The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK
YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA54483 Bet v 1.0103 160 1031 229.2 4.2e-62
CAA54487 Bet v 1.0106 160 1017 226.2 3.3e-61
CAA54484 Bet v 1.0104 160 1011 224.9 8.2e-61
CAB02159 Bet v 1.0112 160 997 221.9 6.5e-60
CAB02156 Bet v 1.0109 160 996 221.7 7.6e-60
CAA33887 Bet v 1.0101 160 995 221.5 8.8e-60
CAA04827.1 Bet v 1.0116 159 994 221.3 1e-59
CAB02161 Bet v 1.0114 160 984 219.1 4.5e-59
CAB02160 Bet v 1.0113 160 983 218.9 5.2e-59
CAB02155 Bet v 1.0108 160 983 218.9 5.2e-59
CAA07323.1 Bet v 1.0117 160 982 218.7 6.1e-59
CAB02157 Bet v 1.0110 160 976 217.4 1.5e-58
CAB02158 Bet v 1.0111 160 975 217.2 1.7e-58
CAA96547 Bet v 1.0115 160 973 216.8 2.3e-58
CAA54489 Bet v 1.0107 160 966 215.3 6.6e-58
CAA54482 Bet v 1.0102 160 964 214.8 8.8e-58
CAA54485 Bet v 1.0105 160 962 214.4 1.2e-57
CAA07329.1 Bet v 1.0118 160 945 210.8 1.5e-56
P43186 Bet v 1.0204 160 917 204.8 9.6e-55
CAA04828.1 Bet v 1.0206 159 912 203.7 2e-54
Q39427 Bet v 1.0205 160 909 203.0 3.1e-54
ABC41615.1 Bet v 1.0119 150 908 202.8 3.4e-54
CAA54421 Bet v 1.0201 160 907 202.6 4.2e-54
P43184 Bet v 1.0203 160 904 202.0 6.6e-54
CAA54481 Bet v 1.0202 160 895 200.0 2.5e-53
CAA96548 Cor a 1.0201 160 878 196.4 3.2e-52
AAB24432 Aln g 1 160 855 191.5 9.6e-51
P38948 Aln g 1 159 848 190.0 2.7e-50
ACF75030.1 Bet v 1.0207 150 843 188.9 5.3e-50
CAB02217 Car b 1.0302 161 831 186.3 3.4e-49
CAB02216 Car b 1.0301 161 806 181.0 1.4e-47
ABZ81044 Car b 1.0113 160 794 178.4 8.4e-47
CAB02207 Car b 1.0104 160 793 178.2 9.7e-47
CAB02206 Car b 1.0103 160 792 178.0 1.1e-46
ABZ81040 Car b 1.0109 160 786 176.7 2.7e-46
P38950 Car b 1 159 785 176.5 3.2e-46
CAA54696.1 Bet v 1.0301 160 784 176.2 3.7e-46
ABZ81042 Car b 1.0111 160 782 175.8 5e-46
CAA50325 Cor a 1.0103 160 782 175.8 5e-46
ABZ81043 Car b 1.0112 160 782 175.8 5e-46
ABZ81041 Car b 1.0110 160 781 175.6 5.8e-46
ADK39021 Ost c 1.0101 160 781 175.6 5.8e-46
CAA50328 Cor a 1.0102 160 780 175.4 6.7e-46
CAB02208 Car b 1.0105 160 780 175.4 6.7e-46
CAA50327 Cor a 1.0101 160 773 173.9 1.9e-45
CAB02209 Car b 1.0106 160 770 173.2 3e-45
CAB02213 Car b 1.0107 160 768 172.8 4e-45
P38949 Car b 1 159 767 172.6 4.6e-45
Q08407 Cor a 1 159 766 172.4 5.3e-45
CAA47357 Car b 1.0102 159 764 171.9 7.2e-45
CAB02215 Car b 1.0108 160 758 170.7 1.8e-44
CAA50326 Cor a 1.0104 160 754 169.8 3.2e-44
CAA96549 Cor a 1.0301 160 743 167.4 1.6e-43
AAD48405 Cor a 1.0401 161 726 163.8 2.1e-42
AAG40331 Cor a 1.0404 161 723 163.1 3.2e-42
AAG40329 Cor a 1.0402 161 719 162.3 5.9e-42
AAG40330 Cor a 1.0403 161 716 161.6 9.2e-42
CAD10374 Cas s 1 160 707 159.7 3.5e-41
APD76154 Jug r 5.0101 160 693 156.7 2.8e-40
CAA96535 Mal d 1.0401 160 685 155.0 9.1e-40
CAA96536 Mal d 1.0402 160 684 154.8 1.1e-39
ACJ23864 Fag s 1.0101 160 683 154.6 1.2e-39
CAA96537 Mal d 1.0403 160 672 152.2 6.3e-39
O24248 Pru av 1 160 649 147.3 1.9e-37
Q2I6V8 Pru p 1.0101 160 645 146.4 3.5e-37
CAA96534 Mal d 1.0301 159 637 144.7 1.1e-36
O50001 Pru ar 1 160 632 143.6 2.4e-36
ABZ81046 Que a 1.0301 160 626 142.3 5.9e-36
AAO25113 Mal d 1.0304 159 623 141.7 9.1e-36
AAK13027 Mal d 1.0302 159 622 141.5 1.1e-35
AUH28179 Que m 1.0101 160 610 138.9 6.3e-35
AAK13028 Mal d 1.0303 159 608 138.5 8.5e-35
QOL10866 Que ac 1.0101 159 603 137.4 1.8e-34
AAB01362 Mal d 1.0201 159 601 137.0 2.4e-34
AAD26545 Mal d 1.0202 159 601 137.0 2.4e-34
QGS84240 Que i 1.0101 159 600 136.8 2.8e-34
AAD26546 Mal d 1.0103 159 598 136.3 3.7e-34
B6CQS9 Pru du 1.0101 160 598 136.3 3.8e-34
Q256S7 Fra a 1 160 598 136.3 3.8e-34
AAD26548 Mal d 1.0204 159 597 136.1 4.3e-34
AAD29671 Mal d 1.0108 159 596 135.9 5e-34
AAD13683 Mal d 1.0206 159 596 135.9 5e-34
Q3T923 Fra a 1 160 596 135.9 5.1e-34
AAK13030 Mal d 1.0207 159 595 135.7 5.9e-34
AAD26547 Mal d 1.0203 159 595 135.7 5.9e-34
CAA88833 Mal d 1.0102 159 595 135.7 5.9e-34
O65200 Pyr c 1 159 595 135.7 5.9e-34
AAD26552 Mal d 1.0104 159 595 135.7 5.9e-34
AAD26558 Mal d 1.0205 159 593 135.3 7.9e-34
AFN42528 Can s 5.0101 161 593 135.3 8e-34
AAD26555 Mal d 1.0107 159 592 135.1 9.1e-34
Q256S2 Fra a 1 160 592 135.1 9.2e-34
CAA58646 Mal d 1.0101 159 591 134.8 1.1e-33
AAD26553 Mal d 1.0105 159 590 134.6 1.2e-33
AAD26554 Mal d 1.0106 159 590 134.6 1.2e-33
Q256S6 Fra a 1 160 589 134.4 1.4e-33
CAD32318 Mal d 1.0208 158 588 134.2 1.6e-33
ABZ81045 Que a 1.0201 159 587 134.0 1.9e-33
ABZ81047 Que a 1.0401 160 586 133.8 2.2e-33
AAK13029 Mal d 1.0109 159 585 133.6 2.6e-33
Q256S4 Fra a 1 159 577 131.8 8.5e-33
CAM31908 Act c 8.0101 159 504 116.2 4.4e-28
CAM31909 Act d 8.0101 157 496 114.5 1.4e-27
CAA42646 Gly m 4 158 496 114.5 1.4e-27
Q0Z8U9 Rub i 1.0101 137 492 113.7 2.2e-27
CAA43637 Pha v 1 156 471 109.1 5.8e-26
AAQ91847 Ara h 8.0101 157 467 108.2 1.1e-25
P25985 Pha v 1 155 464 107.6 1.6e-25
CAA43636 Pha v 1 155 464 107.6 1.6e-25
AHC08073 Sola l 4.0101 160 464 107.6 1.7e-25
NP_001275580 Sola l 4.0201 160 446 103.7 2.5e-24
Q2VU97 Vig r 1.0101 155 430 100.3 2.6e-23
CAA75803 Lyc e 4.0101 178 418 97.7 1.8e-22
EF436550 Ara h 8.0201 153 411 96.2 4.2e-22
P49372 Api g 1 154 408 95.6 6.7e-22
CAA67246 Pet c PR10 155 395 92.8 4.6e-21
P92918 Api g 1.0201 159 389 91.5 1.2e-20
AAB92255 Tar o RAP 157 384 90.4 2.4e-20
AAL76932 Dau c 1.0201 154 381 89.8 3.7e-20
CAB03716 Dau c 1.0104 154 371 87.7 1.6e-19
CAB06416 Dau c 1.0105 154 368 87.0 2.6e-19
BAA13604 Dau c 1.0102 154 367 86.8 3e-19
AAB01092 Dau c 1.0101 168 365 86.4 4.4e-19
CAB03715 Dau c 1.0103 154 358 84.9 1.1e-18
Q5ULZ4 Fra a 1.0101 100 247 61.2 9.8e-12
P85126 Que a 1.0101 50 215 54.5 5e-10
Q9ZWP8 Vig r 6.0101 155 195 49.9 3.8e-08
Q9S8Q4 Cas s 1 24 114 33.1 0.00068
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 229.2 bits 1031,  Expect = 4e-62
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 2. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 226.2 bits 1017,  Expect = 3e-61
 Identities = 158/160 98%, Positives = 158/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFKYVK RVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 3. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 224.9 bits 1011,  Expect = 8e-61
 Identities = 157/160 98%, Positives = 157/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE EATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFKYVK RVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 4. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 221.9 bits 997,  Expect = 7e-60
 Identities = 152/160 95%, Positives = 158/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG+PFKYVK RVDEVDHTNFKY+YSVIEGGP+GDTLEKISNEIKIVATP+GGSILKI+NK
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 5. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 221.7 bits 996,  Expect = 8e-60
 Identities = 153/160 95%, Positives = 157/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFKYVK RVDEVDHTNFKY+YSVIEGGPVGDTLEKISNEIKIVATP+GGSILKI+NK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 6. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 221.5 bits 995,  Expect = 9e-60
 Identities = 152/160 95%, Positives = 157/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFKYVK RVDEVDHTNFKY+YSVIEGGP+GDTLEKISNEIKIVATP+GGSILKI+NK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 7. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 221.3 bits 994,  Expect = 1e-59
 Identities = 153/159 96%, Positives = 157/159 98%, Gaps = 0/159 0%
Query  2    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNKY 121
            GIPFKYVK RVDEVDH NFKYSYS+IEGGPVGDTLEKISNEIKIVATP+GGSILKI+NKY
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            HTKGDHEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 8. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 219.1 bits 984,  Expect = 5e-59
 Identities = 151/160 94%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFKYVK RVDEVDHTNFKY+YSVIEGGP+GDTLEKISNEIKIVATP+GGSILKI+NK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHEVKAEQ+KASKEM ETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 9. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 218.9 bits 983,  Expect = 5e-59
 Identities = 151/160 94%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFKYVK RVDEVDHTNFKY+YSVIEGGP+GDTLEKISNEIKIVATP+GGSILKI+NK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 10. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 218.9 bits 983,  Expect = 5e-59
 Identities = 150/160 93%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFKYVK RVDEVDHTNFKY+YSVIEGGPVGDTLEKISNEIKIVATP+GG +LKI+NK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 11. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 218.7 bits 982,  Expect = 6e-59
 Identities = 149/160 93%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFKYVK RVDEVDHTNFKY+YSVIEGGP+GDTLEKISNEIKIVATP+GG +LKI+NK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 12. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 217.4 bits 976,  Expect = 1e-58
 Identities = 148/160 92%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFKYVK RVDEVDHTNFKY+YSVIEGGP+GD LEKISNEIKIVATP+GG +LKI+NK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 13. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 217.2 bits 975,  Expect = 2e-58
 Identities = 148/160 92%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
             G+PFKYVK RVDEVDHTNFKY+YSVIEGGP+GDTLEKISNEIKIVATP+GG +LKI+NK
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 14. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 216.8 bits 973,  Expect = 2e-58
 Identities = 151/160 94%, Positives = 154/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFKYVK RVDEV H NFKYSYSVIEGGP+GDTLEKISNEIKIVATP+G SILKI+NK
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 15. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 215.3 bits 966,  Expect = 7e-58
 Identities = 147/160 91%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETEATSVIPAAR+FKAFILDGD L PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFKYVK RVDEVDHTNFKY+YSVIEGGPVGDTLEKISNEIKIVATP+GG +LKI+NK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 16. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 214.8 bits 964,  Expect = 9e-58
 Identities = 147/160 91%, Positives = 154/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E TSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFKYVK RVDEVDHTNFKY+YSVIEGGPVGDTLEKISNEIKIVATP+GG +LKI+NK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 17. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 214.4 bits 962,  Expect = 1e-57
 Identities = 146/160 91%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE+E TSVIPAARLFKAFIL+GDNL PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFKYVK RVDEVDHTNFKY+YSVIEGGPVGDTLEKISNEIKIVATP+GG +LKI+NK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 18. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 210.8 bits 945,  Expect = 1e-56
 Identities = 144/160 90%, Positives = 153/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFKYVK RVDEVDHTNFKY+YSVIEGGP+GDTLEKISNEIK+VATP+GGSIL+I+NK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 19. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 204.8 bits 917,  Expect = 1e-54
 Identities = 141/160 88%, Positives = 150/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE+E TSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFKYVK RVDEVDH NFKYSYS+IEGG +GDTLEKI NEIKIVATP+GGSILKI+NK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 20. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 203.7 bits 912,  Expect = 2e-54
 Identities = 140/159 88%, Positives = 150/159 94%, Gaps = 0/159 0%
Query  2    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYE+E TSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKI+FPE
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNKY 121
            G PFKYVK RVDEVDH NFKYSYS+IEGG +GDTLEKI NEIK+VATP+GGSILKI+NKY
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            HTKGDHE+KAE++KA KE GETLLRAVESYLLAHSDAYN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 21. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 203.0 bits 909,  Expect = 3e-54
 Identities = 140/160 87%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFKYVK RVDEVDH NFKYSYS+IEGG +GDTLEKI NEIK+VATP+GGSILKI+NK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHE+KAE++KA KE  E LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 22. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 202.8 bits 908,  Expect = 3e-54
 Identities = 139/150 92%, Positives = 146/150 97%, Gaps = 0/150 0%
Query  4    FNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGI 63
            FNYETE TSVIPAARLFKAFILDGDNLFPKVAPQAISSV+NIEGNGGPGTIKKI+FPEG 
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   PFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNKYHT 123
            PFKYVK RVDEVDHTNFKY+YSVIEGGPVGDTLEKISNEIKIVATP+GG ILKI+NKYHT
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  124  KGDHEVKAEQIKASKEMGETLLRAVESYLL 153
            KG+HEVKAEQ+KASKEMGETLLRAVESYLL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 23. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 202.6 bits 907,  Expect = 4e-54
 Identities = 140/160 87%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPAARLFKAFIL+GD L PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFKYVK RVDEVDH NFKYSYS+IEGG +GDTLEKI NEIKIVATP+GGSILKI+NK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 24. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 202.0 bits 904,  Expect = 7e-54
 Identities = 139/160 86%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE+E TSVIPAARLFKAFIL+GD L PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFKYVK RVDEVDH NFKYSYS+IEGG +GDTLEKI NEIKIVATP+GGSILKI+NK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 25. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 200.0 bits 895,  Expect = 3e-53
 Identities = 138/160 86%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE+E TSVIPAARLFKAFIL+GD L PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFKYVK RVDEVDH NFKYSYS+IEGG +GDTLEKI NEIKIVATP+GGSILKI+NK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD+E+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 26. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 196.4 bits 878,  Expect = 3e-52
 Identities = 134/160 83%, Positives = 147/160 91%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE+TSVIPAARLFKAFILDG+NL PKVAPQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFKYVK RV+EVDHTNFKYSY+VIEGGPVGD +EKI NEIKIVA P+GGSILKI+NK
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHEV AE+IK  KE  E L+RAVE+YLLAHSDAYN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 27. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 191.5 bits 855,  Expect = 1e-50
 Identities = 130/160 81%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E  SVIPAARLFKAFILDGD L+PKVAP+A+SSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFKYVK RVDEVD  NFKYS+SVIEGG VGD LEK+ NEIKIVA P+GGSILKI+NK
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +HTKGDHE+ AEQIK  KE    LL+AVESYLLAHSDAYN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 28. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 190.0 bits 848,  Expect = 3e-50
 Identities = 129/159 81%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  2    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYE E  SVIPAARLFKAFILDGD L+PKVAP+A+SSVENIEGNGGPGTIKKI+FPE
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNKY 121
            G PFKYVK RVDEVD  NFKYS+SVIEGG VGD LEK+ NEIKIVA P+GGSILKI+NK+
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            HTKGDHE+ AEQIK  KE    LL+AVESYLLAHSDAYN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 29. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 188.9 bits 843,  Expect = 5e-50
 Identities = 130/150 86%, Positives = 140/150 93%, Gaps = 0/150 0%
Query  4    FNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGI 63
            FNYE+E TSVIPAARLFKAFIL+GDNL PKVAPQAISSVENIEGNGGPGTIKKI+FPEG 
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   PFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNKYHT 123
            PFKYVK RVDEVDH NFKYSYS+IEGG +GDTLEKI NEIKIVATP+GGSILKI+NKYHT
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  124  KGDHEVKAEQIKASKEMGETLLRAVESYLL 153
            KGDHE+KAE++KA KE GE LLRAVESYLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 30. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 186.3 bits 831,  Expect = 3e-49
 Identities = 127/160 79%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E TSVIPAARLFKAFILDG+NL PKVAPQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG P KYVK RV+EVDHTNFKYSY+VIEGGPVGD +EKI NEIKIVA P+GGSILKI +K
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHEV AE+IK  KE  E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 31. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 181.0 bits 806,  Expect = 1e-47
 Identities = 124/160 77%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E TSVIPAARLFKAFILDG+ L PKV+PQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG P KYVK RV+EVDHTNFKYSY+VIEGG VGD +EKI NEIKIVA P+GGSILKI +K
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHEV AE+IK  KE  E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 32. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 178.4 bits 794,  Expect = 8e-47
 Identities = 118/160 73%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EGIPFK+VK RVDEVD+ NFKYSY+VIEG  +GD LEK+S+E+KIVA P GGSI+KI++K
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 33. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 178.2 bits 793,  Expect = 1e-46
 Identities = 117/160 73%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFK+VK RVDEVD+ NFKY+Y+VIEG  +GD LEK+S+E+KIVA P GGSI+KI++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 34. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 178.0 bits 792,  Expect = 1e-46
 Identities = 117/160 73%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFK+VK RVDEVD+ NFKY+Y+VIEG  +GD LEK+S+E+KIVA P GGSI+KI++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 35. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 176.7 bits 786,  Expect = 3e-46
 Identities = 117/160 73%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFK+VK RVDEVD+ NFKY+Y+VIEG  +GD LEK+S+E+KIVA P GGSILKI++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 36. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 176.5 bits 785,  Expect = 3e-46
 Identities = 117/159 73%, Positives = 138/159 86%, Gaps = 0/159 0%
Query  2    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYE E TSVIPAARLFKAFILDG+ L PKV+PQA+SSVEN+EGNGGPGTIKKI+F E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNKY 121
            G P KYVK RV+E+DHTNFKY+Y+VIEG  +GD LEK+S+E+KIVA P GGSI+KI++K+
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            H KG HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 37. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 176.2 bits 784,  Expect = 4e-46
 Identities = 118/160 73%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE EATSVI  ARLFK+F+LD DNL PKVAP+ +SS ENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  FKY+K RVDE+DH NFKY YS+IEGGP+GDTLEKIS EIKIVA P GGSILKI +K
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD  +  E+IKA KE G  L++AVE+YL+AH +AYN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 38. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 175.8 bits 782,  Expect = 5e-46
 Identities = 116/160 72%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFK+VK RVDEVD+ NFKY+Y+VIEG  +GD LEK+S+E+KIVA P GGSI+KI++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 39. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 175.8 bits 782,  Expect = 5e-46
 Identities = 117/160 73%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E TSVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  +KYVK RVDEVD+TNF YSY+VIEG  +GD LEK+ +E+KIVA P GGSILKI++K
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHE+ AE+IK +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 40. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 175.8 bits 782,  Expect = 5e-46
 Identities = 116/160 72%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFK+VK RVDEVD+ NFKY+Y+VIEG  +GD LEK+S+E+KIVA P GGSI+KI++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 41. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 175.6 bits 781,  Expect = 6e-46
 Identities = 115/160 71%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFK+VK RVDEVD+ NFKY+Y+VIEG  +GD LEK+S+E+KIVA P GGS++KI++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 42. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 175.6 bits 781,  Expect = 6e-46
 Identities = 116/160 72%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAIS VEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFK+VK RVDEVD+ NFKY+Y+VIEG  +GD LEK+S+E+KIVA P GGSILKI++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 43. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 175.4 bits 780,  Expect = 7e-46
 Identities = 116/160 72%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  +KYVK RVDEVD+TNFKYSY+VIEG  +GD LEK+ +E+KIVA P GGSILKI++K
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 44. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 175.4 bits 780,  Expect = 7e-46
 Identities = 116/160 72%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E  SVIPAARLFK+++LD D L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFK+VK RVDEVD+ NFKY+Y+VIEG  +GD LEK+S+E+KIVA P GGSI+KI++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 45. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 173.9 bits 773,  Expect = 2e-45
 Identities = 115/160 71%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  +KYVK RVDEVD+TNF YSY+VIEG  +GD LEK+ +E+KIVA P GGSILKI++K
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 46. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 173.2 bits 770,  Expect = 3e-45
 Identities = 115/160 71%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E  SVIPAARLFK+++LD D L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFK+VK RVDEVD+ NFKY+Y+VIEG  +GD LEK+S+E+KIVA P GGSI+KI++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 47. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 172.8 bits 768,  Expect = 4e-45
 Identities = 116/160 72%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E  SVIPAARLFK+++LD D L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFK+VK RVDEVD+ NFK+SY+VIEG  +GD LEK+S E+KIVA P GGSILKI+ K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 48. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 172.6 bits 767,  Expect = 5e-45
 Identities = 114/159 71%, Positives = 135/159 84%, Gaps = 0/159 0%
Query  2    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYE E  SVIPAARLFK+++LDGD L PKVAPQ ISSVEN+ GNGGPGTIK I+F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNKY 121
            GIPFK+VK RVDEVD+ NFKY+Y+VIEG  +GD LEK+S+E+KIVA P GGSI+KI++K+
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            H KG HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 49. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 172.4 bits 766,  Expect = 5e-45
 Identities = 114/159 71%, Positives = 135/159 84%, Gaps = 0/159 0%
Query  2    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F E
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNKY 121
            G  +KYVK RVDEVD+TNF YSY+VIEG  +GD LEK+ +E+KIVA P GGSILKI++K+
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 50. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 171.9 bits 764,  Expect = 7e-45
 Identities = 114/159 71%, Positives = 135/159 84%, Gaps = 0/159 0%
Query  2    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNKY 121
            G PFK+VK RVDEVD+ NFKY+Y+VIEG  +GD LEK+S+E+KIVA P GGSI+KI++K+
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            H KG HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 51. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 170.7 bits 758,  Expect = 2e-44
 Identities = 114/160 71%, Positives = 133/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E  SV+PAARLFK+++LD D L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PFK+VK RVDEVD+ NFK+SY+VIEG  +GD LEK+S E+ IVA P GGSILKI+ K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 52. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 169.8 bits 754,  Expect = 3e-44
 Identities = 113/160 70%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E  SVI AARLFK+++LDGD L PKVAPQAI+SVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  +KYVK RVDEVD+TNFKYSY+VIEG  +GD LEK+ +E+KIVA P GGS LKI++K
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 53. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 167.4 bits 743,  Expect = 2e-43
 Identities = 114/160 71%, Positives = 130/160 81%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIP ARLFK F+LD DNL PKVAP+AI S+E IEGNGGPGTIKKI F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG PF Y+K +V+E+D+ NF Y YSVIEG  + D LEKI+ EIKIVA+P+GGSILK  +K
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHT GDHE+K EQIKA KE    L++AVE YLLAHSDAYN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 54. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 163.8 bits 726,  Expect = 2e-42
 Identities = 110/159 69%, Positives = 130/159 81%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE EATSVIP ARLFK+F+LD DNL PKVAPQ  +S EN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGG-SILKINN 119
            EG  FKY+K +V+E+DH NFKY YS+IEGGP+G TLEKIS EIK+ A P+GG SILKI +
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159
            KYHTKG+  +  E+IKA KE    L++AVE+YLLAH DAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 55. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 163.1 bits 723,  Expect = 3e-42
 Identities = 109/159 68%, Positives = 130/159 81%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF+YE EATSVIP ARLFK+F+LD DNL PKVAPQ  +S EN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGG-SILKINN 119
            EG  FKY+K +V+E+DH NFKY YS+IEGGP+G TLEKI  EIK+ A P+GG SILKI +
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159
            KYHTKG+  +  E+IKA KE    L++AVE+YLLAH DAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 56. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 162.3 bits 719,  Expect = 6e-42
 Identities = 108/159 67%, Positives = 129/159 81%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF+YE EATSVIP ARLFK+F+LD DNL PKVAPQ  +  EN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGG-SILKINN 119
            EG  FKY+K +V+E+DH NFKY YS+IEGGP+G TLEKIS EIK+ A P+GG SILKI +
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159
            KYHTKG+  +  E+IKA KE    L++AVE+YLLAH D Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 57. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 161.6 bits 716,  Expect = 9e-42
 Identities = 108/159 67%, Positives = 128/159 80%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE EATSVIP ARLFK+F+LD DNL PKVAPQ  +  EN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGG-SILKINN 119
            EG  FKY+K +V+E+DH NFKY YS+IEGGP+G TLEKIS EIK+ A P+GG SILKI +
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159
            KYHTKG+  +  E+IKA KE    L++AVE+YLLAH D Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 58. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 159.7 bits 707,  Expect = 3e-41
 Identities = 108/160 67%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF +E E TS IP  RLFKAF+LD DNL PK+AP+AI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  FKYVK R+DE+D+ NF Y YSVIEG  V + LEKIS EIKIVA+P+GGSILK  +K
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG++E+K E++ A KE    L++AVE+YLLAHSDAYN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 59. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 156.7 bits 693,  Expect = 3e-40
 Identities = 106/160 66%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YETE+TSVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  +KYVK R D +D  NF Y+YSVIEG  + D +EKIS E KIVA+  GGSILK  + 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YH+KGDHE+K E +K  KE    L++AVE YLLAH DAYN
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 60. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 155.0 bits 685,  Expect = 9e-40
 Identities = 103/160 64%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPA RLFKAFILDGDNL PK+APQAI S E IEG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK RV+ +D  NF YSYS+IEG  + D LEKI+ E K++A+P+GGSI+K  + 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YH KGD E+K E++KA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 61. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 154.8 bits 684,  Expect = 1e-39
 Identities = 103/160 64%, Positives = 127/160 79%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPA RLFKAFILDGDNL PK+APQAI S + IEG+GG GTIKK++F 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK RV+ +D  NF YSYS+IEG  + D LEKI+ E K++A+P+GGSI+K N+ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YH KGD E+K E++KA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 62. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 154.6 bits 683,  Expect = 1e-39
 Identities = 103/160 64%, Positives = 129/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+E T+VI  ARLFKAF+LD DNL PKVAPQAI S E IEG+GGPGTIKKI+F 
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  F YVK R+DE+D+ NF Y+ ++IEG  + +TLEKI+ EIK+VA+P+GGSILK  +K
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHE+K +QIKA KE    +++AVE+YLLA+  AY+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 63. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 152.2 bits 672,  Expect = 6e-39
 Identities = 102/160 63%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPA RLFKAFILDGDNL PK+APQAI S E IEG+GG GTIKK++F 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK RV+ +D  NF YSYS+IEG  + D LEKI+ E K++A+P+GGSI+K  + 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            Y  KGD E+K E++KA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 64. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 147.3 bits 649,  Expect = 2e-37
 Identities = 95/160 59%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK ++D +D  N+ YSY++IEG  +GDTLEKIS E K+VA+P+GGSI+K  + 
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E++KA KE    L++ +E+YL  H DAYN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 65. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 146.4 bits 645,  Expect = 3e-37
 Identities = 95/160 59%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK ++D +D  N  YSY++IEG  +GD LEKIS E K+VA+P+GGSI+K  + 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +E+YL  H DAYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 66. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 144.7 bits 637,  Expect = 1e-36
 Identities = 98/159 61%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA+   GS++K  + 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTK D E+K E++KA KE    L++ +E+YLLAHSDAYN
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 67. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 143.6 bits 632,  Expect = 2e-36
 Identities = 95/160 59%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YETE TSVIP  +LFKAFILD DNL PKVAP A+   E +EG+GG GTIKK++F 
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK RVD +D  N+ YSY++IEG  + D +E I+ +IK+VA+P+GGSI+K  + 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K EQ+KA KE    L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 68. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 142.3 bits 626,  Expect = 6e-36
 Identities = 95/159 59%, Positives = 119/159 74%, Gaps = 0/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+E  SVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  +K+ K R+D +D  NF YS+SVIEG  + D LE +S E KIVA+P+GGSI+K  +K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159
            Y+TKGD ++  E I+  KE    +++AVE+YL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 69. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 141.7 bits 623,  Expect = 9e-36
 Identities = 95/159 59%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA+   GS++K  + 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +E+YLL H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 70. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 141.5 bits 622,  Expect = 1e-35
 Identities = 95/159 59%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA    GS++K  + 
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +E+YLL H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 71. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 138.9 bits 610,  Expect = 6e-35
 Identities = 93/159 58%, Positives = 117/159 73%, Gaps = 0/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  YE+E  SVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  +K+ K R+D +D  NF +S+SVIEG  + D LE +S E KIVA+P+GGSI+K   K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159
            Y+TKGD ++  E I+  KE    +++AVE+YL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 72. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 138.5 bits 608,  Expect = 8e-35
 Identities = 93/159 58%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE E TSVIP ARL+ AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK ++D VD  NF Y YSVIEG  + +T+EKIS E K+VA+   GS++K  + 
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSISH 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +E+YLL H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 73. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 137.4 bits 603,  Expect = 2e-34
 Identities = 94/159 59%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+NYE++ TSVIP ARLFKAF+LD DNL  KV P+A+ S E IEGNGGPGTIKK +F 
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            E    KY K R+D +D  N  YS+SVIEG  + D +  IS E+K VA+P+GGSI+K   K
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            Y+TKG  ++K EQI+A+ E G  L++AVE+YLLAH D YN
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 74. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 137.0 bits 601,  Expect = 2e-34
 Identities = 90/159 56%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK ++D VD  N+ Y+Y++IEG  + DT+EK+S E K+VA+   GSI+K  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 75. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 137.0 bits 601,  Expect = 2e-34
 Identities = 90/159 56%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK ++D VD  N+ Y+Y++IEG  + DT+EK+S E K+VA+   GSI+K  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 76. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 136.8 bits 600,  Expect = 3e-34
 Identities = 96/158 60%, Positives = 117/158 74%, Gaps = 1/158 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  +E++ TSVIP ARLFKAF+LD DNL PKV PQAI S+E IEGNGGPGTIKKI+F 
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            E   FKY K R+D +D  N  YS+SVIEG  + D +  +S EIK VA+P+GGSI K   K
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159
            Y+TKGD ++K EQI+A+ E    L +AVE+YLLAH D Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 77. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 136.3 bits 598,  Expect = 4e-34
 Identities = 90/159 56%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK R+D +D  ++ YSY++IEG  + DT+EKIS E K+VA  +G +I  I++ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 78. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 136.3 bits 598,  Expect = 4e-34
 Identities = 87/160 54%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG+F Y  E+TSVIP  RLFKA++L+ D L PK+APQ++ S E +EG+GG GTIKKISF 
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK ++D +D  NF Y+YS++EG  + D +EKIS EIK+VA+ +GGS++K  + 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E +KA KE    L++ +E+YL+A+ DAYN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 79. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 136.3 bits 598,  Expect = 4e-34
 Identities = 88/160 55%, Positives = 114/160 71%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK ++  +D  N  YSYS+IEG  + D +EKI  E K+V+ P+GG+I+K  +K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 80. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 136.1 bits 597,  Expect = 4e-34
 Identities = 89/159 55%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK ++D VD  N+ Y+Y++IEG  + DT+EK+S E K++A+   GSI+K  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMAS-GSGSIIKSISH 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 81. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 135.9 bits 596,  Expect = 5e-34
 Identities = 90/159 56%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK R+D +D  ++ YSY++IEG  + DT+EKIS E K+VA  +G +I  I++ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 82. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 135.9 bits 596,  Expect = 5e-34
 Identities = 89/159 55%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFK F+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK ++D VD  N+ Y+Y++IEG  + DT+EK+S E K+VA+   GSI+K  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 83. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 135.9 bits 596,  Expect = 5e-34
 Identities = 86/160 53%, Positives = 114/160 71%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK ++  +D  N  YSYS+IEG  + D +EKI  E K+V+ P+GG+++K  +K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 84. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 135.7 bits 595,  Expect = 6e-34
 Identities = 89/159 55%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGT KKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK ++D VD  N+ Y+Y++IEG  + DT+EK+S E K+VA+   GSI+K  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 85. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 135.7 bits 595,  Expect = 6e-34
 Identities = 89/159 55%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK ++D VD  N+ Y+Y++IEG  + DT+EK+S E K+VA+   GSI+K  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +ES+L  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 86. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 135.7 bits 595,  Expect = 6e-34
 Identities = 89/159 55%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK R+D +D  ++ YSY++IEG  + DT+EKIS E K+VA  +G +I  I++ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATIKSISH- 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YH KG+ E+K E++K  KE G  L++ +ESYL  H DAYN
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 87. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 135.7 bits 595,  Expect = 6e-34
 Identities = 90/159 56%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG++ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK RVD +D  ++ Y+Y++IEG  + DT+EKIS E K+VA+ +G +I  I++ 
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVASGSGSTIKSISH- 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 88. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 135.7 bits 595,  Expect = 6e-34
 Identities = 90/159 56%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK R+D +D  ++ YSY++IEG  + DT+EKIS E K+VA  +G +I  I++ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 89. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 135.3 bits 593,  Expect = 8e-34
 Identities = 89/159 55%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK ++D VD  N+ Y+Y++IEG  + DT+EK+S E K+VA+   GSI+K  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++ A KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 90. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 135.3 bits 593,  Expect = 8e-34
 Identities = 86/160 53%, Positives = 123/160 76%, Gaps = 1/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+E TS I  ARLFKAF+LDGDNL PK+APQA+  VE +EGNGG GTIKKI+F 
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPV-GDTLEKISNEIKIVATPNGGSILKINN 119
            +G+PFKYVK +++ +D  ++ YSYS+IEG  + G+ LEKI++E K+VA+ +GG+++K  +
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  120  KYHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            KY++ GD +V  E++K  ++    +L+ VE+YL  H +AYN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 91. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 135.1 bits 592,  Expect = 9e-34
 Identities = 89/159 55%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK R+D +D  ++ YSY++IEG  + DT+EKIS E K+VA  +G +I  I++ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E++KA K     L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 92. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 135.1 bits 592,  Expect = 9e-34
 Identities = 86/160 53%, Positives = 114/160 71%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK ++  +D  N  YSYS+IEG  + + +EKI  E K+V+ P+GG+I+K  +K
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 93. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 134.8 bits 591,  Expect = 1e-33
 Identities = 89/159 55%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK R+D +D  ++ YSY++IEG  + DT+EKIS E K+VA  +G +I  I++ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E++K  KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 94. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 134.6 bits 590,  Expect = 1e-33
 Identities = 90/159 56%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK R+D +D  ++ YSY++IEG  + DT+EKIS E K+VA  +G +I  I++ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 95. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 134.6 bits 590,  Expect = 1e-33
 Identities = 89/159 55%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK R+D +D  ++ YSY++IEG  + DT+E IS E K+VA  +G +I  I++ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 96. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 134.4 bits 589,  Expect = 1e-33
 Identities = 87/160 54%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG + YE E TS IPA +LFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK ++  +D  N  YSYS+IEG  + D +EKI  E K+V+ P+GG+I+K  +K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 97. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 134.2 bits 588,  Expect = 2e-33
 Identities = 89/158 56%, Positives = 115/158 72%, Gaps = 1/158 0%
Query  2    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GV+ YE E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F E
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNKY 121
            G  + YVK ++D VD  N+ Y+Y++IEG  + DT+EK+S E K+VA+   GSI+K  + Y
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 119
Query  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            HTKGD E+  E++KA KE    L++ +ESYL  H DAYN
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 98. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 134.0 bits 587,  Expect = 2e-33
 Identities = 94/158 59%, Positives = 116/158 73%, Gaps = 1/158 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            E   FKY K R+D +D  N  YS+SVIEG  +   +E +S EIK VA+P+GGSI+K   K
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159
            Y+TKGD ++K EQI+A+ E    LL+AVE+YL+AH D Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 99. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 133.8 bits 586,  Expect = 2e-33
 Identities = 92/159 57%, Positives = 116/159 72%, Gaps = 0/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  +K+ K R+D +D  NF YS+SVIEG  + D LE +S E KIVA+P+GGSI K  +K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159
            Y+TKGD ++  E I+  KE    +++AVE+YL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 100. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 133.6 bits 585,  Expect = 3e-33
 Identities = 89/159 55%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK R+D +D  ++ YSY++IEG  + DT+EKIS E K+VA  +G +I  I++ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E++K  KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 101. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 131.8 bits 577,  Expect = 9e-33
 Identities = 86/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG  + YVK ++  +D  N  YSYS+IEG  + D +EKI  E K+V+ P+G +I+K  +K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +E YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 102. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 116.2 bits 504,  Expect = 4e-28
 Identities = 80/157 50%, Positives = 108/157 68%, Gaps = 0/157 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  Y+ E  S +P  +L+KAFILDGD L PKV P+AI  V+ +EG+G  GTIK+++F 
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG   K VK RVD +D  N+ YSY++IEG  + + +E IS  IKIVA P+GGSI K  + 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSD 157
            Y TKGD +V  E+IK  KE    +++A+E+YLLA+ D
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157

Sequence Alignment: 103. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 114.5 bits 496,  Expect = 1e-27
 Identities = 80/156 51%, Positives = 105/156 67%, Gaps = 1/156 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG   Y+ E  S I A ++FKAF+LDGD + PK  P+AI+ V+ +EG+GG GTIK  +F 
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG   K VK R+D +D  NF YSYS+IEGG + D +E IS  IKIVATP+GG I K  + 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSD 157
            Y  K D +V  E+IKA KE    +++ VE+YLLA+ D
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPD 156

Sequence Alignment: 104. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 114.5 bits 496,  Expect = 1e-27
 Identities = 79/158 50%, Positives = 108/158 68%, Gaps = 2/158 1%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF +E E  S +  A L+KA++ D DN+ PK A  +  SVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            E    K+V  +++ +D  N+ YSYSV+ G  + DT EKI+ + K+VA PNGGS  K+  K
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            Y TKGD E   +++K  K   + L++A+E+YLLAH D YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPD-YN 158

Sequence Alignment: 105. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 113.7 bits 492,  Expect = 2e-27
 Identities = 76/135 56%, Positives = 97/135 71%, Gaps = 1/135 0%
Query  11   TSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGIPFKYVKG 70
            TSVIP  +LFKAF+LD DNL PK+APQA+ SVE IEG+GG GT+KKI + EG    YVK 
Sbjct  2    TSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKH 61
Query  71   RVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNKYHTKGDHEVK 130
            ++D +D  NF YSYS+ EG  +GD +EKIS EIK+VA+   GSI+K  + YH KG  E+K
Sbjct  62   KIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVAS-GRGSIIKTTSHYHCKGGAEIK 120
Query  131  AEQIKASKEMGETLLR 146
             EQ+K  KE    L++
Sbjct  121  EEQVKDGKERAAGLFK 136

Sequence Alignment: 106. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 109.1 bits 471,  Expect = 6e-26
 Identities = 71/155 45%, Positives = 105/155 67%, Gaps = 0/155 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF +E + TS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            E    K+V  +++ +D  N+ YSYS++ G  + +T EKI+ + K+   PNGGS++K++  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            YH+KGD     +++KA K   ++L++AVE+YLLA+
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155

Sequence Alignment: 107. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 108.2 bits 467,  Expect = 1e-25
 Identities = 74/157 47%, Positives = 105/157 66%, Gaps = 2/157 1%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF +E E TS +P A+L+ A + D D++ PK+    + SVE +EGNGGPGTIKK++  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            E    K++  +V+ +D  N+ Y+YSV+ G  +  T EKI+ E K+V  PNGGSI K+  K
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159
            YHTKGD +   E++K  K  GE L+RA+E Y+LA+   Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 108. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 107.6 bits 464,  Expect = 2e-25
 Identities = 70/154 45%, Positives = 104/154 67%, Gaps = 0/154 0%
Query  2    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVF +E + TS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNKY 121
                K+V  +++ +D  N+ YSYS++ G  + +T EKI+ + K+   PNGGS++K++  Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            H+KGD     +++KA K   ++L++AVE+YLLA+
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154

Sequence Alignment: 109. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 107.6 bits 464,  Expect = 2e-25
 Identities = 71/154 46%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            M VF +E + TS +  A L+KA++ D D + PK A  +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            E    K+V  +++E+D  N+ YSYS++ G  + DT EKIS + K+   PNGGS++K++ K
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            YH+KGD     +++KA K   + L++ +E+YLLA+
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154

Sequence Alignment: 110. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 107.6 bits 464,  Expect = 2e-25
 Identities = 72/159 45%, Positives = 103/159 64%, Gaps = 0/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  Y  E+T+ I   RLFKA++LD DNL PK+  Q + + E IEG+GG G+IK+++F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG P KY+K ++  +D  N++  YS+IEG  +G+ LE I+ +IK  A  NGG + K   +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159
            YHTKGDH V  E+    +E    + +AVE+YLLA+   Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 111. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 103.7 bits 446,  Expect = 2e-24
 Identities = 67/159 42%, Positives = 102/159 64%, Gaps = 0/159 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  +  E+T+ I   RLFK ++LD D+L PK+  + + S+E +EG+GG G+IK+++F 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG P KY+K ++  +D  N+   YS+IEG  +GD LE I+ ++K  A  +GG + K   +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159
            YHTKGDH V  E+    K     L++A+E+YLLA+   Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 112. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 100.3 bits 430,  Expect = 3e-23
 Identities = 70/154 45%, Positives = 101/154 65%, Gaps = 1/154 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            M VF ++ +ATS +  A L+ A+  D DN+ PK A  +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            E    K+V  +++ VD  N+ YSYS++ G  + DT EKI+ + KI    +GGS++K+   
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            YH KGD     +++KA K   + L++AVE+YLLA+
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLAN 154

Sequence Alignment: 113. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 97.7 bits 418,  Expect = 2e-22
 Identities = 64/150 42%, Positives = 93/150 62%, Gaps = 0/150 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  Y  E+T+ I   RLFKA++LD DNL PK+  Q + + E IEG+GG G+IK+++F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG P KY+K ++  +D  N++  YS+IEG  +G+ LE I+ +IK  A  NGG + K   +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVES 150
            YHTKGDH V  E+    +      ++   S
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQGCRS 150

Sequence Alignment: 114. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 96.2 bits 411,  Expect = 4e-22
 Identities = 63/153 41%, Positives = 101/153 66%, Gaps = 2/153 1%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  +E E+TS +P A+LFKA ++DGD L PK+ P AI S+E +EGNGGPGT+KK++  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            E     YV  ++D +D   + Y Y++  G    + LEK+S + K+ A  +GGS +K++  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAA-DGGSKIKVSVT 118
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            +HTKGD  +  E  +  K+  + +++A+E Y+L++
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 115. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 95.6 bits 408,  Expect = 7e-22
 Identities = 65/154 42%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  +  E TS + A ++F+ F++D D ++PK AP A  SVE I+G+GGPGT+K I++P
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            +G P   +  R+D V+   + + YSVI+G  +   +E I N + +V T +GGSI K    
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            +HTKGD  V  E IK + E    L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 116. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 92.8 bits 395,  Expect = 5e-21
 Identities = 62/155 40%, Positives = 97/155 62%, Gaps = 0/155 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV   E   TS +PAA+LFKA+ LD D L+P+V P AI   E +EG+GG GT+K +++ 
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            +  P+K +K ++D +D   F +SYS+I+G  +   ++ I+N +  V T +GG        
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            ++TKGD  V  E IK + +    +++AVE+YLLA+
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 117. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 91.5 bits 389,  Expect = 1e-20
 Identities = 63/154 40%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV     EA S + A ++++ F+LD D +FPKV PQ I SVE +EG+GG GT+K + + 
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            E   +  +K +VD +D   + Y+Y+ I G  + D LE + NE  +V T +GG I+K    
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPT-DGGCIVKNTTI 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            Y+TKGD  +  ++IK + E     ++AVE+YLLA+
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 118. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 90.4 bits 384,  Expect = 2e-20
 Identities = 54/152 35%, Positives = 95/152 62%, Gaps = 0/152 0%
Query  7    ETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGIPFK 66
            E E TS +  + +FKAF++D D + PK  P+   S++ IEG+GG GTIK I++ +G+PF 
Sbjct  5    EFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFT 64
Query  67   YVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNKYHTKGD 126
              K +VD +D  NF  SY++ EG  +   +E  ++ +K + + +GGS+ K +  +  KGD
Sbjct  65   SSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGD 124
Query  127  HEVKAEQIKASKEMGETLLRAVESYLLAHSDA 158
             ++  E +   KE  +  ++A+E+Y+++H +A
Sbjct  125  AKLTDENVSLMKEGLKKTFKAIETYVISHPEA 156

Sequence Alignment: 119. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 89.8 bits 381,  Expect = 4e-20
 Identities = 60/154 38%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV   E EA S + A ++++ F+LD D +FPKV PQ I SVE +EG+GG GT++ + + 
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            E   +  +K +VD +D   + Y+Y+ I G  + + LE + N+  +V T +GG I+K    
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQFVVVPT-DGGCIVKNTTI 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            Y+TKGD  +  +++K + E     ++AVE+YLLA+
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 120. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 87.7 bits 371,  Expect = 2e-19
 Identities = 59/154 38%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG  ++  E TS + A ++F   +LD D + PK AP A  SV+ ++G+GG GT++ I++P
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG P   +  R D V+   + Y  +VI+G  +   +E I   + +V T +GGSI K    
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            +HTKGD  V  E IK + E    L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 87.0 bits 368,  Expect = 3e-19
 Identities = 59/154 38%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG  ++  E TS + A ++F   +LD D + PK AP A  SVE ++G+GG GT++ I++P
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG P   +  R D V+   + Y  +VI+G  +   +E I   + +V T +GGSI K    
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            +HTKGD  V  E IK +      L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 86.8 bits 367,  Expect = 3e-19
 Identities = 58/154 37%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG  ++  E TS + A ++F   +LD D + PK AP A  SV+ ++G+GG GT++ I++P
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG P   +  R D V+   + Y  +VI+G  + + +E I   + +V T +GGSI K    
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            +HTKGD  V  E IK +      L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 86.4 bits 365,  Expect = 4e-19
 Identities = 58/154 37%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG  ++  E TS + A ++F   +LD D + PK AP A  SV+ ++G+GG GT++ I++P
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 73
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG P   +  R D V+   + Y  +VI+G  + + +E I   + +V T +GGSI K    
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            +HTKGD  V  E IK +      L++A+E+YL+A+
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 124. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 84.9 bits 358,  Expect = 1e-18
 Identities = 58/154 37%, Positives = 90/154 58%, Gaps = 1/154 0%
Query  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG  ++  E TS + A ++F   +LD D + PK A  A  SVE ++G+GG GT++ I++P
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            EG P   +  R D V+   + Y  +VI+G  +   +E I   + +V T +GGSI K    
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            +HTKGD  V  E IK +      L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 61.2 bits 247,  Expect = 1e-11
 Identities = 52/100 52%, Positives = 69/100 69%, Gaps = 39/100 39%
Query  22   AFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGIPFKYVKGRVDEVDHTNFK 81
            AF+LD DNL PK                      KI+F EG  + YVK            
Sbjct  1    AFVLDADNLIPK----------------------KITFGEGSQYGYVK------------ 26
Query  82   YSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKASKEMG 141
                 +EG  + DTLEKI  E K+V+ P+  +I+K  +KYHTKGD E+K E++KA KE  
Sbjct  27   -----VEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 81
Query  142  ETLLRAVESYLLAHSDAYN 160
              L++ +E YL  H   YN
Sbjct  82   AHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 54.5 bits 215,  Expect = 5e-10
 Identities = 34/50 68%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  2    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGP 51
            GVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 49.9 bits 195,  Expect = 4e-08
 Identities = 48/143 33%, Positives = 70/143 48%, Gaps = 9/143 6%
Query  4    FNYETEATSVIPA--ARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISF-P 60
            FN +TE +  + A  A L K FI     + PKV P+ +  V+ IEG+GG GTI   +F P
Sbjct  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
Query  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
            E  P  Y +  + E D ++ +    VIEGG +   L       K+       +++ +   
Sbjct  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYL 152
            Y    D E K    K S+      LR +E YL
Sbjct  120  YDHDSDIEEKVTPTKTSQST-LMYLRRLERYL 150

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 33.1 bits 114,  Expect = 0.0007
 Identities = 17/24 70%, Positives = 21/24 87%, Gaps = 0/24 0%
Query  2    GVFNYETEATSVIPAARLFKAFIL 25
            GVF +E++ TSVIP ARLFKAF+L
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.