-63
 Identities = 135/160 84%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+E TSVIPAAR+FKAFIL+GD L+PKVAPQAISSVENIEGNGGPGTIKKI FP
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIKIVATPDGG +LKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG++E+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 25. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 231.4 bits 889,  Expect = 9e-63
 Identities = 136/160 85%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ETTSVIPAARLFKAFIL+GD L PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
             G PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIKIVATPDGG +LKISNK
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG++E+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 26. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 230.9 bits 887,  Expect = 1e-62
 Identities = 133/160 83%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+E+TSVIPAARLFKAFIL+G+ LIPKVAPQA+SSVEN+EGNGGPGTIKKITF 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSPFKYVKERV+EVDH NFKYSY++IEGG +GD +EKICNEIKIVA PDGGSILKISNK
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD+E+ AEH+K  KEK E L+RAVE+YLLAHSDAYN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 27. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 230.2 bits 884,  Expect = 2e-62
 Identities = 133/160 83%, Positives = 148/160 92%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ET SVIPAARLFKAFIL+GD L+PKVAP+A+SSVENIEGNGGPGTIKKITFP
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSPFKYVKERVDEVD  NFKYS+S+IEGGA+GD LEK+CNEIKIVA PDGGSILKISNK
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +HTKGD+E+ AE++K  KEK   LL+AVESYLLAHSDAYN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 28. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 228.4 bits 877,  Expect = 7e-62
 Identities = 132/159 83%, Positives = 147/159 92%, Gaps = 0/159 0%
Query  2    GVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 61
            GVFNYE+ET SVIPAARLFKAFIL+GD L+PKVAP+A+SSVENIEGNGGPGTIKKITFPE
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKY 121
            GSPFKYVKERVDEVD  NFKYS+S+IEGGA+GD LEK+CNEIKIVA PDGGSILKISNK+
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  122  HTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            HTKGD+E+ AE++K  KEK   LL+AVESYLLAHSDAYN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 29. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 219.8 bits 843,  Expect = 3e-59
 Identities = 126/160 78%, Positives = 145/160 90%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ETTSVIPAARLFKAFIL+G+ LIPKVAPQA+SSVEN+EGNGGPGTIKKITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSP KYVKERV+EVDH NFKYSY++IEGG +GD +EKICNEIKIVA PDGGSILKI++K
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD+E+ AEH+K  KE+ E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 30. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 218.1 bits 836,  Expect = 1e-58
 Identities = 125/160 78%, Positives = 145/160 90%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ETTSVIPAARLFKAFIL+G+ LIPKV+PQA+SSVEN+EGNGGPGTIKKITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSP KYVKERV+EVDH NFKYSY++IEGG +GD +EKICNEIKIVA PDGGSILKI++K
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD+E+ AEH+K  KE+ E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 31. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 215.1 bits 824,  Expect = 7e-58
 Identities = 127/150 84%, Positives = 139/150 92%, Gaps = 0/150 0%
Query  4    FNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 63
            FNYE+ETTSVIPAARLFKAFIL+GD L PKVAPQAISSV+NIEGNGGPGTIKKI FPEG 
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 123
            PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIKIVATPDGG ILKISNKYHT
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  124  KGDQEMKAEHMKAIKEKGEALLRAVESYLL 153
            KG++E+KAE++KA KE GE LLRAVESYLL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 32. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 209.2 bits 801,  Expect = 4e-56
 Identities = 120/160 75%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ET SVIPAARLFK+++L+GD LIPKVAPQAISSVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSPFK+VKERVDEVD+ANFKY+Y++IEG  LGD LEK+ +E+KIVA P GGSI+KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGD+E+ AE MK  KE  E LLRAVESYLLAH+D YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 33. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 209.0 bits 800,  Expect = 5e-56
 Identities = 120/160 75%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ET SVIPAARLFK+++L+GD LIPKVAPQAISSVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSPFK+VKERVDEVD+ANFKY+Y++IEG  LGD LEK+ +E+KIVA P GGSI+KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGD+E+ AE MK  KE  E LLRAVESYLLAH+D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 34. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 208.2 bits 797,  Expect = 9e-56
 Identities = 120/160 75%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE ET SVIPAARLFK+++L+GD LIPKVAPQAI+SVEN+EGNGGPGTIK ITF 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS +KYVKERVDEVD+ NFKYSY++IEG  LGD LEK+C+E+KIVA P GGSILKIS+K
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGD+E+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 35. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 207.5 bits 794,  Expect = 1e-55
 Identities = 120/160 75%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ET SVIPAARLFK+++L+GD LIPKVAPQAISSVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSPFK+VKERVDEVD+ANFKY+Y++IEG  LGD LEK+ +E+KIVA P GGSILKIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGD+E+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 36. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 207.5 bits 794,  Expect = 1e-55
 Identities = 119/160 74%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ETTSVIPAARLFK+++L+GD LIPKVAPQAI+SVEN+EGNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS +KYVKERVDEVD+ NF YSY++IEG  LGD LEK+C+E+KIVA P GGSILKIS+K
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGD+E+ AE +K  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 37. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 206.4 bits 790,  Expect = 3e-55
 Identities = 119/160 74%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE ET SVIPAARLFK+++L+GD LIPKVAPQAI+SVEN+EGNGGPGTIK ITF 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS +KYVKERVDEVD+ NF YSY++IEG  LGD LEK+C+E+KIVA P GGSILKIS+K
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGD+E+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 38. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 206.4 bits 790,  Expect = 3e-55
 Identities = 119/160 74%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ET SVIPAARLFK+++L+GD LIPKVAPQAISSVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSPFK+VKERVDEVD+ANFKY+Y++IEG  LGD LEK+ +E+KIVA P GGSI+KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGD+E+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 39. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 206.4 bits 790,  Expect = 3e-55
 Identities = 119/160 74%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ET SVIPAARLFK+++L+GD LIPKVAPQAISSVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSPFK+VKERVDEVD+ANFKY+Y++IEG  LGD LEK+ +E+KIVA P GGSI+KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGD+E+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 40. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 206.2 bits 789,  Expect = 4e-55
 Identities = 119/160 74%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ET SVIPAARLFK+++L+GD LIPKVAPQAIS VEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSPFK+VKERVDEVD+ANFKY+Y++IEG  LGD LEK+ +E+KIVA P GGSILKIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGD+E+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 41. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 206.2 bits 789,  Expect = 4e-55
 Identities = 118/160 73%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ET SVIPAARLFK+++L+GD LIPKVAPQAISSVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSPFK+VKERVDEVD+ANFKY+Y++IEG  LGD LEK+ +E+KIVA P GGS++KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGD+E+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 42. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 205.9 bits 788,  Expect = 4e-55
 Identities = 119/160 74%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ET SVIPAARLFK+++L+ D LIPKVAPQAISSVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSPFK+VKERVDEVD+ANFKY+Y++IEG  LGD LEK+ +E+KIVA P GGSI+KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGD+E+ AE MK  KE  E LLRAVESYLLAH+D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 43. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 205.4 bits 786,  Expect = 6e-55
 Identities = 119/160 74%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ET SVIPAARLFK+++L+GD LIPKVAPQAISSVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EG PFK+VKERVDEVD+ANFKYSY++IEG  LGD LEK+ +E+KIVA P GGSI+KIS+K
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGD+E+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 44. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 204.7 bits 783,  Expect = 1e-54
 Identities = 118/159 74%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  2    GVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 61
            GVFNYE ET SVIPAARLFK+++L+GD LIPKVAPQAI+SVEN+EGNGGPGTIK ITF E
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKY 121
            GS +KYVKERVDEVD+ NF YSY++IEG  LGD LEK+C+E+KIVA P GGSILKIS+K+
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  122  HTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            H KGD+E+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 45. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 204.7 bits 783,  Expect = 1e-54
 Identities = 118/159 74%, Positives = 138/159 86%, Gaps = 0/159 0%
Query  2    GVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 61
            GVFNYE+ETTSVIPAARLFKAFIL+G+ LIPKV+PQA+SSVEN+EGNGGPGTIKKITF E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKY 121
            GSP KYVKERV+E+DH NFKY+Y++IEG  LGD LEK+ +E+KIVA P GGSI+KIS+K+
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            H KG +E+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 46. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 203.9 bits 780,  Expect = 2e-54
 Identities = 118/160 73%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE E TSVI  ARLFK+F+L+ D LIPKVAP+ +SS ENIEGNGGPGTIKKITFP
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS FKY+K RVDE+DHANFKY YS+IEGG LGDTLEKI  EIKIVA P GGSILKI++K
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD  +  E +KA KEKG  L++AVE+YL+AH +AYN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 47. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 203.4 bits 778,  Expect = 2e-54
 Identities = 118/160 73%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ET SVIPAARLFK+++L+ D LIPKVAPQAISSVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSPFK+VKERVDEVD+ANFKY+Y++IEG  LGD LEK+ +E+KIVA P GGSI+KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGD+E+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 48. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 202.9 bits 776,  Expect = 3e-54
 Identities = 119/160 74%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ET SVIPAARLFK+++L+ D LIPKVAPQAISSVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSPFK+VKERVDEVD+ANFK+SY++IEG  LGD LEK+  E+KIVA P GGSILKIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGD+E+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 49. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 201.9 bits 772,  Expect = 7e-54
 Identities = 117/159 73%, Positives = 137/159 86%, Gaps = 0/159 0%
Query  2    GVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 61
            GVFNYE+ET SVIPAARLFK+++L+GD LIPKVAPQAISSVEN+ GNGGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKY 121
            GSPFK+VKERVDEVD+ANFKY+Y++IEG  LGD LEK+ +E+KIVA P GGSI+KIS+K+
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            H KG +E+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 50. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 201.7 bits 771,  Expect = 8e-54
 Identities = 117/160 73%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE ET SVI AARLFK+++L+GD LIPKVAPQAI+SVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS +KYVKERVDEVD+ NFKYSY++IEG  LGD LEK+C+E+KIVA P GGS LKIS+K
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGD+E+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 51. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 200.4 bits 766,  Expect = 2e-53
 Identities = 117/160 73%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ET SV+PAARLFK+++L+ D LIPKVAPQAISSVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSPFK+VKERVDEVD+ANFK+SY++IEG  LGD LEK+  E+ IVA P GGSILKIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGD+E+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 52. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 198.6 bits 759,  Expect = 7e-53
 Identities = 115/159 72%, Positives = 135/159 84%, Gaps = 0/159 0%
Query  2    GVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 61
            GVFNYE+ET SVIPAARLFK+++L+GD LIPKVAPQ ISSVEN+ GNGGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKY 121
            G PFK+VKERVDEVD+ANFKY+Y++IEG  LGD LEK+ +E+KIVA P GGSI+KIS+K+
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            H KG +E+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 53. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 195.1 bits 745,  Expect = 8e-52
 Identities = 114/160 71%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ETTSVIP ARLFK F+L+ D LIPKVAP+AI S+E IEGNGGPGTIKKI F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSPF Y+K++V+E+D+ANF Y YS+IEG AL D LEKI  EIKIVA+P GGSILK  +K
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHT GD+E+K E++KA KEK   L++AVE YLLAHSDAYN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 54. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 188.8 bits 720,  Expect = 6e-50
 Identities = 110/160 68%, Positives = 131/160 81%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVF +E+E TS IP  RLFKAF+L+ D LIPK+AP+AI S E IEGNGGPGTIKKITF 
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS FKYVK R+DE+D+ANF Y YS+IEG  + + LEKI  EIKIVA+PDGGSILK ++K
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+QE+K E + A KEK   L++AVE+YLLAHSDAYN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 55. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 188.8 bits 720,  Expect = 6e-50
 Identities = 109/160 68%, Positives = 130/160 81%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+ETTSVIPA RLFKAFIL+GD LIPK+APQAI S E IEG+GG GTIKK+TF 
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK+RV+ +D  NF YSYSMIEG  L D LEKI  E K++A+PDGGSI+K ++ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YH KGD E+K EH+KA KEK   L++ +E+YLLAHSDAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 56. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 187.0 bits 713,  Expect = 2e-49
 Identities = 109/159 68%, Positives = 129/159 81%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVF YE E TSVIP ARLFK+F+L+ D LIPKVAPQ  +S EN+EGNGGPGTIKKITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGG-SILKISN 119
            EG+ FKY+K +V+E+DHANFKY YS+IEGG LG TLEKI  EIK+ A P GG SILKI++
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159
            KYHTKG+  +  E +KA KEK   L++AVE+YLLAH DAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 57. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 187.0 bits 713,  Expect = 2e-49
 Identities = 109/159 68%, Positives = 130/159 81%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVF+YE E TSVIP ARLFK+F+L+ D LIPKVAPQ  +S EN+EGNGGPGTIKKITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGG-SILKISN 119
            EG+ FKY+K +V+E+DHANFKY YS+IEGG LG TLEKI  EIK+ A P GG SILKI++
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159
            KYHTKG+  +  E +KA KEK   L++AVE+YLLAH DAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 58. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 186.2 bits 710,  Expect = 4e-49
 Identities = 108/159 67%, Positives = 128/159 80%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVF+YE E TSVIP ARLFK+F+L+ D LIPKVAPQ  +  EN+EGNGGPGTIKKITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGG-SILKISN 119
            EGS FKY+K +V+E+DHANFKY YS+IEGG LG TLEKI  EIK+ A P GG SILKI++
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159
            KYHTKG+  +  E +KA KEK   L++AVE+YLLAH D Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 59. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 185.5 bits 707,  Expect = 6e-49
 Identities = 107/160 66%, Positives = 129/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+E TSVIPA RLFKAFIL+GD LIPK+APQAI S + IEG+GG GTIKK+TF 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK+RV+ +D  NF YSYSMIEG  L D LEKI  E K++A+PDGGSI+K ++ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YH KGD E+K EH+KA KEK   L++ +E+YLLAHSDAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 60. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 185.5 bits 707,  Expect = 6e-49
 Identities = 108/159 67%, Positives = 127/159 79%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVF YE E TSVIP ARLFK+F+L+ D LIPKVAPQ  +  EN+EGNGGPGTIKKITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGG-SILKISN 119
            EGS FKY+K +V+E+DHANFKY YS+IEGG LG TLEKI  EIK+ A P GG SILKI++
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159
            KYHTKG+  +  E +KA KEK   L++AVE+YLLAH D Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 61. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 184.5 bits 703,  Expect = 1e-48
 Identities = 107/160 66%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+E TSVIPA RLFKAFIL+GD LIPK+APQAI S E IEG+GG GTIKK+TF 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK+RV+ +D  NF YSYSMIEG  L D LEKI  E K++A+PDGGSI+K ++ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            Y  KGD E+K EH+KA KEK   L++ +E+YLLAHSDAYN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 62. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 182.2 bits 694,  Expect = 6e-48
 Identities = 106/160 66%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVF YESETT+VI  ARLFKAF+L+ D LIPKVAPQAI S E IEG+GGPGTIKKITF 
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS F YVK R+DE+D+ANF Y+ ++IEG A+ +TLEKI  EIK+VA+PDGGSILK ++K
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD+E+K +++KA KE+   +++AVE+YLLA+  AY+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 63. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 181.2 bits 690,  Expect = 1e-47
 Identities = 106/160 66%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVF YE+E+TSVIP ARLFKAF+L+ D LIPKV PQA+ S E IEGNGGPGTIKKI F 
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS +KYVK R D +D ANF Y+YS+IEG AL D +EKI  E KIVA+ +GGSILK  + 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YH+KGD+E+K E +K  KEK   L++AVE YLLAH DAYN
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 64. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 176.9 bits 673,  Expect = 2e-46
 Identities = 99/160 61%, Positives = 124/160 77%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVF YESE TS IP  RLFKAF+L+ D L+PK+APQAI   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK ++D +D  N+ YSY++IEG ALGDTLEKI  E K+VA+P GGSI+K ++ 
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+ E+K EH+KA KEK   L++ +E+YL  H DAYN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 65. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 175.9 bits 669,  Expect = 5e-46
 Identities = 99/160 61%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVF YESE TS IP  RLFKAF+L+ D L+PK+APQAI   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK ++D +D  N  YSY++IEG ALGD LEKI  E K+VA+P GGSI+K ++ 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +E+YL  H DAYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 66. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 170.6 bits 648,  Expect = 2e-44
 Identities = 98/160 61%, Positives = 124/160 77%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVF YE+E TSVIP  +LFKAFIL+ D LIPKVAP A+   E +EG+GG GTIKK+TF 
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK RVD +D  N+ YSY++IEG AL D +E I  +IK+VA+PDGGSI+K ++ 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KEK   L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 67. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 169.1 bits 642,  Expect = 5e-44
 Identities = 98/159 61%, Positives = 122/159 76%, Gaps = 0/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVF YESE  SVIP ARLFKAF+L+ D LIPKV PQA+ S E IEGNGGPGTIKKITF 
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS +K+ K R+D +D  NF YS+S+IEG AL D LE +  E KIVA+PDGGSI+K ++K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159
            Y+TKGD ++  E ++  KEK   +++AVE+YL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 68. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 168.6 bits 640,  Expect = 7e-44
 Identities = 98/159 61%, Positives = 123/159 77%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVFNYE+E TSVIP ARLF AF+L+ D LIPK+APQA+ S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK R+D VD  NF Y YS+IEG A+ +T+EKI  E K+VA+   GS++K ++ 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTK D E+K EH+KA KEK   L++ +E+YLLAHSDAYN
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 69. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 167.3 bits 635,  Expect = 2e-43
 Identities = 93/160 58%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MG+F Y  E+TSVIP  RLFKA++LE DTLIPK+APQ++ S E +EG+GG GTIKKI+F 
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK ++D +D  NF Y+YS++EG AL D +EKI  EIK+VA+ DGGS++K ++ 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K E +KA KEK   L++ +E+YL+A+ DAYN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 70. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 166.6 bits 632,  Expect = 3e-43
 Identities = 97/159 61%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVF YESE TSVIP ARLF AF+L+ D LIPK+APQA+ S E +EG+GG GTIKKI F 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK R+D VD  NF Y YS+IEG A+ +T+EKI  E K+VA+   GS++K ++ 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +E+YLL H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 71. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 166.1 bits 630,  Expect = 4e-43
 Identities = 96/159 60%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV+ +E+E TS IP +RLFKAF+L+ D LIPK+APQAI   E +EGNGGPGTIKKITF 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK R+D +D A++ YSY++IEG AL DT+EKI  E K+VA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+ E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 72. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 166.1 bits 630,  Expect = 4e-43
 Identities = 97/159 61%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVF YESE TSVIP ARLF AF+L+ D LIPK+APQA+ S E +EG+GG GTIKKI F 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK R+D VD  NF Y YS+IEG A+ +T+EKI  E K+VA    GS++K ++ 
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +E+YLL H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 73. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 165.6 bits 628,  Expect = 6e-43
 Identities = 95/159 59%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV+ +E+E TS IP  RLFKAF+L+ D LIPK+APQAI   E +EG+GGPGTIKKITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK ++D VD AN+ Y+Y++IEG AL DT+EK+  E K+VA+   GSI+K  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 74. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 165.6 bits 628,  Expect = 6e-43
 Identities = 95/159 59%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV+ +E+E TS IP  RLFKAF+L+ D LIPK+APQAI   E +EG+GGPGTIKKITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK ++D VD AN+ Y+Y++IEG AL DT+EK+  E K+VA+   GSI+K  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 75. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 165.6 bits 628,  Expect = 6e-43
 Identities = 96/159 60%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV+ +E+E TS IP +RLFKAF+L+ D LIPK+APQAI   E +EGNGGPGTIKKITF 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK R+D +D A++ YSY++IEG AL DT+EKI  E K+VA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+ E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 76. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 165.5 bits 628,  Expect = 6e-43
 Identities = 96/159 60%, Positives = 120/159 75%, Gaps = 0/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV  YESE  SVIP ARLFKAF+L+ D LIPKV PQA+ S E IEGNGGPGTIKKITF 
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS +K+ K R+D +D  NF +S+S+IEG AL D LE +  E KIVA+PDGGSI+K + K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159
            Y+TKGD ++  E ++  KEK   +++AVE+YL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 77. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 165.3 bits 627,  Expect = 7e-43
 Identities = 96/159 60%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MG++ +E+E TS IP  RLFKAF+L+ D LIPK+APQAI   E +EGNGGPGTIKKITF 
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK RVD +D A++ Y+Y++IEG AL DT+EKI  E K+VA+  G +I  IS+ 
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVASGSGSTIKSISH- 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 78. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 165.3 bits 627,  Expect = 7e-43
 Identities = 95/159 59%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV+ +E+E TS IP +RLFKAF+L+ D LIPK+APQAI   E +EGNGGPGTIKKITF 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK R+D +D A++ YSY++IEG AL DT+EKI  E K+VA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATIKSISH- 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YH KG+ E+K EH+K  KEKG  L++ +ESYL  H DAYN
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 79. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 165.0 bits 626,  Expect = 9e-43
 Identities = 96/159 60%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV+ +E+E TS IP  RLFKAF+L+ D LIPK+APQAI   E +EGNGGPGTIKKITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK R+D +D A++ YSY++IEG AL DT+EKI  E K+VA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+ E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 80. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 164.5 bits 624,  Expect = 1e-42
 Identities = 94/159 59%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV+ +E+E TS IP  RLFKAF+L+ D LIPK+APQAI   E +EG+GGPGTIKKITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK ++D VD AN+ Y+Y++IEG AL DT+EK+  E K++A+   GSI+K  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMAS-GSGSIIKSISH 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 81. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 164.3 bits 623,  Expect = 1e-42
 Identities = 95/159 59%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV+ +E+E TS IP +RLFKAF+L+ D LIPK+APQAI   E +EGNGGPGTIKKITF 
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK R+D +D A++ YSY++IEG AL DT+EKI  E K+VA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+ E+K EH+KA K K   L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 82. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 164.3 bits 623,  Expect = 1e-42
 Identities = 94/159 59%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV+ +E+E TS IP  RLFK F+L+ D LIPK+APQAI   E +EG+GGPGTIKKITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK ++D VD AN+ Y+Y++IEG AL DT+EK+  E K+VA+   GSI+K  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 83. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 164.3 bits 623,  Expect = 1e-42
 Identities = 95/159 59%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV+ +E+E TS IP +RLFKAF+L+ D LIPK+APQAI   E +EGNGGPGTIKKITF 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK R+D +D A++ YSY++IEG AL DT+EKI  E K+VA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+ E+K EH+K  KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 84. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 164.0 bits 622,  Expect = 2e-42
 Identities = 94/159 59%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV+ +E+E TS IP  RLFKAF+L+ D LIPK+APQAI   E +EG+GGPGT KKITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK ++D VD AN+ Y+Y++IEG AL DT+EK+  E K+VA+   GSI+K  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 85. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 164.0 bits 622,  Expect = 2e-42
 Identities = 94/159 59%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV+ +E+E TS IP  RLFKAF+L+ D LIPK+APQAI   E +EG+GGPGTIKKITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK ++D VD AN+ Y+Y++IEG AL DT+EK+  E K+VA+   GSI+K  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +ES+L  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 86. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 164.0 bits 622,  Expect = 2e-42
 Identities = 95/159 59%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV+ +E+E TS IP +RLFKAF+L+ D LIPK+APQAI   E +EGNGGPGTIKKITF 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK R+D +D A++ YSY++IEG AL DT+E I  E K+VA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+ E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 87. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 164.0 bits 622,  Expect = 2e-42
 Identities = 96/159 60%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV  +E+E TS IP +RLFKAF+L+ D LIPK+APQAI   E +EGNGGPGTIKKITF 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK R+D +D A++ YSY++IEG AL DT+EKI  E K+VA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+ E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 88. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 164.0 bits 622,  Expect = 2e-42
 Identities = 93/160 58%, Positives = 118/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV+ YE+E TS IPA +LFKAF+L+ D LIPK+APQAI   E +EG+GGPGTIKKITF 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK ++  +D  N  YSYS+IEG AL D +EKI  E K+V+ P GG+I+K ++K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 89. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 163.5 bits 620,  Expect = 2e-42
 Identities = 94/159 59%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV+ +E+E TS IP  RLFKAF+L+ D LIPK+APQAI   E +EG+GGPGTIKKITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK ++D VD AN+ Y+Y++IEG AL DT+EK+  E K+VA+   GSI+K  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+ A KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 90. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 163.5 bits 620,  Expect = 2e-42
 Identities = 91/160 56%, Positives = 118/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV+ YE+E TS IPA +LFKAF+L+ D LIPK+APQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK ++  +D  N  YSYS+IEG AL D +EKI  E K+V+ P GG+++K ++K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 91. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 162.8 bits 617,  Expect = 4e-42
 Identities = 96/159 60%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV+NYES+ TSVIP ARLFKAF+L+ D LI KV P+A+ S E IEGNGGPGTIKK TF 
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            E S  KY K R+D +D  N  YS+S+IEG AL D +  I  E+K VA+PDGGSI+K + K
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            Y+TKG  ++K E+++A  EKG  L++AVE+YLLAH D YN
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 92. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 162.8 bits 617,  Expect = 4e-42
 Identities = 95/159 59%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV  +E+E TS IP +RLFKAF+L+ D LIPK+APQAI   E +EGNGGPGTIKKITF 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK R+D +D A++ YSY++IEG AL DT+EKI  E K+VA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+ E+K EH+K  KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 93. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 162.5 bits 616,  Expect = 5e-42
 Identities = 91/160 56%, Positives = 118/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV+ YE+E TS IPA +LFKAF+L+ D LIPK+APQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK ++  +D  N  YSYS+IEG AL + +EKI  E K+V+ P GG+I+K ++K
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 94. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 162.3 bits 615,  Expect = 6e-42
 Identities = 94/158 59%, Positives = 119/158 75%, Gaps = 1/158 0%
Query  2    GVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 61
            GV+ YE+E TS IP  RLFKAF+L+ D LIPK+APQAI   E +EG+GGPGTIKKITF E
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKY 121
            GS + YVK ++D VD AN+ Y+Y++IEG AL DT+EK+  E K+VA+   GSI+K  + Y
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 119
Query  122  HTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            HTKGD E+  EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 95. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 161.8 bits 613,  Expect = 8e-42
 Identities = 98/158 62%, Positives = 119/158 75%, Gaps = 1/158 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV  +ES+ TSVIP ARLFKAF+L+ D LIPKV PQAI S+E IEGNGGPGTIKKITF 
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            E S FKY K R+D +D  N  YS+S+IEG AL D +  +  EIK VA+PDGGSI K + K
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159
            Y+TKGD ++K E+++A  EK   L +AVE+YLLAH D Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 96. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 161.8 bits 613,  Expect = 8e-42
 Identities = 92/160 57%, Positives = 117/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MG + YE+E TS IPA +LFKAF+L+ D LIPK+APQAI   E +EG+GGPGTIKKITF 
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK ++  +D  N  YSYS+IEG AL D +EKI  E K+V+ P GG+I+K ++K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 97. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 161.0 bits 610,  Expect = 1e-41
 Identities = 94/159 59%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVF YE E TSVIP ARL+ AF+L+ D LIPK+APQA+ S E +EG+GG GTIKKI F 
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK ++D VD  NF Y YS+IEG A+ +T+EKI  E K+VA+   GS++K  + 
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSISH 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +E+YLL H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 98. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 159.2 bits 603,  Expect = 5e-41
 Identities = 95/159 59%, Positives = 119/159 74%, Gaps = 0/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVF +ES+ TSVI  ARLFKA+ L+ D LI KV PQAI S E IEGNGGPGTIKKITF 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS +K+ K R+D +D  NF YS+S+IEG AL D LE +  E KIVA+PDGGSI K ++K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159
            Y+TKGD ++  E ++  KEK   +++AVE+YL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 99. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 158.7 bits 601,  Expect = 7e-41
 Identities = 96/158 60%, Positives = 118/158 74%, Gaps = 1/158 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVF +ES+ TSVI  ARLFKA+ L+ D LI KV PQAI S E IEGNGGPGTIKKITF 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            E S FKY K R+D +D  N  YS+S+IEG AL   +E +  EIK VA+PDGGSI+K + K
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159
            Y+TKGD ++K E+++A  EK   LL+AVE+YL+AH D Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 100. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 158.7 bits 601,  Expect = 7e-41
 Identities = 91/159 57%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV+ YE+E TS IPA +LFKAF+L+ D LIPK+APQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS + YVK ++  +D  N  YSYS+IEG AL D +EKI  E K+V+ P G +I+K ++K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +E YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 101. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 155.9 bits 590,  Expect = 5e-40
 Identities = 88/160 55%, Positives = 122/160 76%, Gaps = 1/160 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVF YESE TS I  ARLFKAF+L+GD L+PK+APQA+  VE +EGNGG GTIKKITF 
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGAL-GDTLEKICNEIKIVATPDGGSILKISN 119
            +G PFKYVK +++ +D  ++ YSYS+IEG AL G+ LEKI +E K+VA+ DGG+++K  +
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  120  KYHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            KY++ GD ++  E +K  +++   +L+ VE+YL  H +AYN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 102. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 138.5 bits 521,  Expect = 8e-35
 Identities = 82/157 52%, Positives = 111/157 70%, Gaps = 0/157 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV  Y+ E  S +P  +L+KAFIL+GDTL+PKV P+AI  V+ +EG+G  GTIK++TF 
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS  K VK+RVD +D  N+ YSY++IEG  L + +E I   IKIVA PDGGSI K  + 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSD 157
            Y TKGD ++  E +K  KEK   +++A+E+YLLA+ D
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157

Sequence Alignment: 103. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 137.0 bits 515,  Expect = 2e-34
 Identities = 83/156 53%, Positives = 108/156 69%, Gaps = 1/156 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MG   Y+ E  S I A ++FKAF+L+GDT+IPK  P+AI+ V+ +EG+GG GTIK  TF 
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGS  K VK R+D +D  NF YSYS+IEGGAL D +E I   IKIVATPDGG I K  + 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSD 157
            Y  K D ++  E +KA KE+   +++ VE+YLLA+ D
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPD 156

Sequence Alignment: 104. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 136.3 bits 512,  Expect = 4e-34
 Identities = 82/158 51%, Positives = 111/158 70%, Gaps = 2/158 1%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVF +E E  S +  A L+KA++ + D +IPK A  +  SVEN+EGNGGPGTIKKITF 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            E    K+V  +++ +D AN+ YSYS++ G AL DT EKI  + K+VA P+GGS  K++ K
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            Y TKGD E   + +K  K K +AL++A+E+YLLAH D YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPD-YN 158

Sequence Alignment: 105. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 131.2 bits 492,  Expect = 1e-32
 Identities = 75/154 48%, Positives = 110/154 71%, Gaps = 1/154 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            M VF +E +TTS +  A L+KA++ + DT++PK A  +  SVE +EGNGGPGTIKKI+F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            E    K+V  +++E+D AN+ YSYS++ G AL DT EKI  + K+   P+GGS++K+S K
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            YH+KGD     + +KA K K +AL++ +E+YLLA+
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154

Sequence Alignment: 106. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 129.3 bits 484,  Expect = 4e-32
 Identities = 75/135 55%, Positives = 100/135 74%, Gaps = 1/135 0%
Query  11   TSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGSPFKYVKE 70
            TSVIP  +LFKAF+L+ D LIPK+APQA+ SVE IEG+GG GT+KKI + EG+   YVK 
Sbjct  2    TSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKH 61
Query  71   RVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHTKGDQEMK 130
            ++D +D  NF YSYS+ EG ALGD +EKI  EIK+VA+   GSI+K ++ YH KG  E+K
Sbjct  62   KIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVAS-GRGSIIKTTSHYHCKGGAEIK 120
Query  131  AEHMKAIKEKGEALLR 146
             E++K  KE+   L++
Sbjct  121  EEQVKDGKERAAGLFK 136

Sequence Alignment: 107. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 129.2 bits 484,  Expect = 5e-32
 Identities = 76/157 48%, Positives = 107/157 68%, Gaps = 2/157 1%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVF +E E TS +P A+L+ A + + D++ PK+    + SVE +EGNGGPGTIKK+T  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            E    K++  +V+ +D AN+ Y+YS++ G AL  T EKI  E K+V  P+GGSI K++ K
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159
            YHTKGD +   E +K  K KGE L+RA+E Y+LA+   Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 108. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 129.0 bits 483,  Expect = 6e-32
 Identities = 74/155 47%, Positives = 107/155 69%, Gaps = 0/155 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGVF +E +TTS +  A L+KA   + DT+ PK  P +  SVE +EGNGGPGTIKKI+F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            E    K+V  +++ +D AN+ YSYS++ G AL +T EKI  + K+   P+GGS++K+S  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            YH+KGD     + +KA K K ++L++AVE+YLLA+
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155

Sequence Alignment: 109. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 127.2 bits 476,  Expect = 2e-31
 Identities = 73/154 47%, Positives = 106/154 68%, Gaps = 0/154 0%
Query  2    GVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 61
            GVF +E +TTS +  A L+KA   + DT+ PK  P +  SVE +EGNGGPGTIKKI+F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKY 121
                K+V  +++ +D AN+ YSYS++ G AL +T EKI  + K+   P+GGS++K+S  Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  122  HTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            H+KGD     + +KA K K ++L++AVE+YLLA+
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154

Sequence Alignment: 110. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 122.9 bits 459,  Expect = 4e-30
 Identities = 67/159 42%, Positives = 102/159 64%, Gaps = 0/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV  +  E+T+ I   RLFK ++L+ D+L+PK+  + + S+E +EG+GG G+IK++ F 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EG P KY+K ++  +D  N+   YS+IEG  LGD LE I  ++K  A  DGG + K + +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159
            YHTKGD+ +  E     K K   L++A+E+YLLA+   Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 111. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 121.1 bits 452,  Expect = 1e-29
 Identities = 68/159 42%, Positives = 102/159 64%, Gaps = 0/159 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV  Y  E+T+ I   RLFKA++L+ D L+PK+  Q + + E IEG+GG G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EG P KY+K ++  +D  N++  YS+IEG  LG+ LE I  +IK  A  +GG + K + +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159
            YHTKGD+ +  E     +E+   + +AVE+YLLA+   Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 112. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 120.1 bits 448,  Expect = 3e-29
 Identities = 73/154 47%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            M VF ++ + TS +  A L+ A+  + D +IPK A  +  SVE +EGNGGPGTIKKI+F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            E    K+V  +++ VD AN+ YSYS++ G AL DT EKI  + KI    DGGS++K++  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            YH KGD     + +KA K K +AL++AVE+YLLA+
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLAN 154

Sequence Alignment: 113. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 119.9 bits 447,  Expect = 3e-29
 Identities = 66/153 43%, Positives = 104/153 67%, Gaps = 2/153 1%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV  +E E+TS +P A+LFKA +++GD L PK+ P AI S+E +EGNGGPGT+KK+T  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            E     YV  ++D +D A + Y Y++  G  + + LEK+  + K+ A  DGGS +K+S  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAA-DGGSKIKVSVT 118
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            +HTKGD  +  E  + +K+K + +++A+E Y+L++
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 114. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 113.8 bits 423,  Expect = 2e-27
 Identities = 66/154 42%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV  +  E TS + A ++F+ F+++ DT++PK AP A  SVE I+G+GGPGT+K IT+P
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            +G P   +  R+D V+   + + YS+I+G  L   +E I N + +V T DGGSI K +  
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            +HTKGD  +  E++K   E+  AL++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 115. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 110.8 bits 411,  Expect = 2e-26
 Identities = 64/155 41%, Positives = 101/155 65%, Gaps = 0/155 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV   E   TS +PAA+LFKA+ L+ DTL+P+V P AI   E +EG+GG GT+K +T+ 
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            + SP+K +K+++D +D   F +SYS+I+G  L   ++ I N +  V T DGG     +  
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            ++TKGD  +  E++K   ++   +++AVE+YLLA+
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 116. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 109.2 bits 405,  Expect = 6e-26
 Identities = 62/142 43%, Positives = 92/142 64%, Gaps = 1/142 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV  Y  E+T+ I   RLFKA++L+ D L+PK+  Q + + E IEG+GG G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EG P KY+K ++  +D  N++  YS+IEG  LG+ LE I  +IK  A  +GG + K + +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGDQEM-KAEHMKAIKEKGE 142
            YHTKGD+ + + EH    +E  E
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHE 143

Sequence Alignment: 117. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 108.2 bits 401,  Expect = 1e-25
 Identities = 64/154 41%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV     E  S + A ++++ F+L+ DT+ PKV PQ I SVE +EG+GG GT+K + + 
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            E + +  +K++VD +D A + Y+Y+ I G  L D LE + NE  +V T DGG I+K +  
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPT-DGGCIVKNTTI 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            Y+TKGD  +  + +K   EK    ++AVE+YLLA+
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 118. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 108.0 bits 400,  Expect = 1e-25
 Identities = 58/152 38%, Positives = 96/152 63%, Gaps = 0/152 0%
Query  7    ESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGSPFK 66
            E E TS +  + +FKAF+++ DT+ PK  P+   S++ IEG+GG GTIK IT+ +G PF 
Sbjct  5    EFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFT 64
Query  67   YVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHTKGD 126
              K +VD +D  NF  SY++ EG  L   +E   + +K + + DGGS+ K S  +  KGD
Sbjct  65   SSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGD 124
Query  127  QEMKAEHMKAIKEKGEALLRAVESYLLAHSDA 158
             ++  E++  +KE  +  ++A+E+Y+++H +A
Sbjct  125  AKLTDENVSLMKEGLKKTFKAIETYVISHPEA 156

Sequence Alignment: 119. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 106.2 bits 393,  Expect = 4e-25
 Identities = 62/154 40%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MGV   E E  S + A ++++ F+L+ DT+ PKV PQ I SVE +EG+GG GT++ + + 
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            E + +  +K++VD +D A + Y+Y+ I G  L + LE + N+  +V T DGG I+K +  
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQFVVVPT-DGGCIVKNTTI 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            Y+TKGD  +  + +K   EK    ++AVE+YLLA+
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 120. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 106.2 bits 393,  Expect = 4e-25
 Identities = 62/154 40%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MG  ++  E TS + A ++F   +L+ DT+IPK AP A  SV+ ++G+GG GT++ IT+P
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSP   +  R D V+   + Y  ++I+G  L   +E I   + +V T DGGSI K +  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            +HTKGD  +  E++K   E+  AL++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 105.5 bits 390,  Expect = 7e-25
 Identities = 62/154 40%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MG  ++  E TS + A ++F   +L+ DT+IPK AP A  SVE ++G+GG GT++ IT+P
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSP   +  R D V+   + Y  ++I+G  L   +E I   + +V T DGGSI K +  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            +HTKGD  +  E++K    +  AL++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 105.2 bits 389,  Expect = 8e-25
 Identities = 61/154 39%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MG  ++  E TS + A ++F   +L+ DT+IPK AP A  SV+ ++G+GG GT++ IT+P
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSP   +  R D V+   + Y  ++I+G  L + +E I   + +V T DGGSI K +  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            +HTKGD  +  E++K    +  AL++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 104.7 bits 387,  Expect = 1e-24
 Identities = 61/154 39%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MG  ++  E TS + A ++F   +L+ DT+IPK AP A  SV+ ++G+GG GT++ IT+P
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 73
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSP   +  R D V+   + Y  ++I+G  L + +E I   + +V T DGGSI K +  
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            +HTKGD  +  E++K    +  AL++A+E+YL+A+
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 124. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 103.0 bits 380,  Expect = 4e-24
 Identities = 61/154 39%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
            MG  ++  E TS + A ++F   +L+ DT+IPK A  A  SVE ++G+GG GT++ IT+P
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            EGSP   +  R D V+   + Y  ++I+G  L   +E I   + +V T DGGSI K +  
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            +HTKGD  +  E++K    +  AL++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 74.0 bits 264,  Expect = 1e-15
 Identities = 50/89 56%, Positives = 63/89 70%, Gaps = 17/89 19%
Query  55   KKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSI 114
            KKITF EGS + YVK                 +EG AL DTLEKI  E K+V+ P   +I
Sbjct  12   KKITFGEGSQYGYVK-----------------VEGDALSDTLEKIDYETKLVSAPSSSTI 54
Query  115  LKISNKYHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +K ++KYHTKGD E+K EH+KA KEK   L++ +E YL  H   YN
Sbjct  55   IKTTSKYHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 61.0 bits 210,  Expect = 6e-12
 Identities = 34/50 68%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  2    GVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGP 51
            GVF +ES+ TSVI  ARLFKA+ L+ D LI KV PQAI S E IEGNGGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 61.1 bits 214,  Expect = 2e-11
 Identities = 49/143 34%, Positives = 73/143 51%, Gaps = 9/143 6%
Query  4    FNYESETTSVIPA--ARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITF-P 60
            FN ++E +  + A  A L K FI    T++PKV P+ +  V+ IEG+GG GTI    F P
Sbjct  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
Query  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
            E SP  Y +E + E D ++ +    +IEGG L   L       K+    +  +++ +   
Sbjct  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
Query  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYL 152
            Y    D E K    K   +     LR +E YL
Sbjct  120  YDHDSDIEEKVTPTKT-SQSTLMYLRRLERYL 150

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 38.1 bits 117,  Expect = 2e-05
 Identities = 18/24 75%, Positives = 21/24 87%, Gaps = 0/24 0%
Query  2    GVFNYESETTSVIPAARLFKAFIL 25
            GVF +ES+ TSVIP ARLFKAF+L
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.