The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG
EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY
HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA96534 Mal d 1.0301 159 1006 269.4 3.3e-74
AAO25113 Mal d 1.0304 159 979 262.3 4.5e-72
AAK13027 Mal d 1.0302 159 972 260.5 1.6e-71
AAK13028 Mal d 1.0303 159 948 254.2 1.2e-69
O24248 Pru av 1 160 816 219.7 3e-59
CAA96535 Mal d 1.0401 160 814 219.2 4.4e-59
CAA96536 Mal d 1.0402 160 814 219.2 4.4e-59
CAA96537 Mal d 1.0403 160 814 219.2 4.4e-59
AAB01362 Mal d 1.0201 159 813 218.9 5.2e-59
AAD26545 Mal d 1.0202 159 813 218.9 5.2e-59
Q2I6V8 Pru p 1.0101 160 812 218.6 6.3e-59
AAD26548 Mal d 1.0204 159 809 217.9 1.1e-58
AAD13683 Mal d 1.0206 159 808 217.6 1.3e-58
AAK13030 Mal d 1.0207 159 807 217.4 1.5e-58
AAD26547 Mal d 1.0203 159 807 217.4 1.5e-58
AAD26558 Mal d 1.0205 159 805 216.8 2.2e-58
CAD32318 Mal d 1.0208 158 800 215.5 5.4e-58
AAD26546 Mal d 1.0103 159 796 214.5 1.1e-57
AAD29671 Mal d 1.0108 159 794 214.0 1.6e-57
O50001 Pru ar 1 160 794 213.9 1.6e-57
O65200 Pyr c 1 159 792 213.4 2.3e-57
B6CQS9 Pru du 1.0101 160 791 213.2 2.8e-57
CAA58646 Mal d 1.0101 159 789 212.6 4e-57
AAD26553 Mal d 1.0105 159 788 212.4 4.8e-57
AAD26552 Mal d 1.0104 159 788 212.4 4.8e-57
AAD26554 Mal d 1.0106 159 788 212.4 4.8e-57
AAD26555 Mal d 1.0107 159 785 211.6 8.3e-57
AAK13029 Mal d 1.0109 159 783 211.1 1.2e-56
APD76154 Jug r 5.0101 160 779 210.0 2.5e-56
CAA88833 Mal d 1.0102 159 776 209.2 4.2e-56
Q256S4 Fra a 1 159 769 207.4 1.5e-55
Q3T923 Fra a 1 160 761 205.3 6.5e-55
Q256S7 Fra a 1 160 759 204.8 9.3e-55
Q256S2 Fra a 1 160 751 202.7 4e-54
Q256S6 Fra a 1 160 750 202.4 4.7e-54
CAD10374 Cas s 1 160 736 198.8 6e-53
CAA96549 Cor a 1.0301 160 719 194.3 1.3e-51
ACJ23864 Fag s 1.0101 160 716 193.6 2.2e-51
CAA54696.1 Bet v 1.0301 160 683 184.9 8.9e-49
Q0Z8U9 Rub i 1.0101 137 677 183.5 2e-48
ABZ81046 Que a 1.0301 160 665 180.2 2.3e-47
Q39427 Bet v 1.0205 160 663 179.7 3.3e-47
AAD48405 Cor a 1.0401 161 659 178.6 7e-47
AAG40331 Cor a 1.0404 161 656 177.9 1.2e-46
AAG40329 Cor a 1.0402 161 656 177.9 1.2e-46
AAG40330 Cor a 1.0403 161 653 177.1 2.1e-46
P43186 Bet v 1.0204 160 652 176.8 2.4e-46
CAA07329.1 Bet v 1.0118 160 652 176.8 2.4e-46
AFN42528 Can s 5.0101 161 649 176.0 4.3e-46
CAA04828.1 Bet v 1.0206 159 648 175.8 5e-46
CAA96548 Cor a 1.0201 160 646 175.3 7.3e-46
AUH28179 Que m 1.0101 160 645 175.0 8.7e-46
CAB02160 Bet v 1.0113 160 643 174.5 1.2e-45
CAA54421 Bet v 1.0201 160 642 174.2 1.5e-45
CAA33887 Bet v 1.0101 160 642 174.2 1.5e-45
CAB02159 Bet v 1.0112 160 642 174.2 1.5e-45
CAB02156 Bet v 1.0109 160 641 173.9 1.8e-45
CAA54481 Bet v 1.0202 160 640 173.7 2.2e-45
CAB02161 Bet v 1.0114 160 640 173.7 2.2e-45
P43184 Bet v 1.0203 160 639 173.4 2.6e-45
CAA54487 Bet v 1.0106 160 638 173.2 3.1e-45
CAA54483 Bet v 1.0103 160 637 172.9 3.7e-45
CAA54482 Bet v 1.0102 160 634 172.1 6.4e-45
CAA96547 Bet v 1.0115 160 632 171.6 9.2e-45
CAA54484 Bet v 1.0104 160 632 171.6 9.2e-45
CAA54485 Bet v 1.0105 160 632 171.6 9.2e-45
CAA07323.1 Bet v 1.0117 160 631 171.3 1.1e-44
CAA54489 Bet v 1.0107 160 630 171.1 1.3e-44
CAB02155 Bet v 1.0108 160 630 171.1 1.3e-44
CAA04827.1 Bet v 1.0116 159 629 170.8 1.6e-44
CAB02157 Bet v 1.0110 160 625 169.8 3.3e-44
CAB02158 Bet v 1.0111 160 622 169.0 5.6e-44
CAA50325 Cor a 1.0103 160 621 168.7 6.7e-44
ABZ81047 Que a 1.0401 160 621 168.7 6.7e-44
CAB02217 Car b 1.0302 161 616 167.4 1.7e-43
AAB24432 Aln g 1 160 615 167.1 2e-43
CAA50327 Cor a 1.0101 160 612 166.4 3.4e-43
QOL10866 Que ac 1.0101 159 609 165.6 5.9e-43
P38948 Aln g 1 159 608 165.3 7e-43
Q08407 Cor a 1 159 605 164.5 1.2e-42
CAA50328 Cor a 1.0102 160 605 164.5 1.2e-42
CAB02216 Car b 1.0301 161 603 164.0 1.8e-42
CAB02207 Car b 1.0104 160 601 163.5 2.5e-42
CAB02206 Car b 1.0103 160 600 163.2 3e-42
CAB02208 Car b 1.0105 160 597 162.4 5.2e-42
ABZ81045 Que a 1.0201 159 593 161.4 1.1e-41
QGS84240 Que i 1.0101 159 593 161.4 1.1e-41
ABZ81041 Car b 1.0110 160 591 160.9 1.5e-41
ABZ81043 Car b 1.0112 160 590 160.6 1.9e-41
ABZ81042 Car b 1.0111 160 590 160.6 1.9e-41
ABZ81040 Car b 1.0109 160 588 160.1 2.7e-41
CAB02209 Car b 1.0106 160 587 159.8 3.2e-41
P38950 Car b 1 159 583 158.8 6.5e-41
ADK39021 Ost c 1.0101 160 583 158.8 6.6e-41
ABZ81044 Car b 1.0113 160 582 158.5 7.9e-41
CAA50326 Cor a 1.0104 160 581 158.3 9.5e-41
ACF75030.1 Bet v 1.0207 150 578 157.6 1.4e-40
CAB02213 Car b 1.0107 160 573 156.2 4e-40
CAA47357 Car b 1.0102 159 572 155.9 4.8e-40
ABC41615.1 Bet v 1.0119 150 563 153.6 2.2e-39
CAB02215 Car b 1.0108 160 563 153.6 2.5e-39
P38949 Car b 1 159 559 152.5 5e-39
CAM31908 Act c 8.0101 159 558 152.3 6e-39
CAM31909 Act d 8.0101 157 538 147.0 2.2e-37
NP_001275580 Sola l 4.0201 160 497 136.3 3.9e-34
AHC08073 Sola l 4.0101 160 487 133.7 2.4e-33
CAA42646 Gly m 4 158 476 130.8 1.7e-32
AAQ91847 Ara h 8.0101 157 469 129.0 6e-32
CAA43637 Pha v 1 156 460 126.7 3e-31
P25985 Pha v 1 155 453 124.8 1.1e-30
CAA43636 Pha v 1 155 447 123.3 3.1e-30
CAA75803 Lyc e 4.0101 178 445 122.6 5.8e-30
EF436550 Ara h 8.0201 153 441 121.7 9.1e-30
Q2VU97 Vig r 1.0101 155 437 120.7 1.9e-29
CAA67246 Pet c PR10 155 434 119.9 3.3e-29
AAL76932 Dau c 1.0201 154 425 117.5 1.7e-28
P92918 Api g 1.0201 159 424 117.2 2.1e-28
P49372 Api g 1 154 400 111.0 1.5e-26
AAB92255 Tar o RAP 157 396 109.9 3.3e-26
BAA13604 Dau c 1.0102 154 378 105.2 8.3e-25
CAB03716 Dau c 1.0104 154 378 105.2 8.3e-25
CAB06416 Dau c 1.0105 154 375 104.5 1.4e-24
AAB01092 Dau c 1.0101 168 375 104.3 1.7e-24
CAB03715 Dau c 1.0103 154 360 100.5 2.2e-23
Q5ULZ4 Fra a 1.0101 100 339 95.5 4.5e-22
P85126 Que a 1.0101 50 217 64.5 5.1e-13
Q9ZWP8 Vig r 6.0101 155 188 55.6 7.6e-10
Q9S8Q4 Cas s 1 24 118 39.4 8.3e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 269.4 bits 1006,  Expect = 3e-74
 Identities = 159/159 100%, Positives = 159/159 100%, Gaps = 0/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN
Sbjct  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 2. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 262.3 bits 979,  Expect = 4e-72
 Identities = 154/159 96%, Positives = 155/159 97%, Gaps = 0/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+EFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            HTK DVEIKEEHVKAGKEKASHLFKLIENYLL H DAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 3. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 260.5 bits 972,  Expect = 2e-71
 Identities = 152/159 95%, Positives = 155/159 97%, Gaps = 0/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+EFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGSTYSYVKHRIDGVDK+NFVYKYSVIEGDAISETIEKISYETKLVA+GSGSVIKSTSHY
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            HTK DVEIKEEHVKAGKEKASHLFKLIENYLL H DAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 4. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 254.2 bits 948,  Expect = 1e-69
 Identities = 148/159 93%, Positives = 152/159 95%, Gaps = 0/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE EFTSVIPPARL+NAFVLDADNLIPKIAPQAVKS EILEGDGGVGTIKKINFG
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGSTYSYVKH+IDGVDK+NFVY+YSVIEGDAISETIEKISYETKLVASGSGSVIKS SHY
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVASGSGSVIKSISHY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            HTK DVEIKEEHVKAGKEKASHLFKLIENYLL H DAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 5. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 219.7 bits 816,  Expect = 3e-59
 Identities = 125/159 78%, Positives = 140/159 88%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+EFTS IPP RLF AFVLDADNL+PKIAPQA+K +EILEGDGG GTIKKI FG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSG-SVIKSTSH 119
            EGS Y YVKH+ID +DKEN+ Y Y++IEGDA+ +T+EKISYETKLVAS SG S+IKSTSH
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK +VEIKEEHVKAGKEKAS+LFKLIE YL  H DAYN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 6. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 219.2 bits 814,  Expect = 4e-59
 Identities = 122/159 76%, Positives = 140/159 88%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYETE TSVIP  RLF AF+LD DNLIPKIAPQA+KS EI+EGDGGVGTIKK+ FG
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS Y YVK+R++G+DK+NF Y YS+IEGD +S+ +EKI+YETKL+AS   GS+IK+TSH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YH K DVEIKEEHVKAGKEKAS LFKL+E YLLAHSDAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 7. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 219.2 bits 814,  Expect = 4e-59
 Identities = 121/159 76%, Positives = 140/159 88%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYETEFTSVIP  RLF AF+LD DNLIPKIAPQA+KS +I+EGDGGVGTIKK+ FG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS Y YVK+R++G+DK+NF Y YS+IEGD +S+ +EKI+YETKL+AS   GS+IK+ SH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YH K DVEIKEEHVKAGKEKAS LFKL+E YLLAHSDAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 8. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 219.2 bits 814,  Expect = 4e-59
 Identities = 122/159 76%, Positives = 140/159 88%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYETEFTSVIP  RLF AF+LD DNLIPKIAPQA+KS EI+EGDGGVGTIKK+ FG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS Y YVK+R++G+DK+NF Y YS+IEGD +S+ +EKI+YETKL+AS   GS+IK+TSH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            Y  K DVEIKEEHVKAGKEKAS LFKL+E YLLAHSDAYN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 9. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 218.9 bits 813,  Expect = 5e-59
 Identities = 123/159 77%, Positives = 138/159 86%, Gaps = 0/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+ +E E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKLVASGSGS+IKS SHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            HTK DVEIKEEHVKAGKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 10. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 218.9 bits 813,  Expect = 5e-59
 Identities = 123/159 77%, Positives = 138/159 86%, Gaps = 0/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+ +E E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKLVASGSGS+IKS SHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            HTK DVEIKEEHVKAGKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 11. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 218.6 bits 812,  Expect = 6e-59
 Identities = 125/159 78%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+EFTS IPP RLF AFVLDADNL+PKIAPQA+K +EILEGDGG GTIKKI FG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSG-SVIKSTSH 119
            EGS Y YVKH+ID +DKEN  Y Y++IEGDA+ + +EKISYETKLVAS SG S+IKSTSH
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK DVEIKEEHVKAGKEKAS+LFKLIE YL  H DAYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 12. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 217.9 bits 809,  Expect = 1e-58
 Identities = 122/159 76%, Positives = 138/159 86%, Gaps = 0/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+ +E E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKL+ASGSGS+IKS SHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMASGSGSIIKSISHY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            HTK DVEIKEEHVKAGKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 13. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 217.6 bits 808,  Expect = 1e-58
 Identities = 122/159 76%, Positives = 137/159 86%, Gaps = 0/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+ +E E+TS IPP RLF  FVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKLVASGSGS+IKS SHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            HTK DVEIKEEHVKAGKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 14. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 217.4 bits 807,  Expect = 2e-58
 Identities = 122/159 76%, Positives = 137/159 86%, Gaps = 0/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+ +E E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEGDGG GT KKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKLVASGSGS+IKS SHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            HTK DVEIKEEHVKAGKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 15. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 217.4 bits 807,  Expect = 2e-58
 Identities = 122/159 76%, Positives = 138/159 86%, Gaps = 0/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+ +E E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKLVASGSGS+IKS SHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            HTK DVEIKEEHVKAGKEKA  LFKLIE++L  H DAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 16. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 216.8 bits 805,  Expect = 2e-58
 Identities = 122/159 76%, Positives = 137/159 86%, Gaps = 0/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+ +E E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKLVASGSGS+IKS SHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            HTK DVEIKEEHV AGKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 17. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 215.5 bits 800,  Expect = 5e-58
 Identities = 122/158 77%, Positives = 136/158 86%, Gaps = 0/158 0%
Query  2    GVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GV+ YE E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FGE
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHYH 121
            GS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKLVASGSGS+IKS SHYH
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHYH 120
Query  122  TKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            TK DVEI EEHVKAGKEKA  LFKLIE+YL  H DAYN
Sbjct  121  TKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 18. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 214.5 bits 796,  Expect = 1e-57
 Identities = 120/159 75%, Positives = 137/159 86%, Gaps = 0/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+ +E EFTS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            HTK ++EIKEEHVKAGKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 19. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 214.0 bits 794,  Expect = 2e-57
 Identities = 120/159 75%, Positives = 137/159 86%, Gaps = 0/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+ +E EFTS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            HTK ++EIKEEHVKAGKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 20. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 213.9 bits 794,  Expect = 2e-57
 Identities = 118/159 74%, Positives = 140/159 88%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YETEFTSVIPP +LF AF+LDADNLIPK+AP AVK  EILEGDGGVGTIKK+ FG
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS Y+YVKHR+DG+DK+N+ Y Y++IEGDA+S+ IE I+Y+ KLVAS   GS++K+TSH
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK DVEIKEE+VKAGKEKA+ LFKL+E YLLA+ DAYN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 21. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 213.4 bits 792,  Expect = 2e-57
 Identities = 119/159 74%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG++ +E EFTS IPP RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKHR+D +D+ ++ Y Y++IEGDA+++TIEKISYE KLVASGSGS IKS SHY
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVASGSGSTIKSISHY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            HTK D+EIKEEHVKAGKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 22. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 213.2 bits 791,  Expect = 3e-57
 Identities = 124/159 77%, Positives = 142/159 89%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG+F Y  E TSVIPP RLF A+VL+AD LIPKIAPQ+VKSAEI+EGDGGVGTIKKI+FG
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSG-SVIKSTSH 119
            EGS YSYVKH+IDG+DK+NFVY YS++EGDA+S+ +EKISYE KLVAS  G SVIKSTS+
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK DVEIKEE VKAGKEKA+ LFKLIENYL+A+ DAYN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 23. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 212.6 bits 789,  Expect = 4e-57
 Identities = 119/159 74%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+ +E EFTS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            HTK ++EIKEEHVK GKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 24. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 212.4 bits 788,  Expect = 5e-57
 Identities = 120/159 75%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV  +E EFTS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            HTK ++EIKEEHVKAGKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 25. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 212.4 bits 788,  Expect = 5e-57
 Identities = 119/159 74%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+ +E E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            HTK ++EIKEEHVKAGKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 26. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 212.4 bits 788,  Expect = 5e-57
 Identities = 119/159 74%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+ +E EFTS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIE ISYETKLVA GSGS IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSGSTIKSISHY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            HTK ++EIKEEHVKAGKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 27. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 211.6 bits 785,  Expect = 8e-57
 Identities = 118/159 74%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+ +E E+TS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            HTK ++EIKEEHVKAGK KA  LFKLIE+YL  H DAYN
Sbjct  121  HTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 28. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 211.1 bits 783,  Expect = 1e-56
 Identities = 119/159 74%, Positives = 135/159 84%, Gaps = 0/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV  +E EFTS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            HTK ++EIKEEHVK GKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 29. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 210.0 bits 779,  Expect = 2e-56
 Identities = 121/159 76%, Positives = 135/159 84%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YETE TSVIPPARLF AFVLDADNLIPK+ PQAVKS+EI+EG+GG GTIKKINFG
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASG-SGSVIKSTSH 119
            EGS Y YVKHR D +D+ NF Y YSVIEGDA+++ IEKISYETK+VAS   GS++KS SH
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YH+K D EIKEE VK GKEKAS LFK +E YLLAH DAYN
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 30. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 209.2 bits 776,  Expect = 4e-56
 Identities = 116/159 72%, Positives = 134/159 84%, Gaps = 0/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+ +E EFTS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSG+ IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATIKSISHY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            H K ++EIKEEHVK GKEK   LFKLIE+YL  H DAYN
Sbjct  121  HPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 31. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 207.4 bits 769,  Expect = 1e-55
 Identities = 119/159 74%, Positives = 131/159 82%, Gaps = 0/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+ YE EFTS IP  +LF AFVLDADNLIPKIAPQAVK AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKH+I  +DKEN  Y YS+IEGDA+S+ IEKI YETKLV++  G++IK+TS Y
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            HTK DVEIKEEHVKAGKEKASHLFKLIE YL  H   YN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 32. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 205.3 bits 761,  Expect = 6e-55
 Identities = 121/159 76%, Positives = 130/159 81%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+ YE EFTS IP  +LF AFVLDADNLIPKIAPQAVK AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSH 119
            EGS Y YVKH+I  +DKEN  Y YS+IEGDA+S+ IEKI YETKLV A   G+VIK+TS 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK DVEIKEEHVKAGKEKASHLFKLIE YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 33. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 204.8 bits 759,  Expect = 9e-55
 Identities = 119/159 74%, Positives = 130/159 81%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+ YE EFTS IP  +LF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSH 119
            EGS Y YVKH+I  +DKEN  Y YS+IEGDA+S+ IEKI YETKLV A   G++IK+TS 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK DVEIKEEHVKAGKEKASHLFKLIE YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 34. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 202.7 bits 751,  Expect = 4e-54
 Identities = 119/159 74%, Positives = 129/159 81%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+ YE EFTS IP  +LF AFVLDADNLIPKIAPQAVK AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSH 119
            EGS Y YVKH+I  +DK N  Y YS+IEGDA+SE IEKI YETKLV A   G++IK+TS 
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK DVEIKEEHVKAGKEKA+HLFKLIE YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 35. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 202.4 bits 750,  Expect = 5e-54
 Identities = 118/159 74%, Positives = 129/159 81%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG + YE EFTS IP  +LF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSH 119
            EGS Y YVKH+I  +DKEN  Y YS+IEGDA+S+ IEKI YETKLV A   G++IK+TS 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK DVEIKEEHVKAGKEKASHLFKLIE YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 36. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 198.8 bits 736,  Expect = 6e-53
 Identities = 113/159 71%, Positives = 132/159 83%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF +E E TS IPP RLF AFVLDADNLIPK+AP+A+KSAEI+EG+GG GTIKKI FG
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + YVKHRID +D+ NF Y YSVIEGD ++E +EKISYE K+VAS   GS++K+TS 
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK + EIKEE V AGKEKA+ LFK +E YLLAHSDAYN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 37. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 194.3 bits 719,  Expect = 1e-51
 Identities = 108/159 67%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYETE TSVIPPARLF  FVLD+DNLIPK+AP+A+KS EI+EG+GG GTIKKI F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASG-SGSVIKSTSH 119
            EGS ++Y+K++++ +D+ NF Y+YSVIEGDA+S+ +EKI+YE K+VAS   GS++KS S 
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHT  D E+K+E++KAGKEKAS LFK +E YLLAHSDAYN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 38. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 193.6 bits 716,  Expect = 2e-51
 Identities = 111/159 69%, Positives = 134/159 84%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E T+VI PARLF AFVLDADNLIPK+APQA+KS+EI+EG GG GTIKKI FG
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS ++YVKHRID +D  NF Y  ++IEGDAISET+EKI+YE KLVAS   GS++KSTS 
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK D EIKE+++KAGKE+AS +FK +E YLLA+  AY+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 39. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 184.9 bits 683,  Expect = 9e-49
 Identities = 103/159 64%, Positives = 127/159 79%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE E TSVI PARLF +FVLDADNLIPK+AP+ V SAE +EG+GG GTIKKI F 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + Y+KHR+D +D  NF Y YS+IEG  + +T+EKISYE K+VA+ G GS++K TS 
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK D+ + EE +KAGKEK + LFK +ENYL+AH +AYN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 40. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 183.5 bits 677,  Expect = 2e-48
 Identities = 101/137 73%, Positives = 120/137 87%, Gaps = 0/137 0%
Query  10   FTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGEGSTYSYVK 69
            +TSVIPP +LF AFVLDADNLIPKIAPQAVKS EI+EGDGGVGT+KKI++GEG+ +SYVK
Sbjct  1    YTSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVK 60
Query  70   HRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHYHTKSDVEIK 129
            H+IDG+DK NFVY YS+ EGDA+ + IEKISYE KLVASG GS+IK+TSHYH K   EIK
Sbjct  61   HKIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVASGRGSIIKTTSHYHCKGGAEIK 120
Query  130  EEHVKAGKEKASHLFKL 146
            EE+VK GKE+A+ LFK+
Sbjct  121  EEQVKDGKERAAGLFKI 137

Sequence Alignment: 41. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 180.2 bits 665,  Expect = 2e-47
 Identities = 100/158 63%, Positives = 125/158 79%, Gaps = 1/158 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SVIPPARLF AFVLD+DNLIPK+ PQA+KS EI+EG+GG GTIKKI FG
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS   + KHRID +D ENF Y +SVIEGDA+ + +E +S ETK+VAS   GS++KSTS 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAY 158
            Y+TK D ++ +E ++ GKEKAS +FK +E YL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 42. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 179.7 bits 663,  Expect = 3e-47
 Identities = 103/159 64%, Positives = 125/159 78%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYETE TSVIP ARLF AF+LD DNLIPK+APQA+ S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + YVK R+D VD  NF Y YS+IEG A+ +T+EKI  E KLVA+   GS++K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK D E+K EH+KA KEKA  L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 43. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 178.6 bits 659,  Expect = 7e-47
 Identities = 101/158 63%, Positives = 122/158 77%, Gaps = 2/158 1%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE E TSVIPPARLF +FVLDADNLIPK+APQ   SAE LEG+GG GTIKKI F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS--GSGSVIKSTS 118
            EG+ + Y+KH+++ +D  NF Y YS+IEG  +  T+EKISYE K+ A+  G GS++K TS
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  HYHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAY 158
             YHTK +  I EE +KAGKEKA+ LFK +E YLLAH DAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 44. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 177.9 bits 656,  Expect = 1e-46
 Identities = 100/158 63%, Positives = 122/158 77%, Gaps = 2/158 1%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF+YE E TSVIPPARLF +FVLDADNLIPK+APQ   SAE LEG+GG GTIKKI F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS--GSGSVIKSTS 118
            EG+ + Y+KH+++ +D  NF Y YS+IEG  +  T+EKI YE K+ A+  G GS++K TS
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  119  HYHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAY 158
             YHTK +  I EE +KAGKEKA+ LFK +E YLLAH DAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 45. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 177.9 bits 656,  Expect = 1e-46
 Identities = 100/158 63%, Positives = 121/158 76%, Gaps = 2/158 1%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF+YE E TSVIPPARLF +FVLDADNLIPK+APQ    AE LEG+GG GTIKKI F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS--GSGSVIKSTS 118
            EGS + Y+KH+++ +D  NF Y YS+IEG  +  T+EKISYE K+ A+  G GS++K TS
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  HYHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAY 158
             YHTK +  I EE +KAGKEKA+ LFK +E YLLAH D Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 46. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 177.1 bits 653,  Expect = 2e-46
 Identities = 100/158 63%, Positives = 120/158 75%, Gaps = 2/158 1%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE E TSVIPPARLF +FVLDADNLIPK+APQ    AE LEG+GG GTIKKI F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS--GSGSVIKSTS 118
            EGS + Y+KH+++ +D  NF Y YS+IEG  +  T+EKISYE K+ A+  G GS++K TS
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  HYHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAY 158
             YHTK +  I EE +KAGKEKA+ LFK +E YLLAH D Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 47. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 176.8 bits 652,  Expect = 2e-46
 Identities = 100/159 62%, Positives = 124/159 77%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE+E TSVIP ARLF AF+LD DNLIPK+APQA+ S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + YVK R+D VD  NF Y YS+IEG A+ +T+EKI  E K+VA+   GS++K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK D E+K EH+KA KEK   L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 48. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 176.8 bits 652,  Expect = 2e-46
 Identities = 102/159 64%, Positives = 124/159 77%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYETE TSVIP ARLF AF+LD DNLIPK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  I +T+EKIS E KLVA+   GS+++ ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK D E+K EH+KA KEK   L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 49. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 176.0 bits 649,  Expect = 4e-46
 Identities = 96/159 60%, Positives = 128/159 80%, Gaps = 2/159 1%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+EFTS I PARLF AFVLD DNL+PKIAPQAV+  EILEG+GGVGTIKKI FG
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAI-SETIEKISYETKLVASGSG-SVIKSTS 118
            +G  + YVKH+I+ +DKE++ Y YS+IEGDA+    +EKI++E+KLVASG G +VIK+ S
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  119  HYHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
             Y++  D ++ EE VK G+++A++++K +E YL  H +AYN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 50. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 175.8 bits 648,  Expect = 5e-46
 Identities = 100/158 63%, Positives = 123/158 77%, Gaps = 1/158 0%
Query  2    GVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GVFNYE+E TSVIP ARLF AF+LD DNLIPK+APQA+ S E +EG+GG GTIKKI F E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSHY 120
            GS + YVK R+D VD  NF Y YS+IEG A+ +T+EKI  E KLVA+   GS++K ++ Y
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            HTK D E+K EH+KA KEK   L++ +E+YLLAHSDAYN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 51. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 175.3 bits 646,  Expect = 7e-46
 Identities = 98/159 61%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYETE TSVIP ARLF AF+LD +NLIPK+APQAV S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + YVK R++ VD  NF Y Y+VIEG  + + +EKI  E K+VA+   GS++K ++ 
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK D E+  EH+K GKEK   LF+ +E YLLAHSDAYN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 52. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 175.0 bits 645,  Expect = 9e-46
 Identities = 97/158 61%, Positives = 123/158 77%, Gaps = 1/158 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV  YE+E  SVIPPARLF AFVLD+DNLIPK+ PQA+KS EI+EG+GG GTIKKI FG
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS   + KHRID +D ENF + +SVIEGDA+ + +E +S ETK+VAS   GS++KST  
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAY 158
            Y+TK D ++ +E ++ GKEKAS +FK +E YL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 53. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 174.5 bits 643,  Expect = 1e-45
 Identities = 99/159 62%, Positives = 123/159 77%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYETE TSVIP ARLF AF+LD DNL+PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA+   GS++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK D E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 54. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 174.2 bits 642,  Expect = 1e-45
 Identities = 99/159 62%, Positives = 123/159 77%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYETE TSVIP ARLF AF+L+ D LIPK+APQA+ S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + YVK R+D VD  NF Y YS+IEG A+ +T+EKI  E K+VA+   GS++K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK D E+K EH+KA KEK   L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 55. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 174.2 bits 642,  Expect = 1e-45
 Identities = 100/159 62%, Positives = 122/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYETE TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  I +T+EKIS E K+VA+   GS++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK D E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 56. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 174.2 bits 642,  Expect = 1e-45
 Identities = 100/159 62%, Positives = 122/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYETE TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  I +T+EKIS E K+VA+   GS++K ++ 
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK D E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 57. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 173.9 bits 641,  Expect = 2e-45
 Identities = 99/159 62%, Positives = 122/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYETE TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA+   GS++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK D E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 58. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 173.7 bits 640,  Expect = 2e-45
 Identities = 98/159 61%, Positives = 123/159 77%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE+E TSVIP ARLF AF+L+ D LIPK+APQA+ S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + YVK R+D VD  NF Y YS+IEG A+ +T+EKI  E K+VA+   GS++K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK D E+K EH+KA KEK   L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 59. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 173.7 bits 640,  Expect = 2e-45
 Identities = 100/159 62%, Positives = 122/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYETE TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  I +T+EKIS E K+VA+   GS++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK D E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 60. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 173.4 bits 639,  Expect = 3e-45
 Identities = 98/159 61%, Positives = 123/159 77%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE+E TSVIP ARLF AF+L+ D LIPK+APQA+ S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + YVK R+D VD  NF Y YS+IEG A+ +T+EKI  E K+VA+   GS++K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK D E+K EH+KA KEK   L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 61. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 173.2 bits 638,  Expect = 3e-45
 Identities = 98/159 61%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYETE TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA+   GS++K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK D E+K E++KA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 62. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 172.9 bits 637,  Expect = 4e-45
 Identities = 98/159 61%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYETE TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA+   GS++K  + 
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK D E+K E++KA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 63. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 172.1 bits 634,  Expect = 6e-45
 Identities = 98/159 61%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE E TSVIP ARLF AF+LD DNL+PK+APQA+ S E +EG+GG GTIKKINF 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA+  G  V+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK + E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 64. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 171.6 bits 632,  Expect = 9e-45
 Identities = 98/159 61%, Positives = 122/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYETE TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSG-SVIKSTSH 119
            EG  + YVK R+D V  +NF Y YSVIEG  I +T+EKIS E K+VA+  G S++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK D E+K E++KA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 65. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 171.6 bits 632,  Expect = 9e-45
 Identities = 97/159 61%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA+   GS++K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK D E+K E++KA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 66. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 171.6 bits 632,  Expect = 9e-45
 Identities = 98/159 61%, Positives = 122/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE+E TSVIP ARLF AF+L+ DNLIPK+APQA+ S E +EG+GG GTIKKINF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA+  G  V+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK + E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 67. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 171.3 bits 631,  Expect = 1e-44
 Identities = 99/159 62%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYETE TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  I +T+EKIS E K+VA+  G  V+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK + E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 68. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 171.1 bits 630,  Expect = 1e-44
 Identities = 97/159 61%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYETE TSVIP AR+F AF+LD D L+PK+APQA+ S E +EG+GG GTIKKINF 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA+  G  V+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK + E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 69. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 171.1 bits 630,  Expect = 1e-44
 Identities = 98/159 61%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYETE TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA+  G  V+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK + E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 70. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 170.8 bits 629,  Expect = 2e-44
 Identities = 97/158 61%, Positives = 121/158 76%, Gaps = 1/158 0%
Query  2    GVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GVFNYETE TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSHY 120
            G  + YVK R+D VD  NF Y YS+IEG  + +T+EKIS E K+VA+   GS++K ++ Y
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            HTK D E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 71. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 169.8 bits 625,  Expect = 3e-44
 Identities = 98/159 61%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYETE TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  I + +EKIS E K+VA+  G  V+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK + E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 72. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 169.0 bits 622,  Expect = 6e-44
 Identities = 98/159 61%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYETE TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSH 119
             G  + YVK R+D VD  NF Y YSVIEG  I +T+EKIS E K+VA+  G  V+K ++ 
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK + E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 73. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 168.7 bits 621,  Expect = 7e-44
 Identities = 93/159 58%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE E TSVIP ARLF ++VLD D LIPK+APQA+ S E +EG+GG GTIK I FG
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+ +E K+VA+ G GS++K +S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            +H K D EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 74. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 168.7 bits 621,  Expect = 7e-44
 Identities = 95/158 60%, Positives = 122/158 77%, Gaps = 1/158 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF +E++ TSVI PARLF A+ LD+DNLI K+ PQA+KS EI+EG+GG GTIKKI FG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS   + KHRID +D ENF Y +SVIEGDA+ + +E +S ETK+VAS   GS+ KSTS 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAY 158
            Y+TK D ++ +E ++ GKEKAS +FK +E YL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 75. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 167.4 bits 616,  Expect = 2e-43
 Identities = 95/159 59%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE E TSVIP ARLF AF+LD +NLIPK+APQAV S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS   YVK R++ VD  NF Y Y+VIEG  + + +EKI  E K+VA+   GS++K TS 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK D E+  EH+K GKE+   L+K +E YLLAH+  YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 76. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 167.1 bits 615,  Expect = 2e-43
 Identities = 94/159 59%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE E  SVIP ARLF AF+LD D L+PK+AP+AV S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + YVK R+D VD+ NF Y +SVIEG A+ + +EK+  E K+VA+   GS++K ++ 
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            +HTK D EI  E++K  KEKA  L+K +E+YLLAHSDAYN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 77. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 166.4 bits 612,  Expect = 3e-43
 Identities = 92/159 57%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE E  SVIP ARLF ++VLD D LIPK+APQA+ S E +EG+GG GTIK I FG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+ +E K+VA+ G GS++K +S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            +H K D EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 78. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 165.6 bits 609,  Expect = 6e-43
 Identities = 96/158 60%, Positives = 122/158 77%, Gaps = 2/158 1%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+NYE++ TSVIPPARLF AFVLD+DNLI K+ P+AVKS EI+EG+GG GTIKK  FG
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            E S   Y KHRID +D EN  Y +SVIEG+A+++ I  IS E K+VAS   GS++KST+ 
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            Y+TK   ++KEE+++A  EK + LFK +E YLLAH D YN
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 79. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 165.3 bits 608,  Expect = 7e-43
 Identities = 93/158 58%, Positives = 119/158 75%, Gaps = 1/158 0%
Query  2    GVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GVFNYE E  SVIP ARLF AF+LD D L+PK+AP+AV S E +EG+GG GTIKKI F E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSHY 120
            GS + YVK R+D VD+ NF Y +SVIEG A+ + +EK+  E K+VA+   GS++K ++ +
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            HTK D EI  E++K  KEKA  L+K +E+YLLAHSDAYN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 80. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 164.5 bits 605,  Expect = 1e-42
 Identities = 91/158 57%, Positives = 114/158 72%, Gaps = 1/158 0%
Query  2    GVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GVFNYE E  SVIP ARLF ++VLD D LIPK+APQA+ S E +EG+GG GTIK I FGE
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSHY 120
            GS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+ +E K+VA+ G GS++K +S +
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            H K D EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 81. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 164.5 bits 605,  Expect = 1e-42
 Identities = 92/159 57%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE E  SVIP ARLF ++VLD D LIPK+APQA+ S E +EG+GG GTIK I FG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+  E K+VA+ G GS++K +S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            +H K D EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 82. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 164.0 bits 603,  Expect = 2e-42
 Identities = 93/159 58%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE E TSVIP ARLF AF+LD + LIPK++PQAV S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS   YVK R++ VD  NF Y Y+VIEG  + + +EKI  E K+VA+   GS++K TS 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            YHTK D E+  EH+K GKE+   L+K +E YLLAH+  YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 83. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 163.5 bits 601,  Expect = 3e-42
 Identities = 88/159 55%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            +H K D E+  E +K  KE A  L++ +E+YLLAH+D YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 84. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 163.2 bits 600,  Expect = 3e-42
 Identities = 88/159 55%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            +H K D E+  E +K  KE A  L++ +E+YLLAH+D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 85. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 162.4 bits 597,  Expect = 5e-42
 Identities = 88/159 55%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            +H K D E+  E +K  KE A  L++ +E+YLLAH+D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 86. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 161.4 bits 593,  Expect = 1e-41
 Identities = 92/157 58%, Positives = 121/157 77%, Gaps = 2/157 1%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF +E++ TSVI PARLF A+ LD+DNLI K+ PQA+KS EI+EG+GG GTIKKI FG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            E S + Y KHRID +D EN  Y +SVIEGDA++  +E +S E K VAS   GS++KST+ 
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAY 158
            Y+TK D ++KEE+++A  EKA+ L+K +E YL+AH D Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 87. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 161.4 bits 593,  Expect = 1e-41
 Identities = 93/157 59%, Positives = 120/157 76%, Gaps = 2/157 1%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV  +E++ TSVIPPARLF AFVLD+DNLIPK+ PQA+KS E +EG+GG GTIKKI FG
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            E S + Y KHRID +D EN  Y +SVIEGDA+++ +  +S E K+VAS   GS+ KST+ 
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAY 158
            Y+TK D ++KEE+++A  EK + L K +E YLLAH D Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 88. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 160.9 bits 591,  Expect = 2e-41
 Identities = 88/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GSV+K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            +H K D E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 89. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 160.6 bits 590,  Expect = 2e-41
 Identities = 87/159 54%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            +H K D E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 90. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 160.6 bits 590,  Expect = 2e-41
 Identities = 87/159 54%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            +H K D E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 91. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 160.1 bits 588,  Expect = 3e-41
 Identities = 87/159 54%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            +H K D E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 92. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 159.8 bits 587,  Expect = 3e-41
 Identities = 87/159 54%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            +H K D E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 93. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 158.8 bits 583,  Expect = 7e-41
 Identities = 87/158 55%, Positives = 115/158 72%, Gaps = 1/158 0%
Query  2    GVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GVFNYE E TSVIP ARLF AF+LD + LIPK++PQAV S E +EG+GG GTIKKI F E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSHY 120
            GS   YVK R++ +D  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S +
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            H K   E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 94. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 158.8 bits 583,  Expect = 7e-41
 Identities = 86/159 54%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE E  SVIP ARLF ++VLD D LIPK+APQA+   E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            +H K D E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 95. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 158.5 bits 582,  Expect = 8e-41
 Identities = 86/159 54%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EG  + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S 
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            +H K D E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 96. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 158.3 bits 581,  Expect = 9e-41
 Identities = 90/159 56%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE E  SVI  ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I FG
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+  E K+VA+ G GS +K +S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            +H K D EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 97. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 157.6 bits 578,  Expect = 1e-40
 Identities = 89/149 59%, Positives = 114/149 76%, Gaps = 1/149 0%
Query  4    FNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGEGS 63
            FNYE+E TSVIP ARLF AF+L+ DNLIPK+APQA+ S E +EG+GG GTIKKI F EGS
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   TYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSHYHT 122
             + YVK R+D VD  NF Y YS+IEG A+ +T+EKI  E K+VA+   GS++K ++ YHT
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  123  KSDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            K D E+K EH+KA KEK   L++ +E+YLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 98. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 156.2 bits 573,  Expect = 4e-40
 Identities = 85/159 53%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF + Y+VIEGD + + +EK+S E K+VA+ G GS++K +  
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            +H K D E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 99. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 155.9 bits 572,  Expect = 5e-40
 Identities = 85/158 53%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  2    GVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GVFNYE E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSHY 120
            GS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S +
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            H K   E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 100. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 153.6 bits 563,  Expect = 2e-39
 Identities = 87/149 58%, Positives = 111/149 74%, Gaps = 1/149 0%
Query  4    FNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGEGS 63
            FNYETE TSVIP ARLF AF+LD DNL PK+APQA+ S + +EG+GG GTIKKINF EG 
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   TYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSHYHT 122
             + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA+  G  ++K ++ YHT
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  123  KSDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            K + E+K E+VKA KE    L++ +E+YLL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 101. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 153.6 bits 563,  Expect = 2e-39
 Identities = 83/159 52%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFNYE E  SV+P ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF + Y+VIEGD + + +EK+S E  +VA+ G GS++K +  
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            +H K D E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 102. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 152.5 bits 559,  Expect = 5e-39
 Identities = 83/158 52%, Positives = 111/158 70%, Gaps = 1/158 0%
Query  2    GVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GVFNYE E  SVIP ARLF ++VLD D LIPK+APQ + S E + G+GG GTIK I F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSHY 120
            G  + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S +
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            H K   E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 103. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 152.3 bits 558,  Expect = 6e-39
 Identities = 80/156 51%, Positives = 112/156 71%, Gaps = 1/156 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV  Y+ E  S +PP +L+ AF+LD D L+PK+ P+A+K  +ILEGDG  GTIK++ FG
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS +  VK+R+D +DK+N+ Y Y++IEGD ++E  E ISY  K+VA    GS+ K+ S 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSD 156
            Y TK D ++ EE +K GKEKA+ +FK +E YLLA+ D
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157

Sequence Alignment: 104. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 147.0 bits 538,  Expect = 2e-37
 Identities = 84/155 54%, Positives = 106/155 68%, Gaps = 2/155 1%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG   Y+ E  S I   ++F AFVLD D +IPK  P+A+   + LEGDGGVGTIK   FG
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVI-KSTSH 119
            EGS +  VKHRIDG+DKENF Y YS+IEG A+ +  E ISY  K+VA+  G  I K+ S 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSD 156
            Y  K D ++ EE +KAGKE+AS +FK +E YLLA+ D
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPD 156

Sequence Alignment: 105. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 136.3 bits 497,  Expect = 4e-34
 Identities = 78/158 49%, Positives = 107/158 67%, Gaps = 1/158 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV  +  E T+ I P RLF  +VLD D+L+PK+  + VKS EI+EGDGG G+IK++NF 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVI-KSTSH 119
            EG    Y+KH+I  +D +N+V KYS+IEGD + + +E I+Y+ K+ A+G G  + K+T+ 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAY 158
            YHTK D  + EE    GK KA  LFK IE YLLA+   Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 106. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 133.7 bits 487,  Expect = 2e-33
 Identities = 76/158 48%, Positives = 107/158 67%, Gaps = 1/158 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV  Y  E T+ I P RLF A+VLD DNL+PK+  Q VK+ E +EGDGGVG+IK++NF 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSH 119
            EG    Y+KH+I  +D +N+  KYS+IEGD + E +E I+Y+ K+ A+ +G  V K+T+ 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAY 158
            YHTK D  + EE    G+E+  ++ K +E YLLA+   Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 107. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 130.8 bits 476,  Expect = 2e-32
 Identities = 81/157 51%, Positives = 105/157 66%, Gaps = 3/157 1%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF +E E  S + PA L+ A+V DADN+IPK A  + KS E +EG+GG GTIKKI F 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            E     +V H+I+ +D+ N+ Y YSV+ G A+ +T EKI++++KLVA    GS  K T  
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159
            Y TK D E  ++ +K GK KA  LFK IE YLLAH D YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPD-YN 158

Sequence Alignment: 108. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 129.0 bits 469,  Expect = 6e-32
 Identities = 76/156 48%, Positives = 104/156 66%, Gaps = 3/156 1%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF +E E TS +PPA+L+NA + DAD++ PKI    VKS EI+EG+GG GTIKK+   
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            E     ++ H+++ +D+ N+ Y YSV+ G A+  T EKI++ETKLV     GS+ K T  
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAY 158
            YHTK D +  EE +K GK K   LF+ IE Y+LA+   Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 109. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 126.7 bits 460,  Expect = 3e-31
 Identities = 72/154 46%, Positives = 102/154 66%, Gaps = 1/154 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF +E + TS + PA L+ A   DAD + PK  P + KS EI+EG+GG GTIKKI+F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSH 119
            E     +V H+I+ +D+ N+ Y YS++ G A+ ET EKI++++KL      GS+IK +  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAH 154
            YH+K D    E+ +KAGK K+  LFK +E YLLA+
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155

Sequence Alignment: 110. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 124.8 bits 453,  Expect = 1e-30
 Identities = 71/153 46%, Positives = 101/153 66%, Gaps = 1/153 0%
Query  2    GVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GVF +E + TS + PA L+ A   DAD + PK  P + KS EI+EG+GG GTIKKI+F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSHY 120
                 +V H+I+ +D+ N+ Y YS++ G A+ ET EKI++++KL      GS+IK +  Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAH 154
            H+K D    E+ +KAGK K+  LFK +E YLLA+
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154

Sequence Alignment: 111. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 123.3 bits 447,  Expect = 3e-30
 Identities = 73/153 47%, Positives = 104/153 67%, Gaps = 2/153 1%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            M VF +E + TS + PA L+ A+V DAD ++PK A  + KS EI+EG+GG GTIKKI+F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSH 119
            E     +V H+I+ +D+ N+ Y YS++ G A+ +T EKIS ++KL      GSV+K +  
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAH 154
            YH+K D    E+ +KAGK K+  LFK+IE YLLA+
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154

Sequence Alignment: 112. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 122.6 bits 445,  Expect = 6e-30
 Identities = 69/145 47%, Positives = 97/145 66%, Gaps = 1/145 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV  Y  E T+ I P RLF A+VLD DNL+PK+  Q VK+ E +EGDGGVG+IK++NF 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSH 119
            EG    Y+KH+I  +D +N+  KYS+IEGD + E +E I+Y+ K+ A+ +G  V K+T+ 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFK 145
            YHTK D  + EE    G+ +    F+
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQ 146

Sequence Alignment: 113. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 121.7 bits 441,  Expect = 9e-30
 Identities = 68/153 44%, Positives = 101/153 66%, Gaps = 1/153 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV  +E E TS +PPA+LF A V+D D L PK+ P A++S EI+EG+GG GT+KK+   
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            E    SYV H+ID +D+  + Y Y++  G    E +EK+S++TKL A+  GS IK +  +
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAADGGSKIKVSVTF 119
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAH 154
            HTK D  + +E  +  K+K+  +FK IE Y+L++
Sbjct  120  HTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 114. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 120.7 bits 437,  Expect = 2e-29
 Identities = 74/152 48%, Positives = 106/152 69%, Gaps = 4/152 2%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            M VF ++ + TS + PA L+NA+  DADN+IPK A  + +S EI+EG+GG GTIKKI+F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGS--GSVIKSTS 118
            E     +V H+I+ VD+ N+ Y YS++ G A+ +T EKI+ +TK ++ G+  GS+IK T 
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTK-ISDGADGGSLIKLTI 118
Query  119  HYHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAH 154
             YH K D    E+ +KAGK K+  LFK +E YLLA+
Sbjct  119  SYHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLAN 154

Sequence Alignment: 115. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 119.9 bits 434,  Expect = 3e-29
 Identities = 65/154 42%, Positives = 100/154 64%, Gaps = 1/154 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV   E   TS +P A+LF A+ LD D L+P++ P A+K  EILEGDGGVGT+K + +G
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSH 119
            + S Y  +K++ID +DKE F + YS+I+GD +   I+ I+    +V +  G     ST+ 
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAH 154
            ++TK D  + EE++K   ++ + +FK +E YLLA+
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 116. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 117.5 bits 425,  Expect = 2e-28
 Identities = 61/154 39%, Positives = 100/154 64%, Gaps = 0/154 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV   E E  S +   +++  F+LD D + PK+ PQ +KS EILEGDGGVGT++ +++G
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            E + Y+ +K+++D +DK  + Y Y+ I GD + E +E +  +  +V +  G ++K+T+ Y
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQFVVVPTDGGCIVKNTTIY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAH 154
            +TK D  + E+ VK   EK++  FK +E YLLA+
Sbjct  121  NTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 117. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 117.2 bits 424,  Expect = 2e-28
 Identities = 60/154 38%, Positives = 99/154 64%, Gaps = 0/154 0%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV     E  S +   +++  F+LD D + PK+ PQ +KS EILEGDGGVGT+K +++G
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            E + Y+ +K+++D +DK  + Y Y+ I GD + + +E +  E  +V +  G ++K+T+ Y
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPTDGGCIVKNTTIY 120
Query  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAH 154
            +TK D  + E+ +K   EK++  FK +E YLLA+
Sbjct  121  NTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 118. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 111.0 bits 400,  Expect = 2e-26
 Identities = 66/153 43%, Positives = 98/153 64%, Gaps = 2/153 1%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV  +  E+TS +   ++F  FV+D D ++PK AP A KS EI +GDGG GT+K I + 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSG-SVIKSTSH 119
            +G   + +  RIDGV+KE + + YSVI+GD +   IE I     LV +  G S+ K+T+ 
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAH 154
            +HTK D  + EE++K   E+ + LFK +E YL+A+
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 119. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 109.9 bits 396,  Expect = 3e-26
 Identities = 59/151 39%, Positives = 91/151 60%, Gaps = 1/151 0%
Query  7    ETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGEGSTYS 66
            E E TS + P+ +F AFV+D D + PK  P+  KS + +EGDGGVGTIK I + +G  ++
Sbjct  5    EFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFT 64
Query  67   YVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSG-SVIKSTSHYHTKSD 125
              KH++D +D  NF   Y++ EGD +   IE  ++  K++ S  G SV K +  +  K D
Sbjct  65   SSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGD 124
Query  126  VEIKEEHVKAGKEKASHLFKLIENYLLAHSDA 157
             ++ +E+V   KE     FK IE Y+++H +A
Sbjct  125  AKLTDENVSLMKEGLKKTFKAIETYVISHPEA 156

Sequence Alignment: 120. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 105.2 bits 378,  Expect = 8e-25
 Identities = 64/151 42%, Positives = 97/151 64%, Gaps = 6/151 3%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG  ++  E TS +   ++F+  VLD D +IPK AP A KS ++ +GDGG GT++ I + 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVA---SGSGSVIKST 117
            EGS  + +  R D V+KE + Y  +VI+GD + E IE I  ET +V    +  GS+ K+T
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 117
Query  118  SHYHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAH 154
            + +HTK D  + EE++K    + + LFK IE YL+A+
Sbjct  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 105.2 bits 378,  Expect = 8e-25
 Identities = 65/151 43%, Positives = 97/151 64%, Gaps = 6/151 3%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG  ++  E TS +   ++F+  VLD D +IPK AP A KS ++ +GDGG GT++ I + 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVA---SGSGSVIKST 117
            EGS  + +  R D V+KE + Y  +VI+GD +   IE I  ET LV    +  GS+ K+T
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESI--ETHLVVVPTADGGSITKTT 117
Query  118  SHYHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAH 154
            + +HTK D  + EE++K   E+ + LFK IE YL+A+
Sbjct  118  AIFHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 104.5 bits 375,  Expect = 1e-24
 Identities = 65/151 43%, Positives = 96/151 63%, Gaps = 6/151 3%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG  ++  E TS +   ++F+  VLD D +IPK AP A KS E+ +GDGG GT++ I + 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVA---SGSGSVIKST 117
            EGS  + +  R D V+KE + Y  +VI+GD +   IE I  ET LV    +  GS+ K+T
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESI--ETHLVVVPTADGGSITKTT 117
Query  118  SHYHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAH 154
            + +HTK D  + EE++K    + + LFK IE YL+A+
Sbjct  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 104.3 bits 375,  Expect = 2e-24
 Identities = 64/151 42%, Positives = 96/151 63%, Gaps = 6/151 3%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG  ++  E TS +   ++F   VLD D +IPK AP A KS ++ +GDGG GT++ I + 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 73
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVA---SGSGSVIKST 117
            EGS  + +  R D V+KE + Y  +VI+GD + E IE I  ET +V    +  GS+ K+T
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 131
Query  118  SHYHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAH 154
            + +HTK D  + EE++K    + + LFK IE YL+A+
Sbjct  132  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 124. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 100.5 bits 360,  Expect = 2e-23
 Identities = 63/151 41%, Positives = 95/151 62%, Gaps = 6/151 3%
Query  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG  ++  E TS +   ++F+  VLD D +IPK A  A KS E+ +GDGG GT++ I + 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVA---SGSGSVIKST 117
            EGS  + +  R D V+KE + Y  +VI+GD +   IE I  ET +V    +  GS+ K+T
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTT 117
Query  118  SHYHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAH 154
            + +HTK D  + EE++K    + + LFK IE YL+A+
Sbjct  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 95.5 bits 339,  Expect = 4e-22
 Identities = 76/99 76%, Positives = 84/99 84%, Gaps = 40/99 40%
Query  22   AFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGEGSTYSYVKHRIDGVDKENFV 81
            AFVLDADNLIPK                      KI FGEGS Y YVK            
Sbjct  1    AFVLDADNLIPK----------------------KITFGEGSQYGYVK------------ 26
Query  82   YKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSHYHTKSDVEIKEEHVKAGKEKA 140
                 +EGDA+S+T+EKI YETKLV A  S ++IK+TS YHTK DVEIKEEHVKAGKEKA
Sbjct  27   -----VEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 81
Query  141  SHLFKLIENYLLAHSDAYN 159
            +HLFKLIE YL  H   YN
Sbjct  82   AHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 64.5 bits 217,  Expect = 5e-13
 Identities = 32/49 65%, Positives = 41/49 83%, Gaps = 0/49 0%
Query  2    GVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGG 50
            GVF +E++ TSVI PARLF A+ LD+DNLI K+ PQA+KS EI+EG+GG
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 55.6 bits 188,  Expect = 8e-10
 Identities = 44/144 30%, Positives = 74/144 51%, Gaps = 6/144 4%
Query  4    FNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGEGS 63
            FN +TE++  +    L+  +  D   ++PK+ P+ VK  +++EGDGGVGTI   NF    
Sbjct  5    FNTQTELSVRLEA--LWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEV 62
Query  64   TYSYVKHRIDGVDKENFVYKYSVIEGDAISETIE--KISYETKLVASGSGSVIKSTSHYH 121
            + SY +  I   D+ +      VIEG  +++ +   K +++   +      V    S+ H
Sbjct  63   SPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDH 122
Query  122  TKSDVEIKEEHVKAGKEKASHLFKLIENYL 151
              SD+E K    K  +    +L +L E YL
Sbjct  123  D-SDIEEKVTPTKTSQSTLMYLRRL-ERYL 150

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 39.4 bits 118,  Expect = 8e-06
 Identities = 18/24 75%, Positives = 21/24 87%, Gaps = 0/24 0%
Query  2    GVFNYETEFTSVIPPARLFNAFVL 25
            GVF +E++ TSVIPPARLF AFVL
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.